_id
stringlengths 24
24
| title
stringlengths 5
149
| content
stringlengths 74
164k
| clean_content
stringlengths 35
156k
|
|---|---|---|---|
619c1a583a71d948b79f4f72 | Does the word ‘ladies’ make you feel unsafe? | pthe post a relnofollow hrefhttpswwwspikedonlinecom20211122doesthewordladiesmakeyoufeelunsafedoes the word ladies make ltemyoultem feel unsafea appeared first on a relnofollow hrefhttpswwwspikedonlinecomspikedap | pthe post relnofollow hrefhttpswwwspikedonlinecom20211122doesthewordladiesmakeyoufeelunsafedoes word ladies ltemyoultem feel unsafea appeared relnofollow hrefhttpswwwspikedonlinecomspikedap |
619c1a613a71d948b79f4f74 | Should we bring back woolly mammoths? My long-read Q&A with Beth Shapiro | pstrongby james pethokoukis and beth shapirostrongp
pfrom gmos to emjurassic parkem americans have been told that scientists attempts to alter nature are a recent and dangerous development but humans have been adapting our environment to suit our needs for millennia and while humans and our technologies can have a destructive influence on the ecologies we inhabit the latest scientific tools also hold the power to accelerate conservation efforts should we embrace the power of modern science to usher in a less natural future or should we stop messing with things before it is too late to answer that question ive brought on beth shapirop
pbeth is a professor of evolutionary biology at the university of california santa cruz her latest book is ema relnoreferrer noopener hrefhttpswwwamazoncomlifewemadeinnovationredefineddp1786079402 target_blanklife as we made it how 50000 years of human innovation refinedand redefinednatureaemp
diviframe srchttpsplayercaptivatefmepisodebe429c83d2604916944da69b251dc1cciframediv
pwhat follows is a lightly edited transcript of our conversation you can a relnoreferrer noopener hrefhttpswwwaeiorgpodcastbethshapirosyntheticbiologyandconservation target_blankdownloada the episode here and dont forget to subscribe to my podcast on a relnoreferrer noopener hrefhttpspodcastsapplecomuspodcastpoliticaleconomypodcastid589914386mt2 target_blankitunesa or a relnoreferrer noopener hrefhttpswwwstitchercompodcastricochetmoneypoliticswithjimpethokoukis target_blankstitchera tell your friends leave a review p
pstrongpethokoukisstrong strongone of my favorite sciencefiction concepts is terraforming where we go to a moon or a planet and start changing it to make it more suitable for humans but its not just a sciencefiction concept weve actually been doing it for a long long time to this planet changing the ecology and the animals that have been inhabiting that ecology thats something humans have always donestrongp
pshapiro yeah pretty much our role in nature is to terraform the earth to make it more suitable for usp
pstrongwhen i was reading ema relnoreferrer noopener hrefhttpswwwamazoncomlifewemadeinnovationredefineddp1786079402 target_blanklife as we made it how 50000 years of human innovation refined and redefined natureaem the two things that popped in my head were dogs and when my dog is bad i say ah thats the wolf coming out of you youre being very wolflike today and then of course fruits and vegetables if you look at what they used to look like we have paintings of watermelons from 300 years ago they looked very very different even the landscape what we think of as north america changed over the eons as indigenous people changed it so weve always been modifying the environment but why are we so squeamish about that notion going forwardstrongp
pi think what youve been talking about are all these different technologies that our ancestors have been developing and using for tens of thousands of years and we have made huge huge differences to things you mentioned dogs i mean when we think about dogs what we think about really are the things that we have today and the breeds that we have today really are not 10 20 30000 years of innovation these have emerged really in the last couple of hundred years but its clear that weve been manipulating these plants and animals around us for much much longer than thatp
figure classwpblockimageimg alt srchttpswwwaeiorgwpcontentuploads202111shapirolongreadscientistjpgx91208 classwpimage1008615756figcaptionvia twenty20figcaptionfigure
pi think that when people think about whats next this idea that we might be using genetic tools to manipulate dna from organisms directly they see this i think correctly to some extent as something thats different than what weve been doing in the past we have been manipulating dna but we havent really been able to get rid of that element of chance that is evolution as weve been doing this when we take two lineages and we breed them together there is some randomness in how their dna combines and what were trying to do now is really eliminate that sense of randomness to make changes in an organism that we know are going to get into the next generation and then into all the generations that come after that and that makes us feel a little bit squeamish i thinkp
spanspan
pstrongits almost like it should be the opposite before weve been doing this we had that random element and didnt really know what we were doing maybe not thinking very many steps ahead and now we are and now people seem far more worried about itstrongp
pits funny isnt it its like human nature fighting with itself weve been trying forever to become as good at directing evolution and propelling something another organism into the future in exactly the way that we want it to do and now that we finally have the capacity to do this were like wait a minute did we really mean that and its really interesting as you point outp
pstrongbefore we talk about what these technologies can do lets say what these technologies are what is synthetic biologystrongp
pits a sort of catchall phrase synthetic biology refers to the suite of biotechnologies that we have that allow us to directly manipulate the genomes of other species this might include something that we call cisgenic changes so this is a really big important category of differences the idea of cisgenic which means that were making changes within the species or a lineage really within a species and transgenic which means that were moving dna between lineages and the antigmo movement for a long time was focused just on transgenics this idea of moving dna between organisms that might not happen in nature and there really is a huge ethical and technological divide therep
pcisgenic technologies for example can create new organisms or new lineages of organisms by doing things like turning off a gene or turning up a gene or maybe moving genes between lineages things that might be able to admix or hybridize in nature but that would be a little bit messier an example of this because its kind of confusing theres a woman at uc davis alison van eenennaam and shes working with dairy cattle trying to create strains of dairy cattle that naturally dont grow horns and beef cattle angus cattle have a genetic mutation thats existed for several thousand years that was selected for by people that make them not grow horns so her idea is to take that mutation that evolved in beef cattle in angus and transfer it to holstein so that you have this holstein cattle that dont grow hornsp
pthe rationale for this is really an animal rights kind of thing when cattle are born the farmers are often mandated to physically remove the horns because they can injure other cattle and theyre dangerous this is painful and expensive and we dont like it so wouldnt it be better if we had a bunch of dairy cattle that are elite dairy cattle that just dont grow horns you could create that elite dairy cow that doesnt grow horns by just breeding together an angus bull and a dairy cow and then seeing what happens in the future the offspring wouldnt grow horns because they would inherit that allele from their dad the angus cow that makes them not grow horns but they would also have a whole half of their dna come from their dad and the animal would neither be an elite beef cow nor an elite dairy cowp
pand they could get back to this by backbreeding that hybrid individual with dairy cows but it would take generations and over those generations the farmers would be losing money and we wouldve lost all of the selected evolution that people had put into creating that dairy cow but if we can transfer just that one gene to make them not grow horns we maintain this elite dairy cow but it doesnt grow horns so this is an example of a cisgenic change a change that could happen in nature but we can just speed it up using the tools of synthetic biologyp
pstrongand how has this technology advanced over the past lets say seven to 10 yearsstrongp
pthe real advance has come with crispr gene editing which makes it much easier to make the desired changes that you want especially when youre just doing cisgenic changes when all you want to do is turn a gene off that stops something from happening or turn a gene upp
figure classwpblockimageimg alt srchttpswwwaeiorgwpcontentuploads202111shapirolongreadtomatojpgx91208 classwpimage1008615755figcaptionvia twenty20figcaptionfigure
pso theres a good example of this theres recently been a tomato thats been introduced to the market in japan theres a new tomato thats been made where people have figured out that they can turn off the expression of the protein that suppresses the production of the hearthealthy proteins so in essence this tomato just keeps making hearthealthy proteins until theres way more of it than you would get in a normal tomato and thats just by turning off a gene in the tomato there are no genes introduced from other organisms so its a cisgenic genetically modified organism and it could have been produced in nature but we know exactly what to do so we can use these tools of synthetic biology to make this change really quicklyp
pstrongbut biodiversity is more of a global issue how does synthetic biology play into thatstrongp
pyeah so theres been a lot less attention that has gone to thinking about how we might use synthetic biology for conservation and biodiversity preservation than for agriculture and i think that there is tremendous potential here we can use these same tools that we can use to create new lineages of tomatoes or mushrooms or papayas and we can help species to adapt to changes in their environment or habitatp
pa great example here is with corals we know that there are some populations of corals that are better able to survive in warmer waters than others if we could discover what it is genetically that makes these corals better able to survive in warmer waters perhaps we could move those genes using the tools of synthetic biology into other coral populations or even species giving them a better chance to be able to survive in what is a warming environmentp
panother great example is the blackfooted ferret this is an amazing project that is being led by a relnoreferrer noopener hrefhttpsreviverestoreorgprojectsblackfootedferret target_blankrevive amp restorea which is a biotechbased conservation nonprofit that is based in sausalito and they have been working with us fish and wildlife and the san diego frozen zoo for some time to figure out whether we can use the tools of synthetic biology to help to save the blackfooted ferrets this is a cute little predator that lives across the midwestern plains and everybody thought that it was extinct for some time it was in fact one of the first species that was listed when the endangered species act first came into existence there was a population that was living at the time and people brought it into captive environments to try to figure out whether they could help it breed and they never could they couldnt figure out what to do and the captive population eventually went extinct and people thought that the species was gonep
pand then in the 80s a population was discovered near meeteetse wyoming and this gave everybody a second shot at figuring out how to help blackfooted ferrets reproduce and survive in captivity so they could try to come up with a program to reestablish them across their native range and this was great for some time until they noticed that the wild population started looking very sick and in a last ditch effort to save them they brought the remaining individuals they could find into captivity they had better luck this time they did manage to solve some of the problems that were plaguing the previous captive breeding program and figure out how to make the animals breed in captivityp
pbut there remained a problem and that was that whenever these captively bred individuals were released into the environment they ate a prairie dog because thats what they do and they got plague from eating this prairie dog and they died now theres a vaccine against the sylvatic plague but vaccinating individuals and releasing them into their habitat and capturing them and revaccinating them is not a sustainable program so revive amp restore and fish and wildlife and other stakeholders thought is there another way that we can help these animals is there a tool from our synthetic biology toolbox that might work and in fact there are several tools that these teams are now workingp
pthe first is theres very little genetic diversity in the existing captively bred population and therefore the existing wild population in fact only seven founder individuals are contributing genetic diversity to all blackfooted ferrets that are alive today but in the san diego frozen zoo they had tissue samples frozen tissue from individuals from the previous captive breeding program which was from a different population than the one that was discovered near meeteetse wyoming in the 80s and about a year ago this team of researchers managed to use that frozen tissue to clone an individual and elizabeth ann a baby blackfooted ferret was born from 30yearold frozen tissue that was preserved at the frozen zoo and when she reaches reproductive maturity she will make an eighth founder individual to this population and because her genetic diversity is from a different population this will be a welcome increase in diversity that will hopefully give them a better chance to survive in the wildp
ptheres also another potential solution that revive amp restore and fish and wildlife and their partners are looking into and that is that the cousin of blackfooted ferrets which is the domestic ferret is naturally immune to plague they evolved in europe alongside plague and they have some natural immunity to it so theyre working to discover what the genetic underpinning of this natural immunity to plague is and once this is known their plan is to use gene editing to introduce that natural immunity from domestic ferrets into the captive population of wild blackfooted ferrets and in doing so they will have created a blackfooted ferret that is mostly blackfooted ferret with a little bit of dna from the domestic ferret that allows them to survive when they get released into the wild and come into contact with plague so these are just some examples of how we might use synthetic biology for conservationp
figure classwpblockimageimg alt srchttpswwwaeiorgwpcontentuploads202111shapirolongreadferretjpgx91208 classwpimage1008615763figcaptionone of the five blackfooted ferrets released on the walker ranch in pueblo west checks out the new territory on friday november 19 2021 via reutersfigcaptionfigure
pstrongim originally from chicago and we used to live back there and every once in a while i would take my kids i would drive them by the house i grew up in and id always say thats the house but it didnt look like this this area because when i was a kid we had these huge elm trees on our block but then they all got dutch elm disease and they had to cut them all down then they planted these really horrible replacement trees could we bring back those elm trees but make them disease resistant is that the kind of thing people are working onstrongp
pyeah thats exactly the kind of thing people are working on in fact there is one organism and its a tree that is the furthest along in using synthetic biology to try to help to restore ecosystems that used to exist and thats the american chestnut tree american chestnut trees were once the dominant tree in eastern forests across north america but there was a fungus a blight that was introduced from asia in the early part of the 20th century or late 19th century and within just a few decades millions all of the american chestnut trees were mostly dead some roots and shoots would survive underground but as soon as they grew up and became large enough for the fungus to start to attack them again they would also diep
pand theres a team out of suny in new york led by bill powell that have been working to try to figure out how they could use synthetic biology to save the american chestnut tree the bits that are left and what this fungus does is it releases an acid into the bark of the tree into the trunk of the tree that burns holes through the tree through which the fungus can then proliferate but lots of plants deal with this sort of acidsecreting fungi and they have evolved ways of doing thisp
pso they looked to some other plants and found a gene in wheat that produces an enzyme that neutralizes the acid so it doesnt kill the fungus iit just stops it from being able to burn the tree up from the inside and theyve introduced this gene from wheat into american chestnut trees and now they have this fungusresistant american chestnut tree that is capable of surviving alongside the fungus that is actually all over the place right now they have trees that are still alive underground and there are also stands of american chestnut trees that people planted as they moved from the east across the country in the 18th and 19th centuries so they have tons of diversity of american chestnut trees out there that they can breed this wheat based resistance intop
pand now they have these trees its called the darling lineage its amazing and theyre currently going through this process of approval through the epa the usda and the fda when it is approved or shown to be safe and i have high hopes that it will be it will be the first genetically modified organism that has been produced specifically for the purposes of ecological restoration and saving a species that is really on the path to becoming extinct without this technologyp
pstrongwe are almost 20 minutes into this and i have shown great restraint in not asking you about woolly mammoths what are we doing with woolly mammoths and why are we doing itstrongp
pwell theres a lot of excitement about the possibility of bringing species back that are gonep
pstrongdeextinctionstrongp
pdeextinction yes my enthusiasm for this is tempered a bit we have so much to do to help species that are still alive today to be able to live and with all of the technological ecological and ethical challenges that come with bringing something back i prefer to focus on how we might use these technologies to maintain the biodiversity that exists today but everybody wants to talk about mammoths so im happy to do sop
pand there are lots of technical challenges here first of all everybody wants to know can we clone a mammoth the answer to that is no because in order to clone something using the same technologies that brought us dolly the sheep and elizabeth ann the blackfooted ferret you need living tissue the tissue that was used to clone elizabeth ann was still alive it was in deep freeze but it was still alive and there isnt any mammoth tissue that is still alive so were not going to be able to clone a mammothp
pthe next thing that one might do and this is what george churchs group was doing and the new company a relnoreferrer noopener hrefhttpscolossalcommammoth target_blankcolossala thats just been formed by george church and tech entrepreneur ben lamb intends to do they would take the dna sequences that we have from several different mammoths that people have been able to extract and reassemble from preserved remains of mammoths from across their former range and compare that to the genome sequence of the asian elephant we know theres about a million and a half dna letter differences between mammoths and asian elephants and their idea is that they will either make all or some important subset of those differences using the tools of gene editing to asian elephant cells that are growing in a dish in a lab and they can just tweak those cells a little bit at a time until theyre asian elephant cells that contain a mammoth genome or an approximate mammoth genome rather than asian elephant cells that contain an elephant genomep
pand then you have a living cell that you could clone assuming that you could clone an elephant which we cant do right now theres lots of technological challenges there but george and colossals idea is that they will build an artificial womb that will be capable of growing a mammoth for the two years of gestation p
pstrongthat sounds like an added level of complexitystrongp
pan added level of complexity for sure and then they would release these animals into the arctic tundra where they will live happily ever afterp
pstrongnow theres a supposed anticlimate change purpose here rightstrongp
pwell george has liked to say hes been working with this russian scientist called sergey zimov who has an enclosure up in northeastern siberia that he calls a relnoreferrer noopener hrefhttpspleistoceneparkru target_blankpleistocene parka pleistocene park is the geological epoch during which we had things like mammoths etc so hes clearly riffing off jurassic park here but thinking ice age rather than dinosaurs and sergey has shown that where you have animals and he has horses bison deer and muskox out in pleistocene park they push the snow away from the surface of the dirt during the winter because theyre looking for grass that they can eatp
figure classwpblockimageimg alt srchttpswwwaeiorgwpcontentuploads202111shapirolongreadzimovjpgx91208 classwpimage1008615761figcaptionsergey zimov checks for permafrost at the pleistocene park reutersmaxim shemetovfigcaptionfigure
pand in doing so they expose the surface of that dirt to the really cold winter air in siberia but without the animals the snow stays on top of the surface and snow is a really efficient insulator and it keeps in all that warmth that was trapped in the dirt during the summer so with the animals there the dirt gets colder and without the animals the dirt stays warmer so the idea is to bring in these animals and theyll push the snow away the dirt will get colder and the permafrost will stop melting and that will stop the release of methane and other greenhouse gases into the atmospherep
pnow i think you would need a ton of mammoths and elephants and woolly rhinos and whatever youre going to have up there to make much of a difference and so i think its a little unfair to broadcast this as a solution to what is clearly a way more pressing problem than we can solve by hundreds of years from now having populations of woolly mammoths wandering around siberiap
pbut i am excited about colossal this company thats just been formed despite not being particularly enthusiastic about bringing mammoths back to life because one of the things that those of us working in synthetic biology for conservation always get is blamed for taking money away from other approaches to conservation that have a better chance at workingp
pfirst of all thats not fair this is not a zerosum game the same people who are going to give money to biotech for conservation are not going to give money to save the panda or something like this its a different source of funds and we can say that until were blue in the face and nobody believes us but now theres colossal and its obvious that were right this is new money into conservation and they i have no doubt are going to make tremendous strides in developing tools ideas and approaches that are going to be useful to make this suite of tools something that we really can apply to solving the biodiversity and extinction crisis thats going on right now so i am super excited about the establishment of this company and the new source of money and the new source of ideas that are going to go into developing tools that we can use to save species populations and ecosystems that are in danger todayp
pstrongnow if i were going to make a movie about how all this goes terribly terribly wrong strongp
poh its already been made come onp
pstrong with unintended consequences and the mosquitoes that we engineer to not give us malaria actually give us something worse i would include a very enthusiastic character like yourselfstrongp
pim not saying we should absolutely run at this without bothering to evaluate what the risks might be obviously with new tools and new things like this there are new risksp
pstrongwell whats the alternative i guess rightstrongp
pyeah exactlyp
pstrongwhat do conservation efforts look like if we just eschew this technology we reject itstrongp
pi think clearly there are risks associated with adopting new technologies but to my mind there is a far greater risk with being so scared of these technologies that we dont at least allow ourselves to have this conversation to start to think as a global community of stakeholders that are normal citizens scientists business people government agencies and indigenous groups we should as a group care about the future of the biodiversity on this planet and if we just wholeheartedly reject these technologies because were afraid of some unintended consequences that might be were also rejecting the intended consequence which is to maintain a planet that is both biodiverse and has the capacity to support a whole bunch of people and i think thats the future we want to live inp
pstrongi dont understand the plan bstrongp
pmaybe its full circle here plan b is terraforming a different planet lets start somewherep
pstrongwe can either go to a different planet or we can have a radically different life here it just does not seem realistic to me if you care about the environment you worry about sustainability and biodiversity the technology here may have been a stressor on the planet but its also i think the only realistic path forward you cant go backwards you just need to keep going forwardstrongp
pyeah the only way to preserve nature may be to use these tools and make it just a little bit less what most people might call naturalp
pstrongis there something you need for public policy are there regulations or do you need more funding is there anything in those areasstrongp
peverything yeah i mean the establishment of colossal is a good step to actually generating some funding thats going to go toward thinking about these things but we need groups that are really interested in having the hard conversations about who gets to make these decisions and how far can we go we really do need to start thinking as a global society one of the biggest problems with all genetic modification or synthetic biology whether its biodiversity or agriculture is that the regulatory pathways are so different in different parts of the world that its really impossible to know how to proceed and it makes it a very complicated landscape for everybody except the richest industries to try to navigate which then just feeds back into the lack of trust that people have because it seems to be a technology that only these big rich companies can get into and this is partly because weve been so nervous about this that weve made it so difficult for anybody else to break throughp
pi mean look at what has happened with golden rice where everybodys like golden rice is a terrible thing and greenpeace is burning down the crops of golden rice in the philippines where so many children go blind and then eventually die from vitamin a deficiency and people are like thats because its big business its not its an entirely academic venture nothing is intended to be sold for profit this is a really great thing that could save childrens lives but the way that we think about this is just so messed up because of our fear and our mistrustp
pstrongwhere does that come fromstrongp
pwell it comes from the antigmo movement that started very early in the days and part of that is scientists fault because people in the early days of these technologies were so reticent to do something that seemed like they werent appropriately calculating risk that people who were opposed to this idea just glommed onto this idea that scientists thought that this was scary all because scientists just wanted to do this the right way they have fed this idea that oh look even the scientists are so scared of this we really shouldnt be doing it but it was appropriate hesitancy i think that has been mischaracterized and misconstruedp
figure classwpblockimageimg alt srchttpswwwaeiorgwpcontentuploads202111shapirolongreadgmoprotestjpgx91208 classwpimage1008615757figcaptionactivists protest against the production of herbicides and gmo genetically modified organisms food products outside monsanto headquarters reuterskate munschfigcaptionfigure
pand now its very hard to find truth in conversations about genetic engineering and gene editing technologies online because theres such a loud voice of a minority of people who are deliberately spreading misinformation to keep people scared and i worry about that i think that this is really to our global detriment as a society i dont really know how to get beyond this other than having louder voices that are trying to have conversations with all of the stakeholders to make people really understand whats going onp
pbut i mean look at the mess that were in with vaccines and i dont know how to do this with our global community right now one of the ways might be to think about the past and the present and really think more about how this isnt a sudden shift into people controlling nature weve been controlling nature for a really long time yes its the new suite of technologies that allows us to do things at a more rapid pace but this is also a pace that might be the only thing that lets us keep up with the pace of the crises that the world is going throughp
pstrongmy guest today has been beth shapiro beth thanks a lot for coming on the podcaststrongp
pthank youp
pemjames pethokoukis is the dewitt wallace fellow at the american enterprise institute where he writes and edits the aeideas blog and hosts a weekly podcast a relnoreferrer noopener hrefhttpswwwaeiorgtagpoliticaleconomypodcast target_blankpolitical economy with james pethokoukisa beth shapiro is a professor of evolutionary biology at the university of california santa cruzem p
p divpstronglearn more stronga hrefhttpswwwaeiorgeconomicslookingbackonthespaceracemylongreadqawithjohnlogsdonlooking back on the space race my longread qampa with john logsdona a hrefhttpswwwaeiorgeconomicsthetechnooptimismofworldsfairsmylongreadqawithcharlespappasthe technooptimism of worlds fairs my longread qampa with charles pappasa a hrefhttpswwwaeiorgeconomicswilltaxingbillionaireshelpdemocratsbuildbackbettermylongreadqawithkylepomerleauwill taxing billionaires help democrats build back better my longread qampa with kyle pomerleauapdiv br
pthe post a relnofollow hrefhttpswwwaeiorgeconomicsshouldwebringbackwoollymammothsmylongreadqawithbethshapiroshould we bring back woolly mammoths my longread qampa with beth shapiroa appeared first on a relnofollow hrefhttpswwwaeiorgamerican enterprise institute aeiap | pstrongby james pethokoukis beth shapirostrongp pfrom gmos toemjurassic parkem americans told scientists attempts alter nature recentand dangerousdevelopment humans adapting environment suit needs millennia humans technologies destructive influence ecologies inhabit latest scientific tools hold power accelerate conservation effortsshould embrace power modern science usher ina natural future stop messing withthings late answer question ive brought beth shapirop pbeth professor evolutionary biology university california santa cruz latest book isema relnoreferrer noopener hrefhttpswwwamazoncomlifewemadeinnovationredefineddp1786079402 target_blanklife ithow 50000 years human innovation refinedand redefinednatureaemp diviframe srchttpsplayercaptivatefmepisodebe429c83d2604916944da69b251dc1cciframediv pwhat follows lightly edited transcript conversation cana relnoreferrer noopener hrefhttpswwwaeiorgpodcastbethshapirosyntheticbiologyandconservation target_blankdownloadathe episode dont forget subscribe podcast ona relnoreferrer noopener hrefhttpspodcastsapplecomuspodcastpoliticaleconomypodcastid589914386mt2 target_blankitunesaora relnoreferrer noopener hrefhttpswwwstitchercompodcastricochetmoneypoliticswithjimpethokoukis target_blankstitchera tell friends leave review p pstrongpethokoukisstrong strongone favorite sciencefiction concepts terraforming moon planet start changing suitable humans sciencefiction concept weve actually long long time planet changing ecology animals inhabiting ecology thats humans donestrongp pshapiro yeah pretty role nature terraform earth suitable usp pstrongwhen reading ema relnoreferrer noopener hrefhttpswwwamazoncomlifewemadeinnovationredefineddp1786079402 target_blanklife 50000 years human innovation refined redefined natureaem things popped head dogs dog bad ah thats wolf coming youre wolflike today course fruits vegetables look look like paintings watermelons 300 years ago looked different landscape think north america changed eons indigenous people changed weve modifying environment squeamish notion going forwardstrongp pi think youve talking different technologies ancestors developing tens thousands years huge huge differences things mentioned dogs mean think dogs think things today breeds today 10 20 30000 years innovation emerged couple years clear weve manipulating plants animals longer thatp figure classwpblockimageimg alt srchttpswwwaeiorgwpcontentuploads202111shapirolongreadscientistjpgx91208 classwpimage1008615756figcaptionvia twenty20figcaptionfigure pi think people think whats idea genetic tools manipulate dna organisms directly think correctly extent thats different weve past manipulating dna havent able rid element chance evolution weve lineages breed randomness dna combines trying eliminate sense randomness changes organism know going generation generations come makes feel little bit squeamish thinkp spanspan pstrongits like opposite weve random element didnt know maybe thinking steps ahead people far worried itstrongp pits funny isnt like human nature fighting weve trying forever good directing evolution propelling organism future exactly way want finally capacity like wait minute mean interesting point outp pstrongbefore talk technologies lets technologies synthetic biologystrongp pits sort catchall phrase synthetic biology refers suite biotechnologies allow directly manipulate genomes species include cisgenic changes big important category differences idea cisgenic means making changes species lineage species transgenic means moving dna lineages antigmo movement long time focused transgenics idea moving dna organisms happen nature huge ethical technological divide therep pcisgenic technologies example create new organisms new lineages organisms things like turning gene turning gene maybe moving genes lineages things able admix hybridize nature little bit messier example kind confusing theres woman uc davis alison van eenennaam shes working dairy cattle trying create strains dairy cattle naturally dont grow horns beef cattle angus cattle genetic mutation thats existed thousand years selected people grow horns idea mutation evolved beef cattle angus transfer holstein holstein cattle dont grow hornsp pthe rationale animal rights kind thing cattle born farmers mandated physically remove horns injure cattle theyre dangerous painful expensive dont like wouldnt better bunch dairy cattle elite dairy cattle dont grow horns create elite dairy cow doesnt grow horns breeding angus bull dairy cow seeing happens future offspring wouldnt grow horns inherit allele dad angus cow makes grow horns half dna come dad animal elite beef cow elite dairy cowp pand backbreeding hybrid individual dairy cows generations generations farmers losing money wouldve lost selected evolution people creating dairy cow transfer gene grow horns maintain elite dairy cow doesnt grow horns example cisgenic change change happen nature speed tools synthetic biologyp pstrongand technology advanced past lets seven 10 yearsstrongp pthe real advance come crispr gene editing makes easier desired changes want especially youre cisgenic changes want turn gene stops happening turn gene upp figure classwpblockimageimg alt srchttpswwwaeiorgwpcontentuploads202111shapirolongreadtomatojpgx91208 classwpimage1008615755figcaptionvia twenty20figcaptionfigure pso theres good example theres recently tomato thats introduced market japan theres new tomato thats people figured turn expression protein suppresses production hearthealthy proteins essence tomato keeps making hearthealthy proteins theres way normal tomato thats turning gene tomato genes introduced organisms cisgenic genetically modified organism produced nature know exactly use tools synthetic biology change quicklyp pstrongbut biodiversity global issue synthetic biology play thatstrongp pyeah theres lot attention gone thinking use synthetic biology conservation biodiversity preservation agriculture think tremendous potential use tools use create new lineages tomatoes mushrooms papayas help species adapt changes environment habitatp pa great example corals know populations corals better able survive warmer waters discover genetically makes corals better able survive warmer waters genes tools synthetic biology coral populations species giving better chance able survive warming environmentp panother great example blackfooted ferret amazing project led relnoreferrer noopener hrefhttpsreviverestoreorgprojectsblackfootedferret target_blankrevive amp restorea biotechbased conservation nonprofit based sausalito working fish wildlife san diego frozen zoo time figure use tools synthetic biology help save blackfooted ferrets cute little predator lives midwestern plains everybody thought extinct time fact species listed endangered species act came existence population living time people brought captive environments try figure help breed couldnt figure captive population eventually went extinct people thought species gonep pand 80s population discovered near meeteetse wyoming gave everybody second shot figuring help blackfooted ferrets reproduce survive captivity try come program reestablish native range great time noticed wild population started looking sick ditch effort save brought remaining individuals find captivity better luck time manage solve problems plaguing previous captive breeding program figure animals breed captivityp pbut remained problem captively bred individuals released environment ate prairie dog thats got plague eating prairie dog died theres vaccine sylvatic plague vaccinating individuals releasing habitat capturing revaccinating sustainable program revive amp restore fish wildlife stakeholders thought way help animals tool synthetic biology toolbox work fact tools teams workingp pthe theres little genetic diversity existing captively bred population existing wild population fact seven founder individuals contributing genetic diversity blackfooted ferrets alive today san diego frozen zoo tissue samples frozen tissue individuals previous captive breeding program different population discovered near meeteetse wyoming 80s year ago team researchers managed use frozen tissue clone individual elizabeth ann baby blackfooted ferret born 30yearold frozen tissue preserved frozen zoo reaches reproductive maturity eighth founder individual population genetic diversity different population welcome increase diversity hopefully better chance survive wildp ptheres potential solution revive amp restore fish wildlife partners looking cousin blackfooted ferrets domestic ferret naturally immune plague evolved europe alongside plague natural immunity theyre working discover genetic underpinning natural immunity plague known plan use gene editing introduce natural immunity domestic ferrets captive population wild blackfooted ferrets created blackfooted ferret blackfooted ferret little bit dna domestic ferret allows survive released wild come contact plague examples use synthetic biology conservationp figure classwpblockimageimg alt srchttpswwwaeiorgwpcontentuploads202111shapirolongreadferretjpgx91208 classwpimage1008615763figcaptionone blackfooted ferrets released walker ranch pueblo west checks new territory friday november 19 2021 reutersfigcaptionfigure pstrongim originally chicago live kids drive house grew id thats house didnt look like area kid huge elm trees block got dutch elm disease cut planted horrible replacement trees bring elm trees disease resistant kind thing people working onstrongp pyeah thats exactly kind thing people working fact organism tree furthest synthetic biology try help restore ecosystems exist thats american chestnut tree american chestnut trees dominant tree eastern forests north america fungus blight introduced asia early 20th century late 19th century decades millions american chestnut trees dead roots shoots survive underground soon grew large fungus start attack diep pand theres team suny new york led bill powell working try figure use synthetic biology save american chestnut tree bits left fungus releases acid bark tree trunk tree burns holes tree fungus proliferate lots plants deal sort acidsecreting fungi evolved ways thisp pso looked plants found gene wheat produces enzyme neutralizes acid doesnt kill fungus iit stops able burn tree inside theyve introduced gene wheat american chestnut trees fungusresistant american chestnut tree capable surviving alongside fungus actually place right trees alive underground stands american chestnut trees people planted moved east country 18th 19th centuries tons diversity american chestnut trees breed wheat based resistance intop pand trees called darling lineage amazing theyre currently going process approval epa usda fda approved shown safe high hopes genetically modified organism produced specifically purposes ecological restoration saving species path extinct technologyp pstrongwe 20 minutes shown great restraint asking woolly mammoths woolly mammoths itstrongp pwell theres lot excitement possibility bringing species gonep pstrongdeextinctionstrongp pdeextinction yes enthusiasm tempered bit help species alive today able live technological ecological ethical challenges come bringing prefer focus use technologies maintain biodiversity exists today everybody wants talk mammoths im happy sop pand lots technical challenges everybody wants know clone mammoth answer order clone technologies brought dolly sheep elizabeth ann blackfooted ferret need living tissue tissue clone elizabeth ann alive deep freeze alive isnt mammoth tissue alive going able clone mammothp pthe thing george churchs group new company relnoreferrer noopener hrefhttpscolossalcommammoth target_blankcolossala thats formed george church tech entrepreneur ben lamb intends dna sequences different mammoths people able extract reassemble preserved remains mammoths range compare genome sequence asian elephant know theres million half dna letter differences mammoths asian elephants idea important subset differences tools gene editing asian elephant cells growing dish lab tweak cells little bit time theyre asian elephant cells contain mammoth genome approximate mammoth genome asian elephant cells contain elephant genomep pand living cell clone assuming clone elephant cant right theres lots technological challenges george colossals idea build artificial womb capable growing mammoth years gestationp pstrongthat sounds like added level complexitystrongp pan added level complexity sure release animals arctic tundra live happily afterp pstrongnow theres supposed anticlimate change purpose rightstrongp pwell george liked hes working russian scientist called sergey zimov enclosure northeastern siberia calls relnoreferrer noopener hrefhttpspleistoceneparkru target_blankpleistocene parka pleistocene park geological epoch things like mammoths etc hes clearly riffing jurassic park thinking ice age dinosaurs sergey shown animals horses bison deer muskox pleistocene park push snow away surface dirt winter theyre looking grass eatp figure classwpblockimageimg alt srchttpswwwaeiorgwpcontentuploads202111shapirolongreadzimovjpgx91208 classwpimage1008615761figcaptionsergey zimov checks permafrost pleistocene park reutersmaxim shemetovfigcaptionfigure pand expose surface dirt cold winter air siberia animals snow stays surface snow efficient insulator keeps warmth trapped dirt summer animals dirt gets colder animals dirt stays warmer idea bring animals theyll push snow away dirt colder permafrost stop melting stop release methane greenhouse gases atmospherep pnow think need ton mammoths elephants woolly rhinos youre going difference think little unfair broadcast solution clearly way pressing problem solve hundreds years having populations woolly mammoths wandering siberiap pbut excited colossal company thats formed despite particularly enthusiastic bringing mammoths life things working synthetic biology conservation blamed taking money away approaches conservation better chance workingp pfirst thats fair zerosum game people going money biotech conservation going money save panda like different source funds blue face believes theres colossal obvious right new money conservation doubt going tremendous strides developing tools ideas approaches going useful suite tools apply solving biodiversity extinction crisis thats going right super excited establishment company new source money new source ideas going developing tools use save species populations ecosystems danger todayp pstrongnow going movie goes terribly terribly wrong strongp poh come onp pstrong unintended consequences mosquitoes engineer malaria actually worse include enthusiastic character like yourselfstrongp pim saying absolutely run bothering evaluate risks obviously new tools new things like new risksp pstrongwell whats alternative guess rightstrongp pyeah exactlyp pstrongwhat conservation efforts look like eschew technology reject itstrongp pi think clearly risks associated adopting new technologies mind far greater risk scared technologies dont allow conversation start think global community stakeholders normal citizens scientists business people government agencies indigenous groups group care future biodiversity planet wholeheartedly reject technologies afraid unintended consequences rejecting intended consequence maintain planet biodiverse capacity support bunch people think thats future want live inp pstrongi dont understand plan bstrongp pmaybe circle plan b terraforming different planet lets start somewherep pstrongwe different planet radically different life realistic care environment worry sustainability biodiversity technology stressor planet think realistic path forward cant backwards need going forwardstrongp pyeah way preserve nature use tools little bit people naturalp pstrongis need public policy regulations need funding areasstrongp peverything yeah mean establishment colossal good step actually generating funding thats going thinking things need groups interested having hard conversations gets decisions far need start thinking global society biggest problems genetic modification synthetic biology biodiversity agriculture regulatory pathways different different parts world impossible know proceed makes complicated landscape everybody richest industries try navigate feeds lack trust people technology big rich companies partly weve nervous weve difficult anybody break throughp pi mean look happened golden rice everybodys like golden rice terrible thing greenpeace burning crops golden rice philippines children blind eventually die vitamin deficiency people like thats big business entirely academic venture intended sold profit great thing save childrens lives way think messed fear mistrustp pstrongwhere come fromstrongp pwell comes antigmo movement started early days scientists fault people early days technologies reticent like werent appropriately calculating risk people opposed idea glommed idea scientists thought scary scientists wanted right way fed idea oh look scientists scared shouldnt appropriate hesitancy think mischaracterized misconstruedp figure classwpblockimageimg alt srchttpswwwaeiorgwpcontentuploads202111shapirolongreadgmoprotestjpgx91208 classwpimage1008615757figcaptionactivists protest production herbicides gmo genetically modified organisms food products outside monsanto headquarters reuterskate munschfigcaptionfigure pand hard find truth conversations genetic engineering gene editing technologies online theres loud voice minority people deliberately spreading misinformation people scared worry think global detriment society dont know having louder voices trying conversations stakeholders people understand whats going onp pbut mean look mess vaccines dont know global community right ways think past present think isnt sudden shift people controlling nature weve controlling nature long time yes new suite technologies allows things rapid pace pace thing lets pace crises world going throughp pstrongmy guest today beth shapiro beth thanks lot coming podcaststrongp pthank youp pemjames pethokoukis dewitt wallace fellow american enterprise institute writes edits aeideas blog hosts weekly podcast relnoreferrer noopener hrefhttpswwwaeiorgtagpoliticaleconomypodcast target_blankpolitical economy james pethokoukisa beth shapiro professor evolutionary biology university california santa cruzem p p divpstronglearn stronga hrefhttpswwwaeiorgeconomicslookingbackonthespaceracemylongreadqawithjohnlogsdonlooking space race longread qampa john logsdona hrefhttpswwwaeiorgeconomicsthetechnooptimismofworldsfairsmylongreadqawithcharlespappasthe technooptimism worlds fairs longread qampa charles pappasa hrefhttpswwwaeiorgeconomicswilltaxingbillionaireshelpdemocratsbuildbackbettermylongreadqawithkylepomerleauwill taxing billionaires help democrats build better longread qampa kyle pomerleauapdiv br pthe post relnofollow hrefhttpswwwaeiorgeconomicsshouldwebringbackwoollymammothsmylongreadqawithbethshapiroshould bring woolly mammoths longread qampa beth shapiroa appeared relnofollow hrefhttpswwwaeiorgamerican enterprise institute aeiap |
619c1a863a71d948b79f4f7a | The Rittenhouse Trial and the Value of Silence | img altthe rittenhouse trial and the value of silence srchttpswisdomofcrowdslivecontentimages202111wisdomsilencejpgpit might seem decidedly out of step with the times but ive been thinking about the french postmodern philosopher gilles deleuzes a hrefhttpswwwamazoncomnegotiations19721990gillesdeleuzedp0231075812linkcodell1tagshtwitter20linkidd74f1b3d1bfc88f66c122583446b9224languageen_usref_as_li_ss_tlinsistencea that quotthe right to say nothingquot is underappreciated and in its own way quite beautiful not to gratuitously mix high and low culture but justin timberlake echoed this sentiment more recently with the line quotsometimes the greatest way to say something is to say nothing at allquot i was not aware of this or much of anything about justin timberlake until i read emslateems a hrefhttpsslatecomculture202111justintimberlakereckoningbritneyspearsjanetjacksonhtmlbig takedowna of timberlake last nightppwhats interesting about the context of deleuzes quote is that he associates the right to silence with democracy pblockquoterepressive forces dont stop people expressing themselves but rather force them to express themselves what a relief to have nothing to say the right to say nothingblockquotepsilence is resistance in this reading ppas it happens i was also not aware that on november 4 1995 gilles jumped to his death from his apartment window in paris ppi was in france last week including a 5day bout of relative isolation on the island of corsica i had told my airbnb host to disconnect the wifi she did and i told her not to give me any hints about where i might find the router and so i came back to find myself completely unaware of a series of ominous developments in europe particularly the balkans but there was a relief in deciding that i didnt want to know too much because i didnt know enough to actually have an opinion i was then liberated from having a position ppi was not aware also that the trial of kyle rittenhouse was happening which meant that i found myself caught off guard when the verdict was announced what i found most interesting yet unsurprising was the diametrically opposed reactions from people i follow on twitter in part because i write about and think about rightwing thought i go out of my way to follow proper rightwingers and my understanding of the world is richer for it lets just say that they have a very different view of rittenhouse than the folks on quotmy sidequot ppwhat seemed clear to me is that there is no quotrealityquot of what happened the night of august 15 2020 there are a string of facts and those arent so much in doubt how we interpret those facts connect them and contextualize them very much is for example how you feel about open carry lawsrittenhouse was legally carrying a semiautomatic rifleis likely to affect how you view the verdict how you view the protests of summer 2020 and to what extent they were justified and good is likely to shape how you view the overall context in which rittenhouse descended on the streets of kenosha wisconsin that night ppthe trial itself was not about any of these bigger questions as david graham a hrefhttpswwwtheatlanticcomideasarchive202111rittenhousetrialverdictnotguilty620737wrotea in emthe atlantic empblockquote[the trial] couldnt say something about the state of race relations in america the jury could never have rendered a yeaornay verdict on the saturation of guns in american societyblockquotepthe most important questions arent about quotfactsquot they are about values and it is difficult to split the difference on foundational differences regarding the common good as i have a hrefhttpswisdomofcrowdsliveisamericaashittycountrysaida before there is no such thing as quotthe common goodquot or at least not one we can agree onppstrongthe rise and fall of justin timberlakestrongppwhich brings me to justin timberlake since i wasnt aware that his star had fallen in recent yearsempitchforkems a hrefhttpspitchforkcomreviewsalbumsjustintimberlakemanofthewoodsreviewa of his last album emman in the woods emis painful to readi was trying to process a lot of new information in a short amount of time apparently justin or the emidea emof justin as deleuze might sayem emis undergoing a bit of a cultural reckoning so that by itself is quite interesting its not about anything hes done in the last 10 years but rather things he said in the early 2000s that were deemed acceptable then but no longer are ppbasically it all started when timberlake who had an acrimonious breakup with britney spears told a radio show that he had in fact had sex with spears spears virginity subsequently became public fodder she was demeaned and shamed this undermined britneys girlnextdoor aura especially since she had said that she wanted to remain celibate until marriage timberlake would routinely offer up thinlyveiled attacks on britney in his songs most famously in quotcry me a riverquot then there was his role in janet jacksons quotwardrobe malfunctionquot at the 2004 super bowl the onus of a hrefhttpswwwesquirecomentertainmenttva38308619malfunctiondressingdownjanetjacksontruestorythe fallouta fell almost entirely on jackson whose career never quite recovered why was a white male able to escape unscathed and why was a black woman punished for what in hindsight seems like something pretty trivial pphow do we reassess the past in light of new cultural norms cultural revisionism has its dangers of course the standards of rightness are always changing obama opposed gay marriage in 2008 but he supported gay marriage in 2014 can that really mean that obama wasnt a liberal in 2008 but became one just a few years later theres also the tyranny of the tastemaker running with trends particularly those having to do with wokeness that might themselves have to be reassessed in in due time ppall of that said i couldnt finish the a hrefhttpsslatecomculture202111justintimberlakereckoningbritneyspearsjanetjacksonhtmltakedowna of timberlake without thinking that progress is real the 2000s sound awful the bush years were uncurious chaste and conformist for gods sake the dixie chicks were canceled for saying something that a hrefhttpstasteofcountrycomnataliemainesdixiechicksbushcontroversyseems pretty innocuousa in retrospect about george w bush also i find some solace in thinking that it would be difficult for mainstream media outlets to shame britney spears today the way they did in the early 2000sppbut perhaps its more accurate to say that all eras suck they just suck in different ways well likely look back at the woke excess of 2018202 and lament that it could have gotten so bad and we will be right but only up to a point it seems tragic that there is no common good to be had in todays america but quotcommon goodsquot are only possible if there is consensus and the notion of consensus frightens me there is a reason i like quoting the belgian political theorist chantal mouffe on this except on the most obvious things any consensus today is likely to be artificial and imposed consensus is only possible when there is already a consensus and there rarely is all forms of consensus are by necessity based on acts of exclusion she a hrefhttpswwwamazoncomdemocraticparadoxradicalthinkersdp1844673553linkcodell1tagshtwitter20linkidf1d3eb27de3423b5bfbd208e74cddfedlanguageen_usref_as_li_ss_tlnotesappthis might be presentist bias but i would take 2021 over 2003 any dayppstrongwhat im reading and watchingstrongppi absolutely loved the most recent episode of emsuccessionem which includes perhaps for the first time in a major television show and explicit reference to the recent popularization of quotintegralismquot on the catholic right pptheres also this rather amusing quote pblockquotea wellregulated election is a transmission frequency for gods graceblockquotepmeanwhile im belatedly trying to finish richard sterns ema hrefhttpswwwamazoncomothermensdaughtersanoveldpb00rw1cby8refsr_1_2crid1icujws1h71pydchild1keywordsothermensdaughtersqid1627055076sbookssprefixothermensdau2cstripbooks2c150sr12other mens daughtersa emwhich is the third in the triptych of semidepressing novels i set myself out to read over the summer for more context on why see this a hrefhttpswisdomofcrowdslivethetemptationsofwritingablankessaypiecea ppalso for reasons that are not entirely clear to me im currently reading stephen kings ema hrefhttpsamznto3dklo4aon writingaem intriguing subtitled quota memoir of the craftquotpppp a hrefhttpswisdomofcrowdslivemoralityisimpossiblewithoutpowerportalsignup target_blankap | img altthe rittenhouse trial value silence srchttpswisdomofcrowdslivecontentimages202111wisdomsilencejpgpit decidedly step times ive thinking french postmodern philosopher gilles deleuzes hrefhttpswwwamazoncomnegotiations19721990gillesdeleuzedp0231075812linkcodell1tagshtwitter20linkidd74f1b3d1bfc88f66c122583446b9224languageen_usref_as_li_ss_tlinsistencea quotthe right nothingquot underappreciated way beautiful gratuitously mix high low culture justin timberlake echoed sentiment recently line quotsometimes greatest way allquot aware justin timberlake read emslateems hrefhttpsslatecomculture202111justintimberlakereckoningbritneyspearsjanetjacksonhtmlbig takedowna timberlake nightppwhats interesting context deleuzes quote associates right silence democracy pblockquoterepressive forces dont stop people expressing force express relief right nothingblockquotepsilence resistance reading ppas happens aware november 4 1995 gilles jumped death apartment window paris ppi france week including 5day bout relative isolation island corsica told airbnb host disconnect wifi told hints find router came find completely unaware series ominous developments europe particularly balkans relief deciding didnt want know didnt know actually opinion liberated having position ppi aware trial kyle rittenhouse happening meant found caught guard verdict announced found interesting unsurprising diametrically opposed reactions people follow twitter write think rightwing thought way follow proper rightwingers understanding world richer lets different view rittenhouse folks quotmy sidequot ppwhat clear quotrealityquot happened night august 15 2020 string facts arent doubt interpret facts connect contextualize example feel open carry lawsrittenhouse legally carrying semiautomatic rifleis likely affect view verdict view protests summer 2020 extent justified good likely shape view overall context rittenhouse descended streets kenosha wisconsin night ppthe trial bigger questions david graham hrefhttpswwwtheatlanticcomideasarchive202111rittenhousetrialverdictnotguilty620737wrotea emthe atlantic empblockquote[the trial] couldnt state race relations america jury rendered yeaornay verdict saturation guns american societyblockquotepthe important questions arent quotfactsquot values difficult split difference foundational differences common good hrefhttpswisdomofcrowdsliveisamericaashittycountrysaida thing quotthe common goodquot agree onppstrongthe rise fall justin timberlakestrongppwhich brings justin timberlake wasnt aware star fallen recent yearsempitchforkems hrefhttpspitchforkcomreviewsalbumsjustintimberlakemanofthewoodsreviewa album emman woods emis painful readi trying process lot new information short time apparently justin emidea emof justin deleuze sayem emis undergoing bit cultural reckoning interesting hes 10 years things said early 2000s deemed acceptable longer ppbasically started timberlake acrimonious breakup britney spears told radio fact sex spears spears virginity subsequently public fodder demeaned shamed undermined britneys girlnextdoor aura especially said wanted remain celibate marriage timberlake routinely offer thinlyveiled attacks britney songs famously quotcry riverquot role janet jacksons quotwardrobe malfunctionquot 2004 super bowl onus hrefhttpswwwesquirecomentertainmenttva38308619malfunctiondressingdownjanetjacksontruestorythe fallouta fell entirely jackson career recovered white male able escape unscathed black woman punished hindsight like pretty trivial pphow reassess past light new cultural norms cultural revisionism dangers course standards rightness changing obama opposed gay marriage 2008 supported gay marriage 2014 mean obama wasnt liberal 2008 years later theres tyranny tastemaker running trends particularly having wokeness reassessed time ppall said couldnt finish hrefhttpsslatecomculture202111justintimberlakereckoningbritneyspearsjanetjacksonhtmltakedowna timberlake thinking progress real 2000s sound awful bush years uncurious chaste conformist gods sake dixie chicks canceled saying hrefhttpstasteofcountrycomnataliemainesdixiechicksbushcontroversyseems pretty innocuousa retrospect george w bush find solace thinking difficult mainstream media outlets shame britney spears today way early 2000sppbut accurate eras suck suck different ways likely look woke excess 2018202 lament gotten bad right point tragic common good todays america quotcommon goodsquot possible consensus notion consensus frightens reason like quoting belgian political theorist chantal mouffe obvious things consensus today likely artificial imposed consensus possible consensus rarely forms consensus necessity based acts exclusion hrefhttpswwwamazoncomdemocraticparadoxradicalthinkersdp1844673553linkcodell1tagshtwitter20linkidf1d3eb27de3423b5bfbd208e74cddfedlanguageen_usref_as_li_ss_tlnotesappthis presentist bias 2021 2003 dayppstrongwhat im reading watchingstrongppi absolutely loved recent episode emsuccessionem includes time major television explicit reference recent popularization quotintegralismquot catholic right pptheres amusing quote pblockquotea wellregulated election transmission frequency gods graceblockquotepmeanwhile im belatedly trying finish richard sterns ema hrefhttpswwwamazoncomothermensdaughtersanoveldpb00rw1cby8refsr_1_2crid1icujws1h71pydchild1keywordsothermensdaughtersqid1627055076sbookssprefixothermensdau2cstripbooks2c150sr12other mens daughtersa emwhich triptych semidepressing novels set read summer context hrefhttpswisdomofcrowdslivethetemptationsofwritingablankessaypiecea ppalso reasons entirely clear im currently reading stephen kings ema hrefhttpsamznto3dklo4aon writingaem intriguing subtitled quota memoir craftquotpppp hrefhttpswisdomofcrowdslivemoralityisimpossiblewithoutpowerportalsignup target_blankap |
619c1aba3a71d948b79f4f7e | Chomsky and Pollin: Protests Outside of COP26 Offered More Hope Than the Summit | a hrefhttpstruthoutorgarticleschomskyandpollinprotestsoutsideofcop26offeredmorehopethanthesummitimg sizesmaxwidth 200px 100vw 200px srchttpstruthoutorgwpcontentuploads2021112021_1122chomsky200x108jpg width200 alt srcsethttpstruthoutorgwpcontentuploads2021112021_1122chomsky200x108jpg 200w httpstruthoutorgwpcontentuploads2021112021_1122chomsky400x216jpg 400w httpstruthoutorgwpcontentuploads2021112021_1122chomsky800x431jpg 800w httpstruthoutorgwpcontentuploads2021112021_1122chomskyjpg 1200w classwppostimage height108apthe legacy of the 2021 united nations climate change conference cop26 this fall was perhaps best encapsulated by its president who bowed his head and close to tears actually apologized for the process which ended with a lastminute wateringdown of participants pledges on coalp
pmay i just say to all delegates i apologize for the way this process has unfolded and i am deeply sorry said alok sharma the british politician who served as president for cop26 the conference ended on november 13 with a disheartening compromise deal on the climate after two weeks of negotiations with diplomats from more than 190 nationsp
pin the interview that follows leading public intellectuals noam chomsky and robert pollin offer their assessments of what transpired at cop26 and share their views about ways to go forward with the fight against the climate crisis chomsky one of the most cited scholars in history and long considered one of the uss voices of conscience is institute professor emeritus at the massachusetts institute of technology and currently laureate professor of linguistics and agnese nelms haury chair in the agnese nelms haury program in environment and social justice at the university of arizona he is joined by one of the worlds leading economists of the left robert pollin who is distinguished professor and codirector of the political economy research institute at the university of massachusetts at amherst chomsky and pollin are coauthors of the recently published book emclimate crisis and the global green new deal the political economy to save the planetemem emp
pstrongcj polychroniou cop26 touted as our last best hope to avert a climatic catastrophe has produced an outcome that was a compromise according to united nations secretary general antnio guterres while activists conducted a funeral ceremony at the glasgow necropolis to symbolize the failure of the summit noam can you give us your analysis of the cop26 climate agreementstrongp
pstrongnoam chomskystrong there were two events at glasgow within the stately halls and in the streets they may have not been quite at war but the conflict was sharp within the dominant voice mostly echoed the concerns of the largest contingent corporate lobbyists rather like the us congress where the impact of lobbyists always significant has exploded since the 1970s as the corporaterun neoliberal assault against the general population gained force the voice within had some nice words but little substance in the streets tens of thousands of protesters mostly young were desperately calling for real steps to save the world from looming catastrophep
pthe outcome of this conflict will determine the course of history or more precisely will determine whether future human history will be nasty brutish and short to lift philosopher thomas hobbess words or full of promise and opportunityp
pthe conflict is nicely encapsulated in a hrefhttpsapnewscomarticleclimatejoebidenforestsenvironmentenvironmentandnaturee9ed2edec21e83449dbcad31e412fc71a report of brazils national institute of space researcha it is dated october 27 just a few days before cop26 opened offering space for fine words and eloquent promises about saving the amazon forests a precious resource for brazils future and the worldsp
pthe institute reported that the area deforested in brazils amazon reached a 15year high after a 22 jump from the prior year [an outcome that] flies in the face of [the jair] bolsonaro governments recent attempts to shore up its environmental credibility to put it politelyp
pit was put less politely by spokespersons for brazilian and international environmental organizations we are seeing the amazon rainforest being destroyed by a government which made environmental destruction its public policy this is the real brazil that the bolsonaro government tries to hide with fantastical speeches and actions of greenwashing abroad the reality shows that the bolsonaro government accelerated the path of amazon destructionp
pwithin the halls there were many fantastical speeches while the outside world revealed much that flies in their face within there was great enthusiasm about the 130 trillion that will be provided by financial institutions to rescue us us chief negotiator john kerry was exultant that the market is now on our sidep
phe might be right if we understand the phrase the market to refer not to the fantastical concept that is conjured up in public discourse but to the real world market what robert pollin and gerald epstein call the neoliberal bailout economyp
phow the holy market works in this case is a hrefhttpswwwtheguardiancomcommentisfree2021nov16cop26bigbusinessclimatecrisisneoliberaloutlined by political economist adam toozea lending by the holders of the rescue package of 130 trillion will not be concessional he writesp
blockquote
pthe trillions kerry insisted to his glasgow audience will earn a proper rate of return but how then will they flow to lowincome countries after all if there was a decent chance of making profit by wiring west africa for solar power the trillions would already be at work for that larry fink of blackrock the worlds largest fund manager has a ready answer he can direct trillions towards the energy transition in lowincome countries if the international monetary fund and the world bank are there to derisk the lending by absorbing the first loss on projects in africa latin america and asia even more money will flow if there is a carbon price that gives clean energy a competitive advantagep
blockquote
pit is a neat solution tooze adds the same neat neoliberal solution that has been proffered repeatedly since the 1990s the same solution that has not been delivered and wont be delivered unless the friendly taxpayers excluding the rich who are granted ways to exempt themselves perform their neoliberal duty in the bailout economyp
pothers added their own interpretation of the lofty rhetoric within the halls not least washington we must seize this moment president joe biden declared in glasgow on returning home he a hrefhttpsnewrepubliccomarticle164465bidenadministrationsdrillingauctionshowsparisagreementisntenoughopened the largest oil and gas lease sale in us historya carrying out a program set in motion by former president donald trumpp
pin defense the administration held that it was obligated to proceed because of a preliminary injunction issued by a federal judge in june saying that its proposed pause on new leases would be illegal environmental groups point out a variety of options but the main conclusions stare us in the face the reigning institutions whether federal or judicial are unwilling to take the steps needed to save us from catastrophep
pthreats will mount when as seems likely the denialist party storms back into power having successfully blocked government programs that would help the population but bolster their political opposition along with a flood of lies about saving innocent little children from the critical race theory villains who are teaching them that they are by nature brutal oppressors and whatever other hysteria they can whip upp
pas trump took over sole possession of the republican party the percentage of republicans who regarded global warming as a serious problem a hrefhttpswwwwashingtonpostcomclimateenvironment20211112strongwindsclimatechangehavefailedmoveopinionsmanyamericansutm_campaignwp_post_mostutm_mediumemailutm_sourcenewsletterwpisrcnl_mostcartaurlhttps3a2f2fs2washingtonpostcom2fcarlntr2f35448eb2f618e9f759d2fdab56b86c7f82f5977f250ae7e8a6816e8c2a12f282f722f618e9f759d2fdab56b86c7f8declined from 50 percent to 40 percenta while the proportion of democrats who see climate change as an existential threat rose by 11 points to 95 percent over seven years its not hard to imagine how the wrecker and his minions will gleefully exploit the renewed opportunity to race as quickly as possible toward irreversible tipping points while enriching their corporate mastersp
pthe last best hope in glasgow was not the conference of 120 world leaders but the competing event that was taking place in the streets outside they are the ones who can compel the powerful in government and corporate headquarters to act expeditiously to use the options available to avert the race to destruction and to create a better worldp
pstrongcan we draw hope from the promise made by the countries meeting in glasgow to revisit and strengthen new plans by the end of 2022 or should we interpret this pledge as another way on the part of world leaders to just keep kicking the can down the roadstrongp
pstrongchomskystrong there were a few positive developments within the halls in glasgow though far short of what is urgently needed the question of how to interpret the pledge brings to mind karl marxs a hrefhttpswwwacademiaedu2593729marxs_xi_thesis_on_feuerbach_explainedpop_sutdtrue11th thesis on ludwig feuerbacha the task of those committed to decent survival is not to interpret the pledge but to act to insure that it is more than pious verbiagep
pstrongbob first whats your own assessment of the key outcomes from cop26 and what do you make of the position of those countries which were fiercely opposed to calls for the inclusion of fossil fuels in any final agreement and phasing out coal and fossil fuel subsidies strongp
pstrongrobert pollin strongthe first thing to say about the cop26 conference is that it demonstrated yet again the breathtaking capacity of highlevel diplomats to discuss issues of human survival almost entirely disconnected from reality for example it was considered an achievement of the conference that for the first time the burning of fossil fuels to produce energy was officially recognized as a cause of climate change the only way that we can consider this progress is in relationship to the flatout absurdity that the previous 25 cop agreements had all failed to acknowledge the longestablished reality that burning fossil fuels is responsible for producing about 7580 percent of the greenhouse gases causing climate changep
pbeyond this measure of progress the cop26 diplomats still wrangled over whether they objected emfull stopem to governments providing fossil fuel subsidies or rather whether they objected only to fossil fuel subsidies that are inefficient whatever that means not surprisingly the final document ended up only opposing inefficient subsidies similarly at the very end of the meetings china and india a hrefhttpsperiumasseducomponentk2item1549doesindiahavearighttoburnfossilmanaged to substitute a referencea to phasing emdownem coal rather than the original text that referred to phasing emoutem coalp
pamid such wordparsing exercises the underlying reality is that even with all the pledges made at the last major cop conference cop21 in paris in 2015 almost nothing has been accomplished in terms of reducing co2 emissions thus in its 2021 world energy outlook the international energy agency iea a hrefhttpswwwieaorgreportsworldenergyoutlook2021projects thata according to its stated policies scenario ie a scenario that takes account of all government pledges made at paris along with what they have actually accomplished relative to these pledges global co2 emissions will not fall emat all emas of 2030 and will fall by less than 6 percent as of 2050 from 36 billion tons of emissions today to 339 billion tons as of 2050 this again is within the context of the paris agreements in which all 196 countries committed to stabilizing the global average temperature at 15 degrees celsius 15spancspan above preindustrial levels to succeed in stabilizing the global average temperature at 15spancspan above preindustrial levels the intergovernmental panel on climate change has established that global co2 emissions must fall by 45 percent by 2030 and reach zero emissions by 2050p
pall of this tells us that we will never move on to a viable climate stabilization by relying on the words or pledges agreed to in any such diplomatic documents the only way to move seriously onto a viable climate stabilization path is through grassroots political organizing that forces governments to take actions that they will otherwise never take if there was any good news out of cop26 it is that political organizers were in the streets in glasgow in full force and could not be ignoredp
ptheir presence did force some concessions into the final document about half of the nearly 200 country delegations agreed to cut methane emissions by 30 percent as of 2030 the full body pledged to end deforestation by 2030 the full body also acknowledged with deep regret that the rich countries that are responsible for the climate crisis have not fulfilled their financial pledges to support green transition programs in lowincome countries it remains an open question as to whether this deep regret will lead to serious financing commitments that will actually be met p
pstrongwhy is the transition to clean energy so slow is it a question of lack of investments and technological knowhow or something elsestrongp
pstrongpollinstrong by some metrics the transition to clean energy is proceeding fairly quickly for example as of 1985 solar energy a hrefhttpsourworldindataorgrenewableenergyprovided less than 001 percenta of the worlds electricity supply by 2020 that figure is up to 33 percent this is an increase of nearly 3000 percent in 35 years of course we are starting in 1985 with a miniscule base of solar production more importantly the level of solar supply cant remain stuck in the range of 3 percent of electricity in order to meet the climate goals it rather needs to be in the range of 6070 percent as of 2050p
pa major factor that had prevented the expansion of clean renewable energy from expanding more rapidly had been cost as recently as 2010 the average cost globally of producing a kilowatt of electricity through solar energy was 38 cents as of 2020 the average cost had fallen to less than 7 cents meanwhile the comparative average cost for fossilfuelgenerated electricity has remained stable over this decade at between 515 cents per kilowatt hour in other words solar is now fully costcompetitive with fossil fuels which had not been true previously both onshore and offshore wind are also a hrefhttpswwwirenaorgpublications2021junrenewablepowercostsin2020now fully costcompetitivea with fossil fuels as such when we include energy efficiency investments along with those for renewable energy the overall result is that this clean energy infrastructure can deliver both a zero emissions economy and lower energy costsp
peven with renewable energy costs dropping sharply several critical issues still remain outstanding one is the intermittency of solar and wind power supply that is the sun doesnt shine at night and wind doesnt blow all day everywhere so transmission and storage questions do need to be addressed for example how to deliver windpowered electricity reliably and at low cost from a farm in western pennsylvania to the center of philadelphia a lot of progress is being made toward resolving these issues but also keep in mind that we dont need to solve them completely right now before we can proceed with the clean energy transition we arent going to eliminate the use of fossil fuels next week no matter what we have roughly two decades to develop the transmission and storage technologies that we will need to operate the global economy on 100 percent renewable energy supplyp
panother challenge with building the renewable energy infrastructure is land use this is a serious question that has emerged in many places where do we site the wind turbines and arrays of solar panels without wrecking neighborhoods or natural environments part of the solution is to make as much use as possible of artificial surfaces such as putting solar panels on rooftops or building solar canopies in parking lots such measures are becoming increasingly viable with the costs of even residential solar installations now also reaching cost parity with both fossil fuels as well as utilityscale solar farms a similar pattern is also occurring with offshore wind platformsp
pbroadly speaking then the technology intermittency and land use issues are being addressed effectively despite inadequate levels of government support still we need to find the funds to build this global clean energy infrastructure that is going to require something like 253 percent of global gdp per year ie about 25 trillion next year then averaging about 45 trillion per year between now and 2050 according to figures in our book emclimate crisis and the global green new dealemp
pwhat was clear from cop26 is that government funding at sufficient levels will never be forthcoming without political struggles this is despite the fact that the 25 percent of gdp that is required can be provided readily through some financing combinations that we have discussed previously for example converting all existing fossil fuel subsidies into clean energy subsidies transferring only 510 percent of military spending into clean energy investments or having the major central banks purchasing global green investment bonds such bond purchases could be in the range of 2 percent of the bailout injections that the federal reserve injected into wall street to prevent a financial collapse the covid recessionp
pstrongdemocratic rep alexandria ocasiocortez said that people shouldnt expect international climate summits like cop26 or governments to solve the climate crisis but at the same time defended the green new deal plan how do we realize the goals of the green new deal from below this is a question addressed to both of youstrongp
pstrongchomskystrong how was the new deal realized or any other step forward in human history virtually without exception by dedicated persistent activism this time will not be differentp
pelements are there thanks in no small part to bob pollins active engagement backed by sound analytic work unions are taking up the cause that includes the united mine workers proceeding well ahead of coal baron sen joe manchin a congressional championinreceivingfundingfromfossilfuelindustries who is cooperating with rocksolid republican opposition to steps to reverse the race to destructionp
ptheres ample precedent for organized labor taking the lead as it did in bringing the new deal to fruition one of the earliest environmental activists was tony mazzocchi of the chemical and atomic workers international union workers who are the most immediate victims of poisoning the atmosphere his efforts to form a labor party failed and its not easy in the rigidly monopolized us political system but there are ways to progress even in this domain there are encouraging signs that labor is reviving from the bitter 40year neoliberal assault the mass refusal to return to rotten and dangerous jobs is only one sign the malaise that is leading to an unprecedented wave of deaths of despair in the white working class can and must be overcome and directed to the kind of militant labor action that 90 years ago created a base for social democracy in the us while europe was descending into fascist horror p
pa third of americans overwhelmingly republicans dont even regard global warming let alone the much broader crisis of environmental destruction as a serious problem all must come to recognize soon that it is not only a serious problem but an urgent one and that how we deal with it right now will determine the fate of human life as well as that of the countless species we are casually destroying to achieve that essential goal requires major educational and organizational efforts omitting no sector of the society including those in thrall trumpstyle malevolencep
pin congress rep alexandria ocasiocortez and sen ed markey have reintroduced a 2019 resolution calling for a comprehensive green new deal along the lines of the detailed work of robert pollin and his colleagues and with somewhat different models from economist jeffrey sachs now also backed by the iea local and statelevel initiatives are underway there are major international actions mostly by the youngp
pthats the barest sample theres lots of work to do this is not the time for musing on the sidelinesp
pstrongpollin strongwe need to be organizing at all levels of society to advance the global green new deal project this means fighting to stop any and all communities and institutions from relying on burning fossil fuels to provide energy and to build a zeroemissionsenergy infrastructure through investments in both energy efficiency and clean renewables note that this is distinct from demanding that institutions divest their ownership shares of fossil fuel stock and bonds the divestment movement has played a critical role in raising consciousness about the climate crisis but its effectiveness is limited by the reality that if say a university sells its stocks in exxonmobil those stocks are getting purchased by hedge funds that are happy to buy the stocks at reduced prices the hedge fund will then a hrefhttpswwwnytimescom20211013climateprivateequityfundsoilgasfossilfuelshtml2020httpstruthoutorgarticlesarefossilfueldivestmentcampaignsworkingaconversationwitheconomistrobertpollincontinue to earn dividends from their fossil fuel stocksa as long as people continue to consume oil coal and natural gas to meet their energy needs so the green new deal program must start with the project of ending reliance on fossil fuels and we certainly cant wait for the next cop conference to settle the matter p
pwe then need to be clear that the case for the green new deal is overwhelming at many levels it is the way through which we can realistically get to zero emissions by 2050 the investments to build the clean energy infrastructure will be a major engine of new job opportunities in all regions of the world my coworkers and i have estimated that clean energy investments at about 25 percent of gdp per year would generate for example about a hrefhttpsirpcdnmultiscreensitecom6f2c9f57filesuploadedzerocarbonactionplanch03pdf45 million jobs per year in the usa and about a hrefhttpswwwepwinjournal201542specialarticlesegalitariangreengrowthprogrammeindiahtml20 million jobs in indiaa creating these new jobs will also open opportunities to increase union organizing and raise the pay and benefits associated with these jobs building the clean energy infrastructure will also create new possibilities for smallscale public private and cooperate ownership of renewable energy assets it will eliminate the largest sources of outdoor air pollution and thus significantly raising public health standards the green new deal must critically also be committed to just transition for the workers and communities that are currently dependent on the fossil fuel industry that will need to be phased outp
pin combination these various features of the global green new deal provide a powerful platform for committed and effective organizing the diplomats that argued last week over what may constitute inefficient fossil fuel subsidies will then be forced into finally seeing the reality before their eyes p
pemnote this transcript has been lightly editedemp | hrefhttpstruthoutorgarticleschomskyandpollinprotestsoutsideofcop26offeredmorehopethanthesummitimg sizesmaxwidth 200px 100vw 200px srchttpstruthoutorgwpcontentuploads2021112021_1122chomsky200x108jpg width200 alt srcsethttpstruthoutorgwpcontentuploads2021112021_1122chomsky200x108jpg 200w httpstruthoutorgwpcontentuploads2021112021_1122chomsky400x216jpg 400w httpstruthoutorgwpcontentuploads2021112021_1122chomsky800x431jpg 800w httpstruthoutorgwpcontentuploads2021112021_1122chomskyjpg 1200w classwppostimage height108apthe legacy 2021 united nations climate change conference cop26 fall best encapsulated president bowed head close tears actually apologized process ended lastminute wateringdown participants pledges coalp pmay delegates apologize way process unfolded deeply sorry said alok sharma british politician served president cop26 conference ended november 13 disheartening compromise deal climate weeks negotiations diplomats 190 nationsp pin interview follows leading public intellectuals noam chomsky robert pollin offer assessments transpired cop26 share views ways forward fight climate crisis chomsky cited scholars history long considered uss voices conscience institute professor emeritus massachusetts institute technology currently laureate professor linguistics agnese nelms haury chair agnese nelms haury program environment social justice university arizona joined worlds leading economists left robert pollin distinguished professor codirector political economy research institute university massachusetts amherst chomsky pollin coauthors recently published book emclimate crisis global green new deal political economy save planetemem emp pstrongcj polychroniou cop26 touted best hope avert climatic catastrophe produced outcome compromise according united nations secretary general antnio guterres activists conducted funeral ceremony glasgow necropolis symbolize failure summit noam analysis cop26 climate agreementstrongp pstrongnoam chomskystrong events glasgow stately halls streets war conflict sharp dominant voice echoed concerns largest contingent corporate lobbyists like congress impact lobbyists significant exploded 1970s corporaterun neoliberal assault general population gained force voice nice words little substance streets tens thousands protesters young desperately calling real steps save world looming catastrophep pthe outcome conflict determine course history precisely determine future human history nasty brutish short lift philosopher thomas hobbess words promise opportunityp pthe conflict nicely encapsulated hrefhttpsapnewscomarticleclimatejoebidenforestsenvironmentenvironmentandnaturee9ed2edec21e83449dbcad31e412fc71a report brazils national institute space researcha dated october 27 days cop26 opened offering space fine words eloquent promises saving amazon forests precious resource brazils future worldsp pthe institute reported area deforested brazils amazon reached 15year high 22 jump prior year [an outcome that] flies face [the jair] bolsonaro governments recent attempts shore environmental credibility politelyp pit politely spokespersons brazilian international environmental organizations seeing amazon rainforest destroyed government environmental destruction public policy real brazil bolsonaro government tries hide fantastical speeches actions greenwashing abroad reality shows bolsonaro government accelerated path amazon destructionp pwithin halls fantastical speeches outside world revealed flies face great enthusiasm 130 trillion provided financial institutions rescue chief negotiator john kerry exultant market sidep phe right understand phrase market refer fantastical concept conjured public discourse real world market robert pollin gerald epstein neoliberal bailout economyp phow holy market works case hrefhttpswwwtheguardiancomcommentisfree2021nov16cop26bigbusinessclimatecrisisneoliberaloutlined political economist adam toozea lending holders rescue package 130 trillion concessional writesp blockquote pthe trillions kerry insisted glasgow audience earn proper rate return flow lowincome countries decent chance making profit wiring west africa solar power trillions work larry fink blackrock worlds largest fund manager ready answer direct trillions energy transition lowincome countries international monetary fund world bank derisk lending absorbing loss projects africa latin america asia money flow carbon price gives clean energy competitive advantagep blockquote pit neat solution tooze adds neat neoliberal solution proffered repeatedly 1990s solution delivered wont delivered friendly taxpayers excluding rich granted ways exempt perform neoliberal duty bailout economyp pothers added interpretation lofty rhetoric halls washington seize moment president joe biden declared glasgow returning home hrefhttpsnewrepubliccomarticle164465bidenadministrationsdrillingauctionshowsparisagreementisntenoughopened largest oil gas lease sale historya carrying program set motion president donald trumpp pin defense administration held obligated proceed preliminary injunction issued federal judge june saying proposed pause new leases illegal environmental groups point variety options main conclusions stare face reigning institutions federal judicial unwilling steps needed save catastrophep pthreats mount likely denialist party storms power having successfully blocked government programs help population bolster political opposition flood lies saving innocent little children critical race theory villains teaching nature brutal oppressors hysteria whip upp pas trump took sole possession republican party percentage republicans regarded global warming problem hrefhttpswwwwashingtonpostcomclimateenvironment20211112strongwindsclimatechangehavefailedmoveopinionsmanyamericansutm_campaignwp_post_mostutm_mediumemailutm_sourcenewsletterwpisrcnl_mostcartaurlhttps3a2f2fs2washingtonpostcom2fcarlntr2f35448eb2f618e9f759d2fdab56b86c7f82f5977f250ae7e8a6816e8c2a12f282f722f618e9f759d2fdab56b86c7f8declined 50 percent 40 percenta proportion democrats climate change existential threat rose 11 points 95 percent seven years hard imagine wrecker minions gleefully exploit renewed opportunity race quickly possible irreversible tipping points enriching corporate mastersp pthe best hope glasgow conference 120 world leaders competing event taking place streets outside ones compel powerful government corporate headquarters act expeditiously use options available avert race destruction create better worldp pstrongcan draw hope promise countries meeting glasgow revisit strengthen new plans end 2022 interpret pledge way world leaders kicking roadstrongp pstrongchomskystrong positive developments halls glasgow far short urgently needed question interpret pledge brings mind karl marxs hrefhttpswwwacademiaedu2593729marxs_xi_thesis_on_feuerbach_explainedpop_sutdtrue11th thesis ludwig feuerbacha task committed decent survival interpret pledge act insure pious verbiagep pstrongbob whats assessment key outcomes cop26 position countries fiercely opposed calls inclusion fossil fuels final agreement phasing coal fossil fuel subsidies strongp pstrongrobert pollin strongthe thing cop26 conference demonstrated breathtaking capacity highlevel diplomats discuss issues human survival entirely disconnected reality example considered achievement conference time burning fossil fuels produce energy officially recognized cause climate change way consider progress relationship flatout absurdity previous 25 cop agreements failed acknowledge longestablished reality burning fossil fuels responsible producing 7580 percent greenhouse gases causing climate changep pbeyond measure progress cop26 diplomats wrangled objected emfull stopem governments providing fossil fuel subsidies objected fossil fuel subsidies inefficient means surprisingly final document ended opposing inefficient subsidies similarly end meetings china india hrefhttpsperiumasseducomponentk2item1549doesindiahavearighttoburnfossilmanaged substitute referencea phasing emdownem coal original text referred phasing emoutem coalp pamid wordparsing exercises underlying reality pledges major cop conference cop21 paris 2015 accomplished terms reducing co2 emissions 2021 world energy outlook international energy agency iea hrefhttpswwwieaorgreportsworldenergyoutlook2021projects thata according stated policies scenario ie scenario takes account government pledges paris actually accomplished relative pledges global co2 emissions fall emat emas 2030 fall 6 percent 2050 36 billion tons emissions today 339 billion tons 2050 context paris agreements 196 countries committed stabilizing global average temperature 15 degrees celsius 15spancspan preindustrial levels succeed stabilizing global average temperature 15spancspan preindustrial levels intergovernmental panel climate change established global co2 emissions fall 45 percent 2030 reach zero emissions 2050p pall tells viable climate stabilization relying words pledges agreed diplomatic documents way seriously viable climate stabilization path grassroots political organizing forces governments actions good news cop26 political organizers streets glasgow force ignoredp ptheir presence force concessions final document half nearly 200 country delegations agreed cut methane emissions 30 percent 2030 body pledged end deforestation 2030 body acknowledged deep regret rich countries responsible climate crisis fulfilled financial pledges support green transition programs lowincome countries remains open question deep regret lead financing commitments actually met p pstrongwhy transition clean energy slow question lack investments technological knowhow elsestrongp pstrongpollinstrong metrics transition clean energy proceeding fairly quickly example 1985 solar energy hrefhttpsourworldindataorgrenewableenergyprovided 001 percenta worlds electricity supply 2020 figure 33 percent increase nearly 3000 percent 35 years course starting 1985 miniscule base solar production importantly level solar supply cant remain stuck range 3 percent electricity order meet climate goals needs range 6070 percent 2050p pa major factor prevented expansion clean renewable energy expanding rapidly cost recently 2010 average cost globally producing kilowatt electricity solar energy 38 cents 2020 average cost fallen 7 cents comparative average cost fossilfuelgenerated electricity remained stable decade 515 cents kilowatt hour words solar fully costcompetitive fossil fuels true previously onshore offshore wind hrefhttpswwwirenaorgpublications2021junrenewablepowercostsin2020now fully costcompetitivea fossil fuels include energy efficiency investments renewable energy overall result clean energy infrastructure deliver zero emissions economy lower energy costsp peven renewable energy costs dropping sharply critical issues remain outstanding intermittency solar wind power supply sun doesnt shine night wind doesnt blow day transmission storage questions need addressed example deliver windpowered electricity reliably low cost farm western pennsylvania center philadelphia lot progress resolving issues mind dont need solve completely right proceed clean energy transition arent going eliminate use fossil fuels week matter roughly decades develop transmission storage technologies need operate global economy 100 percent renewable energy supplyp panother challenge building renewable energy infrastructure land use question emerged places site wind turbines arrays solar panels wrecking neighborhoods natural environments solution use possible artificial surfaces putting solar panels rooftops building solar canopies parking lots measures increasingly viable costs residential solar installations reaching cost parity fossil fuels utilityscale solar farms similar pattern occurring offshore wind platformsp pbroadly speaking technology intermittency land use issues addressed effectively despite inadequate levels government support need find funds build global clean energy infrastructure going require like 253 percent global gdp year ie 25 trillion year averaging 45 trillion year 2050 according figures book emclimate crisis global green new dealemp pwhat clear cop26 government funding sufficient levels forthcoming political struggles despite fact 25 percent gdp required provided readily financing combinations discussed previously example converting existing fossil fuel subsidies clean energy subsidies transferring 510 percent military spending clean energy investments having major central banks purchasing global green investment bonds bond purchases range 2 percent bailout injections federal reserve injected wall street prevent financial collapse covid recessionp pstrongdemocratic rep alexandria ocasiocortez said people shouldnt expect international climate summits like cop26 governments solve climate crisis time defended green new deal plan realize goals green new deal question addressed youstrongp pstrongchomskystrong new deal realized step forward human history virtually exception dedicated persistent activism time differentp pelements thanks small bob pollins active engagement backed sound analytic work unions taking cause includes united workers proceeding ahead coal baron sen joe manchin congressional championinreceivingfundingfromfossilfuelindustries cooperating rocksolid republican opposition steps reverse race destructionp ptheres ample precedent organized labor taking lead bringing new deal fruition earliest environmental activists tony mazzocchi chemical atomic workers international union workers immediate victims poisoning atmosphere efforts form labor party failed easy rigidly monopolized political system ways progress domain encouraging signs labor reviving bitter 40year neoliberal assault mass refusal return rotten dangerous jobs sign malaise leading unprecedented wave deaths despair white working class overcome directed kind militant labor action 90 years ago created base social democracy europe descending fascist horror p pa americans overwhelmingly republicans dont regard global warming let broader crisis environmental destruction problem come recognize soon problem urgent deal right determine fate human life countless species casually destroying achieve essential goal requires major educational organizational efforts omitting sector society including thrall trumpstyle malevolencep pin congress rep alexandria ocasiocortez sen ed markey reintroduced 2019 resolution calling comprehensive green new deal lines detailed work robert pollin colleagues somewhat different models economist jeffrey sachs backed iea local statelevel initiatives underway major international actions youngp pthats barest sample theres lots work time musing sidelinesp pstrongpollin strongwe need organizing levels society advance global green new deal project means fighting stop communities institutions relying burning fossil fuels provide energy build zeroemissionsenergy infrastructure investments energy efficiency clean renewables note distinct demanding institutions divest ownership shares fossil fuel stock bonds divestment movement played critical role raising consciousness climate crisis effectiveness limited reality university sells stocks exxonmobil stocks getting purchased hedge funds happy buy stocks reduced prices hedge fund hrefhttpswwwnytimescom20211013climateprivateequityfundsoilgasfossilfuelshtml2020httpstruthoutorgarticlesarefossilfueldivestmentcampaignsworkingaconversationwitheconomistrobertpollincontinue earn dividends fossil fuel stocksa long people continue consume oil coal natural gas meet energy needs green new deal program start project ending reliance fossil fuels certainly cant wait cop conference settle matter p pwe need clear case green new deal overwhelming levels way realistically zero emissions 2050 investments build clean energy infrastructure major engine new job opportunities regions world coworkers estimated clean energy investments 25 percent gdp year generate example hrefhttpsirpcdnmultiscreensitecom6f2c9f57filesuploadedzerocarbonactionplanch03pdf45 million jobs year usa hrefhttpswwwepwinjournal201542specialarticlesegalitariangreengrowthprogrammeindiahtml20 million jobs indiaa creating new jobs open opportunities increase union organizing raise pay benefits associated jobs building clean energy infrastructure create new possibilities smallscale public private cooperate ownership renewable energy assets eliminate largest sources outdoor air pollution significantly raising public health standards green new deal critically committed transition workers communities currently dependent fossil fuel industry need phased outp pin combination features global green new deal provide powerful platform committed effective organizing diplomats argued week constitute inefficient fossil fuel subsidies forced finally seeing reality eyes p pemnote transcript lightly editedemp |
619c1ae43a71d948b79f4f82 | From John Harland on Quora | blockquote
pidentity confusion is a potential hazard for autistic people neurotypical people characteristically develop a personality that they use to define and to ground themselves that is the mask through which they interact with society autistic people do that to a much lesser extent and that can be a major strength as well as a riskp
pa muted sense of identity can make it much easier for an autistic person to become and effective contributor to a group because it makes them more adaptable they carry less personal baggage about what ideas define themp
pit can also make them very good at acting and at creating humour however we might think of several famous actors and comedians who have killed themselves seemingly because they were haunted by questions about who they really were behind all those adopted personasp
plearning to be ready for those questions and learning why that trait can be a strength are important lessons to impart to autistic children and adultsp
blockquote
phere is a relnoopener hrefhttpssoftskillsandautismquoracom__ni__0__nsrc__4__snid3__28943130252__tiids__43466217 target_blankthe linka with other interesting bitsp
pthe post a relnofollow hrefhttpmarginalrevolutioncommarginalrevolution202111fromjohnharlandonquorahtmlfrom john harland on quoraa appeared first on a relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap | blockquote pidentity confusion potential hazard autistic people neurotypical people characteristically develop personality use define ground mask interact society autistic people lesser extent major strength riskp pa muted sense identity easier autistic person effective contributor group makes adaptable carry personal baggage ideas define themp pit good acting creating humour think famous actors comedians killed seemingly haunted questions adopted personasp plearning ready questions learning trait strength important lessons impart autistic children adultsp blockquote phere relnoopener hrefhttpssoftskillsandautismquoracom__ni__0__nsrc__4__snid3__28943130252__tiids__43466217 target_blankthe linka interesting bitsp pthe post relnofollow hrefhttpmarginalrevolutioncommarginalrevolution202111fromjohnharlandonquorahtmlfrom john harland quoraa appeared relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap |
619c1b1e3a71d948b79f4f86 | Amicus Brief in Title 42 "Public Health" Expulsion Case | div
picture
source sizesminwidth 600px 331px 100vw typeimagewebp srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202109title42jpgwebp 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202109title421161x675jpgwebp 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202109title42800x450jpgwebp 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202109title42600x338jpgwebp 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202109title42331x186jpgwebp 331w
source sizesminwidth 600px 331px 100vw typeimagejpeg srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202109title42jpg 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202109title421161x675jpg 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202109title42800x450jpg 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202109title42600x338jpg 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202109title42331x186jpg 331w
img width1200 alttitle 42 srchttpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202109title42800x450jpg height675
picture
div
pimg sizesmaxwidth 300px 100vw 300px srchttpsd2eehagpk5cl65cloudfrontnetimgq60uploads202109title42300x225jpg alt width300 srcsethttpsd2eehagpk5cl65cloudfrontnetimgq60uploads202109title42300x225jpg 300w httpsd2eehagpk5cl65cloudfrontnetimgq60uploads202109title421024x766jpg 1024w httpsd2eehagpk5cl65cloudfrontnetimgq60uploads202109title42768x575jpg 768w httpsd2eehagpk5cl65cloudfrontnetimgq60uploads202109title42jpg 1161w classwpimage8131766 height225p
pon friday the cato institute filed an a hrefhttpswwwcatoorgsitescatoorgfiles202111huishahuishacadcpdfamicus briefa i authored for them in the title 42 quotpublic healthquot expulsion case i previously wrote about this case which is currently before the dc circuit a hrefhttpsreasoncomvolokh20210918federalcourtrulesagainsttitle42publichealthexpulsionsofmigrantsherea the brief itself is available a hrefhttpswwwcatoorgsitescatoorgfiles202111huishahuishacadcpdfherea and here is a hrefhttpswwwcatoorglegalbriefshuishahuishavunitedstatesa summarya of the brief adapted from the cato websitep
div
div
blockquotepsince march 2020 the centers for disease control cdc has used its supposed powers under section 265 of the public health service act of 1944 to expel hundreds of thousands of migrants and asylum seekers crossing the southern border several of those affected challenged these actions and the dc federal district court a relnoopener hrefhttpsreasoncomvolokh20210918federalcourtrulesagainsttitle42publichealthexpulsionsofmigrants target_blankruled in their favora the government has now appealed to the dc circuit court of appealsand cato filed an amicus brief supporting the lowercourt rulingpblockquote
div
div
blockquote
div
div
pthe governments interpretation of the cdcs powers would render the statute unconstitutional by violating the nondelegation doctrine as the supreme court recently explained emgundy v united statesem 2019 that principle of separation of powers holds that quotcongress may not transfer to another branch powers which are strictly and exclusively legislativequotp
pwhile congress can give executive branch officials a wide range of discretion it the latter is exactly what the cdc would enjoy if the government prevails in this case it would have the power to exclude or deport virtually any entrants into the united states at any timep
psection 265 gives the cdc quotthe power to prohibit the introduction of persons and property from such countries or places as he shall designatequot whenever the agency quotdetermines that by reason of the existence of any communicable disease in a foreign country there is serious danger of the introduction of such disease into the united statesquot if this language is interpreted as giving the cdc virtually unlimited power to bar or deport migrants from such countries as it designates it would violate constitutional constraints on congresss delegation of the legislative powerp
pby contrast there would be no such nondelegation issue if the term quotintroductionquot were limited to situations where the entry of persons from the country in question could result in the spread of a disease not already prevalent in the united states the problem could also be averted if the dc circuit adopts thep
pfor similar reasons the cdcs position also violates the longstanding principle that courts must not assume that congress has delegated to the executive the power to decide a quotmajorquot question of public policy unless congress has clearly indicated its intent to do sop
pthe supreme court recently reaffirmed this vital rule in blocking another covidrelated cdc action the eviction moratorium in emalabama association of realtors v hhsem the court rejected the cdcs claims that another provision of the public health service act gave it essentially limitless power to regulate housing quoteven if the text were ambiguousquot the court found quotthe sheer scope of the cdcs claimed authority under section 361a would counsel against the governments interpretationquotp
pthe same agency has made the same mistake here rather than heed the admonition that congress quotdoes not hide elephants in mouseholesquot emwhitman v american truckingem 2001the cdc has tried to squeeze yet another pachyderm into a narrow provision of the public health service actp
pthere are few bigger elephants than neartotal control over entry into the united states the dc circuit should affirm the ruling against these expulsions a policy begun under the trump administration that has largely continued under president bidenp
div
div
blockquote
pthis brief also has the support of the quototherquot ilya cato institute vice president ilya shapiro who oversees catos amicus brief program the two of us get confused with each other often enough that there is an a hrefhttpstwittercomsearchq23ilyaconfusionsrctyped_queryilyaconfusiona hashtag on twitter i have written a a hrefhttpsreasoncomvolokh20180420ilyaconfusionaguidefortheperplexedcomprehensive guidea to telling the two ilyas apartp
pas i point out in the guide we often differ on legal issues involving immigration this case is a rare exception hopefully with not one but two ilyas arrayed against it the government doesnt stand a chancep
pon a more serious note this is also a rare case that features both major legal issues and enormous realworld impact if the government prevails it would for reasons set out in the brief set a very dangerous precedent and the lives and freedom of large numbers of people are at stake as well a point we also cover in the briefp
p p
pthe post a relnofollow hrefhttpsreasoncomvolokh20211122amicusbriefintitle42publichealthexpulsioncaseamicus brief in title 42 quotpublic healthquot expulsion casea appeared first on a relnofollow hrefhttpsreasoncomreasoncomap | div picture source sizesminwidth 600px 331px 100vw typeimagewebp srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202109title42jpgwebp 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202109title421161x675jpgwebp 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202109title42800x450jpgwebp 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202109title42600x338jpgwebp 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202109title42331x186jpgwebp 331w source sizesminwidth 600px 331px 100vw typeimagejpeg srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202109title42jpg 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202109title421161x675jpg 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202109title42800x450jpg 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202109title42600x338jpg 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202109title42331x186jpg 331w img width1200 alttitle 42 srchttpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202109title42800x450jpg height675 picture div pimg sizesmaxwidth 300px 100vw 300px srchttpsd2eehagpk5cl65cloudfrontnetimgq60uploads202109title42300x225jpg alt width300 srcsethttpsd2eehagpk5cl65cloudfrontnetimgq60uploads202109title42300x225jpg 300w httpsd2eehagpk5cl65cloudfrontnetimgq60uploads202109title421024x766jpg 1024w httpsd2eehagpk5cl65cloudfrontnetimgq60uploads202109title42768x575jpg 768w httpsd2eehagpk5cl65cloudfrontnetimgq60uploads202109title42jpg 1161w classwpimage8131766 height225p pon friday cato institute filed hrefhttpswwwcatoorgsitescatoorgfiles202111huishahuishacadcpdfamicus briefa authored title 42 quotpublic healthquot expulsion case previously wrote case currently dc circuit hrefhttpsreasoncomvolokh20210918federalcourtrulesagainsttitle42publichealthexpulsionsofmigrantsherea brief available hrefhttpswwwcatoorgsitescatoorgfiles202111huishahuishacadcpdfherea hrefhttpswwwcatoorglegalbriefshuishahuishavunitedstatesa summarya brief adapted cato websitep div div blockquotepsince march 2020 centers disease control cdc supposed powers section 265 public health service act 1944 expel hundreds thousands migrants asylum seekers crossing southern border affected challenged actions dc federal district court relnoopener hrefhttpsreasoncomvolokh20210918federalcourtrulesagainsttitle42publichealthexpulsionsofmigrants target_blankruled favora government appealed dc circuit court appealsand cato filed amicus brief supporting lowercourt rulingpblockquote div div blockquote div div pthe governments interpretation cdcs powers render statute unconstitutional violating nondelegation doctrine supreme court recently explained emgundy v united statesem 2019 principle separation powers holds quotcongress transfer branch powers strictly exclusively legislativequotp pwhile congress executive branch officials awide range discretion itthe exactly cdc enjoy government prevails case power exclude deport virtually entrants united states timep psection 265 gives cdc quotthe power prohibit introduction persons property countries places shall designatequot agencyquotdetermines reason existence communicable disease aforeign country danger introduction disease united statesquot language interpreted giving cdc virtually unlimited power bar deport migrants countries designates violate constitutional constraints congresss delegation legislative powerp pby contrast nondelegation issue term quotintroductionquot limited situations entry persons country question result spread adisease prevalent united states problem averted dc circuit adopts thep pfor similar reasons cdcs position violates longstanding principle courts assume congress delegated executive power decide quotmajorquot question public policy congress clearly indicated intent sop pthe supreme court recently reaffirmed vital rule blocking covidrelated cdc action eviction moratorium inemalabama association realtors v hhsem court rejected cdcs claims provision public health service act gave essentially limitless power regulate housing quoteven text ambiguousquot court found quotthe sheer scope cdcs claimed authority section 361a counsel governments interpretationquotp pthe agency mistake heed admonition congress quotdoes hide elephants mouseholesquot emwhitman v american truckingem 2001the cdc tried squeeze pachyderm anarrow provision public health service actp pthere bigger elephants neartotal control entry united states dc circuit affirm ruling expulsions policy begun trump administration largely continued president bidenp div div blockquote pthis brief support quototherquot ilya cato institute vice president ilya shapiro oversees catos amicus brief program confused hrefhttpstwittercomsearchq23ilyaconfusionsrctyped_queryilyaconfusiona hashtag twitter written hrefhttpsreasoncomvolokh20180420ilyaconfusionaguidefortheperplexedcomprehensive guidea telling ilyas apartp pas point guide differ legal issues involving immigration case rare exception hopefully ilyas arrayed government doesnt stand chancep pon note rare case features major legal issues enormous realworld impact government prevails reasons set brief set dangerous precedent lives freedom large numbers people stake point cover briefp pp pthe post relnofollow hrefhttpsreasoncomvolokh20211122amicusbriefintitle42publichealthexpulsioncaseamicus brief title 42 quotpublic healthquot expulsion casea appeared relnofollow hrefhttpsreasoncomreasoncomap |
619c1bf33a71d948b79f4fa0 | The Scientific Cost of Immigrant Quotas | pimg sizesmaxwidth 515px 100vw 515px srchttpmarginalrevolutioncomwpcontentuploads202111paul_erdos_with_terence_taojpg alt width515 srcsethttpmarginalrevolutioncomwpcontentuploads202111paul_erdos_with_terence_taojpg 515w httpmarginalrevolutioncomwpcontentuploads202111paul_erdos_with_terence_tao300x203jpg 300w classwpimage82414 height348in the 1920s immigration to the united states was restricted with quotas which were designed to reduce the number of immigrants from italy and eastern europe then considered to be lowquality immigrants one unintended consequence was that the number of immigrant scientists from these areas also declined the awesome petra moser and schmuel san have an a hrefhttpspapersssrncomsol3paperscfmabstract_id3558718excellent new papera documenting the cost on us innovation and patentingp
blockquotepspannaturalization data indicate a dramatic decline in the arrival of new eseborn scientists after the quotas until 1924 arrivals of new eseborn immigrant scientists were comparable to arrivals from northern and western europe wne who were subject to comparable pull and push factors of migrationspanspan1 spanspanafter the quotas arrivals of eseborn scientists decline significantly while arrivals from northern and western europe continue to increase combining data on naturalizations with information on scientists university education and career histories we estimate that 1165 eseborn scientists were lost to us science under the quota system at an annual level this implies a loss of 38 scientists per year equivalent to eliminating the entire physics department of a major university each year between 1925 and 1955 for the physical sciences alone an estimated 553 eseborn scientists were lost to us sciencespanp
pspanto estimate the effects of changes in immigration on us inventions we compare changes in patenting per year after 1924 in the prequota fields of eseborn us scientists with changes in patenting in other research fields in which us scientists were active inventors before the quotas this identification strategy allows us to control for changes in invention by us scientists across fields for example as a result of changes in research funding year fixed effects further control for changes in patenting over time that are shared across fields field fixed effects control for variation in the intensity of patenting across fields eg between basic and applied researchspanp
pspanbaseline estimates reveal a large and persistent decline in invention by us scientists in the prequota fields of eseborn scientists after the quotas us scientists produced 68 percent fewer additional patents in the prequota fields of eseborn scientists compared with the prequota fields of other us scientists timevarying effects show a large decline in invention by us scientists in the 1930s which persisted into the 1960s importantly these estimates show no preexisting differences in patenting for ese and other fields before the quotasspanpblockquote
pcanada which did not implement quotas did not see a similar decline one interesting case study which is quite astounding in its wayp
blockquotepspana case study of coauthorships for the prolific hungarianborn mathematician paul erds illustrates how restrictions on immigration reduced collaborations between eseborn scientists and us scientists erds moved to the united states as a postdoctoral fellow at princeton and became a professor at notre dame travelling and collaborating with many us scientists as a hungarian citizen however erds was denied a reentry visa by the us immigration services in1954 and not granted reentry until 1963 to examine how these denials affected erds collaborations with us scientists we collect the location of erds top 100 coauthors at the time of their first collaboration these data show that erds collaborations shifted away from the united states when he was denied reentry between 1954 and 1963 24 percent of erds new coauthors were us scientists compared with 60 percent until 1954 these patterns are confirmed in a broader analysis of patents by coauthors and coauthors of coauthors of eseborn scientists which indicates a 26 percent decline in invention by scientists who were directly or indirectly influenced by eseborn scholars spanpblockquote
div
pas you might suspect from the erdos example scientists in the us became less not more productive without the benefits of cooperation with eastern european scientistsp
div
psome of the scientists denied entry to the us in the 1920s went to israel instead and innovated there so their genius was not entirely lost to the worldp
div
pstrongphotostrong paul erdos with terrence tao attribution either billy or grace tao cc bysa 20 lthttpscreativecommonsorglicensesbysa20 via wikimedia commonsp
div
pthe post a relnofollow hrefhttpmarginalrevolutioncommarginalrevolution202111thescientificcostofimmigrantquotashtmlthe scientific cost of immigrant quotasa appeared first on a relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap | pimg sizesmaxwidth 515px 100vw 515px srchttpmarginalrevolutioncomwpcontentuploads202111paul_erdos_with_terence_taojpg alt width515 srcsethttpmarginalrevolutioncomwpcontentuploads202111paul_erdos_with_terence_taojpg 515w httpmarginalrevolutioncomwpcontentuploads202111paul_erdos_with_terence_tao300x203jpg 300w classwpimage82414 height348in 1920s immigration united states restricted quotas designed reduce number immigrants italy eastern europe considered lowquality immigrants unintended consequence number immigrant scientists areas declined awesome petra moser schmuel san hrefhttpspapersssrncomsol3paperscfmabstract_id3558718excellent new papera documenting cost innovation patentingp blockquotepspannaturalization data indicate dramatic decline arrival new eseborn scientists quotas 1924 arrivals new eseborn immigrant scientists comparable arrivals northern western europe wne subject comparable pull push factors migrationspanspan1 spanspanafter quotas arrivals eseborn scientists decline significantly arrivals northern western europe continue increase combining data naturalizations information scientists university education career histories estimate 1165 eseborn scientists lost science quota system annual level implies loss 38 scientists year equivalent eliminating entire physics department major university year 1925 1955 physical sciences estimated 553 eseborn scientists lost sciencespanp pspanto estimate effects changes immigration inventions compare changes patenting year 1924 prequota fields eseborn scientists changes patenting research fields scientists active inventors quotas identification strategy allows control changes invention scientists fields example result changes research funding year fixed effects control changes patenting time shared fields field fixed effects control variation intensity patenting fields eg basic applied researchspanp pspanbaseline estimates reveal large persistent decline invention scientists prequota fields eseborn scientists quotas scientists produced 68 percent fewer additional patents prequota fields eseborn scientists compared prequota fields scientists timevarying effects large decline invention scientists 1930s persisted 1960s importantly estimates preexisting differences patenting ese fields quotasspanpblockquote pcanada implement quotas similar decline interesting case study astounding wayp blockquotepspana case study coauthorships prolific hungarianborn mathematician paul erds illustrates restrictions immigration reduced collaborations eseborn scientists scientists erds moved united states postdoctoral fellow princeton professor notre dame travelling collaborating scientists hungarian citizen erds denied reentry visa immigration services in1954 granted reentry 1963 examine denials affected erds collaborations scientists collect location erds 100 coauthors time collaboration data erds collaborations shifted away united states denied reentry 1954 1963 24 percent erds new coauthors scientists compared 60 percent 1954 patterns confirmed broader analysis patents coauthors coauthors coauthors eseborn scientists indicates 26 percent decline invention scientists directly indirectly influenced eseborn scholarsspanpblockquote div pas suspect erdos example scientists productive benefits cooperation eastern european scientistsp div psome scientists denied entry 1920s went israel instead innovated genius entirely lost worldp div pstrongphotostrong paul erdos terrence tao attribution billy grace tao cc bysa 20 lthttpscreativecommonsorglicensesbysa20 wikimedia commonsp div pthe post relnofollow hrefhttpmarginalrevolutioncommarginalrevolution202111thescientificcostofimmigrantquotashtmlthe scientific cost immigrant quotasa appeared relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap |
619c1c613a71d948b79f4fb4 | The next Fed chair | palthough the betting markets favor powell im at the point where i think the biden people are more likely to throw him overboard for brainard and blame him for the inflation if they opt for reappointment it feels like they have to own the inflation i favor powell because i think he is less likely to institute a disastrous version of the central bank digital currency idea and because he is better at dealing with congress and generating support for fed policies he might also be better at allowing crypto innovation to proceed although that is just a guess not based on solid informationp
pthe post a relnofollow hrefhttpmarginalrevolutioncommarginalrevolution202111thenextfedchairhtmlthe next fed chaira appeared first on a relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap | palthough betting markets favor powell im point think biden people likely throw overboard brainard blame inflation opt reappointment feels like inflation favor powell think likely institute disastrous version central bank digital currency idea better dealing congress generating support fed policies better allowing crypto innovation proceed guess based solid informationp pthe post relnofollow hrefhttpmarginalrevolutioncommarginalrevolution202111thenextfedchairhtmlthe fed chaira appeared relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap |
619c1c753a71d948b79f4fba | My favorite fiction of 2021 | pmarcel proust a relnoopener hrefhttpswwwamazoncommysteriouscorrespondentnewstoriesebookdpb08qjqxlsgrefsr_1_19keywordsproustqid1637509939qsid14214283993463341sr819sres08129696422c01424379642c18571525062c01430390752c06797791592c03947118232c01431335942cb084dqg4sh2c03074723292c01431337052c00609338442c05470859072c03001917902c05002934222c16813725842c05217200602c17860792402c03458031242c03933218002c0375752196srptabis_book target_blankthe mysterious correspondent new storiesa not the very best proust but even soso proust is pretty superb these are fragments to be welcomedp
pandy weir a relnoopener hrefhttpswwwamazoncomprojecthailmaryandyweirebookdpb08fhbv4zxrefsr_1_1keywordsandyweirqid1637510043qsid14214283993463341sr81sres05931352022c05534481452c05933571322cb07x7k7dvs2c08041390242c91241252882cb071ys433f2c84180370162c94016140752cb06zyytvb92cb00q78s9ys2cb01n9z9a632c039958207x2c83287168012cb00o17jq7g2c0316332917 target_blankproject hail marya at least as good as emthe martianem and arguably more conceptualp
pjudith schlansky a relnoopener hrefhttpswwwclereviewofbookscomhome2021224aneruptionofcontingencyonjudithschalanskysaninventoryoflosses target_blankverzeichnis einiger verluste [inventory of losses]a conceptual german novel with roots in borges not as good in englishp
ppatrick mcgrath a relnoopener hrefhttpswwwgooglecomsearchqlastdaysincleaversquaresourcehpeiefi8yd65dmxsa66wp6adiflsigalswamaaaaayt0aitmskzzno0ijixbgtsbmypcyhioqlastdaysinclevgs_lcpcgdnd3mtd2l6eaeyadiicaaqfhakeb46cwgaeiaeeledeimbogsilhcabbcxaxcdatoicaaqgaqqsqm6cwgueiaeemcbenedoguilhcabdofcaaqgaq6dggueiaeeledemcbenedoggiabcxaxcdatoicc4qsqmqgwe6cwgueledemcbekmcoheilhcabbcxaxdhardraxctajoicaaqgaqqyqm6bqgaejidog4ilhcabbcxaxdharcjajoocc4qgaqqsqmqgweqkwi6cwgueiaeemcbek8boggilhcabbcxazoicc4qgaqqkwi6bggaebyqhlcabfjzemcfjwgacab4aiabywgiaccokgefos43ljgyaqcgaqesclientgwswiz target_blanklast days in cleaver squarea unreliable narratorp
pkarl knausgaard a relnoopener hrefhttpsmarginalrevolutioncommarginalrevolution202107themorningstarbykarlknausgaardhtml target_blankthe morning stara the master returns with a fullscale novel with theology galorep
panne serre a relnoopener hrefhttpsmarginalrevolutioncommarginalrevolution202109whativebeenreading201html target_blankthe beginnersa short french about relationships funp
psally rooney a relnoopener hrefhttpsmarginalrevolutioncommarginalrevolution202109beautifulworldwhereareyouthenewsallyrooneynovelhtml target_blankbeautiful world where are youa she is quite the conservative dont be put off by the leftwing rhetoricp
pmario levrero a relnoopener hrefhttpswwwamazoncomluminousnovelmariolevrerodp1913505014refsr_1_1keywordsluminousnovelqid1637510140qsid14214283993463341sr81sres19135050142c00628469062c13354056582cb09m9b67rn2cb00sve70t62c15387458362c194779101x2c19477910282c17328808242c031602449x2c09915312722c08065361522c18830115152c05256557512c132858934x2cb084v936f9srptabis_book target_blankthe luminous novela the best uruguayan novel of all timep
pdomenico starnone a relnoopener hrefhttpswwwamazoncomtrustdomenicostarnoneebookdpb08vf9ngptrefsr_1_1crid1wapaaut101yokeywordsdomenicostarnoneqid1637510238qsid14214283993463341sprefixdomenicostar2caps2c207sr81sres160945703x2c16094538592c88078885802c19333726642c88078810392c880619478x2c88062289862cb07r2pkzfl2cb00bm7hk2g2cb07bb4txfy2cb084z4gkfc2cb09kmfxfh32cb081f94lrh2cb09hsgmqw32c03165563272c1635578175srptabis_book target_blanktrusta the better of the two elena ferrante novels released in english this yearp
pas for retranslations of classics i very much like a relnoopener hrefhttpswwwamazoncomoedipustrilogyversionssophoclesantigonedp0593314956refsr_1_7keywordssophoclesoedipusqid1637521349qsid14214283993463341sr87sres015602764x2c01404442542c02267686862c04520116712c05933149562c17742600852c17742612942cb095lz9rkt2c01950549382c14165003322c022603514x2c10887298192c18539964322c09913860002c08014739772c1411469836srptabis_book target_blankthe new oedipus rex trilogya and a relnoopener hrefhttpswwwamazoncomkalevalafinnishpeopleeliaslc3b6nnrotdp0241403065refsr_1_1keywordskalevalaqid1637521314qsid14214283993463341sr81sres02414030652c01995388672c17825064382cb0841m95sr2c06745001052c14953201892c95111013742c15057238412c16203556632c02532135252c18558448852c15773302182c04864474802c95111244202cb01djd4gko2cb00bazpd0gsrptabis_book target_blankthe new translation of the kalevalaa i hope they are fiction and kudos to a relnoopener hrefhttpswwwamazoncomgospelsmodernlibrarysarahrudendp0399592946refsr_1_1crid2qendsfbvcycrkeywordssarahrudenthegospelsqid1637521410qsid14214283993463341sprefixsarahruden2caps2c187sr81sres03995929462c03855225762c14813087502c16667121322c16667174602c16845111942c03675491072c05670429282c15633830042c05676961112cb08fnmpc9j2c14982137232c01902642682c15546865472c15981515842c0300208545srptabis_book target_blanksarah rudens work on the gospelsa i am not sure where to put themp
poverall i thought this was an excellent year for reading fiction much better than the few years preceding my number one pick here would be the andy weir noting that for purposes of your norming i do not usually select science fiction for this designation here is a relnoopener hrefhttpsconversationswithtylercomepisodesandyweir target_blankmy earlier cwt with andy weirap
pnote that i just ordered a relnoopener hrefhttpswwwftcomcontent858cf87bad924c74a18244ce81eb00b1 target_blanka whole new batch of appealingsounding novelsa ft link and i will read some before years end so i will give you an update when appropriate most likely toward the very end of the calendar year and my nonfiction list will be coming soon and also note missing titles from this list are very often missing on purposep
pa relattachment wpatt82413 hrefhttpsmarginalrevolutioncomattachment_id82413img sizesmaxwidth 592px 100vw 592px srchttpmarginalrevolutioncomwpcontentuploads202111zbooksjpg alt width592 srcsethttpmarginalrevolutioncomwpcontentuploads202111zbooksjpg 592w httpmarginalrevolutioncomwpcontentuploads202111zbooks300x172jpg 300w classwpimage82413 height340aread morep
pthe post a relnofollow hrefhttpmarginalrevolutioncommarginalrevolution202111myfavoritefictionof2021htmlmy favorite fiction of 2021a appeared first on a relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap | pmarcel proust relnoopener hrefhttpswwwamazoncommysteriouscorrespondentnewstoriesebookdpb08qjqxlsgrefsr_1_19keywordsproustqid1637509939qsid14214283993463341sr819sres08129696422c01424379642c18571525062c01430390752c06797791592c03947118232c01431335942cb084dqg4sh2c03074723292c01431337052c00609338442c05470859072c03001917902c05002934222c16813725842c05217200602c17860792402c03458031242c03933218002c0375752196srptabis_book target_blankthe mysterious correspondent new storiesa best proust soso proust pretty superb fragments welcomedp pandy weir relnoopener hrefhttpswwwamazoncomprojecthailmaryandyweirebookdpb08fhbv4zxrefsr_1_1keywordsandyweirqid1637510043qsid14214283993463341sr81sres05931352022c05534481452c05933571322cb07x7k7dvs2c08041390242c91241252882cb071ys433f2c84180370162c94016140752cb06zyytvb92cb00q78s9ys2cb01n9z9a632c039958207x2c83287168012cb00o17jq7g2c0316332917 target_blankproject hail marya good emthe martianem arguably conceptualp pjudith schlansky relnoopener hrefhttpswwwclereviewofbookscomhome2021224aneruptionofcontingencyonjudithschalanskysaninventoryoflosses target_blankverzeichnis einiger verluste [inventory losses]a conceptual german novel roots borges good englishp ppatrick mcgrath relnoopener hrefhttpswwwgooglecomsearchqlastdaysincleaversquaresourcehpeiefi8yd65dmxsa66wp6adiflsigalswamaaaaayt0aitmskzzno0ijixbgtsbmypcyhioqlastdaysinclevgs_lcpcgdnd3mtd2l6eaeyadiicaaqfhakeb46cwgaeiaeeledeimbogsilhcabbcxaxcdatoicaaqgaqqsqm6cwgueiaeemcbenedoguilhcabdofcaaqgaq6dggueiaeeledemcbenedoggiabcxaxcdatoicc4qsqmqgwe6cwgueledemcbekmcoheilhcabbcxaxdhardraxctajoicaaqgaqqyqm6bqgaejidog4ilhcabbcxaxdharcjajoocc4qgaqqsqmqgweqkwi6cwgueiaeemcbek8boggilhcabbcxazoicc4qgaqqkwi6bggaebyqhlcabfjzemcfjwgacab4aiabywgiaccokgefos43ljgyaqcgaqesclientgwswiz target_blanklast days cleaver squarea unreliable narratorp pkarl knausgaard relnoopener hrefhttpsmarginalrevolutioncommarginalrevolution202107themorningstarbykarlknausgaardhtml target_blankthe morning stara master returns fullscale novel theology galorep panne serre relnoopener hrefhttpsmarginalrevolutioncommarginalrevolution202109whativebeenreading201html target_blankthe beginnersa short french relationships funp psally rooney relnoopener hrefhttpsmarginalrevolutioncommarginalrevolution202109beautifulworldwhereareyouthenewsallyrooneynovelhtml target_blankbeautiful world youa conservative dont leftwing rhetoricp pmario levrero relnoopener hrefhttpswwwamazoncomluminousnovelmariolevrerodp1913505014refsr_1_1keywordsluminousnovelqid1637510140qsid14214283993463341sr81sres19135050142c00628469062c13354056582cb09m9b67rn2cb00sve70t62c15387458362c194779101x2c19477910282c17328808242c031602449x2c09915312722c08065361522c18830115152c05256557512c132858934x2cb084v936f9srptabis_book target_blankthe luminous novela best uruguayan novel timep pdomenico starnone relnoopener hrefhttpswwwamazoncomtrustdomenicostarnoneebookdpb08vf9ngptrefsr_1_1crid1wapaaut101yokeywordsdomenicostarnoneqid1637510238qsid14214283993463341sprefixdomenicostar2caps2c207sr81sres160945703x2c16094538592c88078885802c19333726642c88078810392c880619478x2c88062289862cb07r2pkzfl2cb00bm7hk2g2cb07bb4txfy2cb084z4gkfc2cb09kmfxfh32cb081f94lrh2cb09hsgmqw32c03165563272c1635578175srptabis_book target_blanktrusta better elena ferrante novels released english yearp pas retranslations classics like relnoopener hrefhttpswwwamazoncomoedipustrilogyversionssophoclesantigonedp0593314956refsr_1_7keywordssophoclesoedipusqid1637521349qsid14214283993463341sr87sres015602764x2c01404442542c02267686862c04520116712c05933149562c17742600852c17742612942cb095lz9rkt2c01950549382c14165003322c022603514x2c10887298192c18539964322c09913860002c08014739772c1411469836srptabis_book target_blankthe new oedipus rex trilogya relnoopener hrefhttpswwwamazoncomkalevalafinnishpeopleeliaslc3b6nnrotdp0241403065refsr_1_1keywordskalevalaqid1637521314qsid14214283993463341sr81sres02414030652c01995388672c17825064382cb0841m95sr2c06745001052c14953201892c95111013742c15057238412c16203556632c02532135252c18558448852c15773302182c04864474802c95111244202cb01djd4gko2cb00bazpd0gsrptabis_book target_blankthe new translation kalevalaa hope fiction kudos relnoopener hrefhttpswwwamazoncomgospelsmodernlibrarysarahrudendp0399592946refsr_1_1crid2qendsfbvcycrkeywordssarahrudenthegospelsqid1637521410qsid14214283993463341sprefixsarahruden2caps2c187sr81sres03995929462c03855225762c14813087502c16667121322c16667174602c16845111942c03675491072c05670429282c15633830042c05676961112cb08fnmpc9j2c14982137232c01902642682c15546865472c15981515842c0300208545srptabis_book target_blanksarah rudens work gospelsa sure themp poverall thought excellent year reading fiction better years preceding number pick andy weir noting purposes norming usually select science fiction designation relnoopener hrefhttpsconversationswithtylercomepisodesandyweir target_blankmy earlier cwt andy weirap pnote ordered relnoopener hrefhttpswwwftcomcontent858cf87bad924c74a18244ce81eb00b1 target_blanka new batch appealingsounding novelsa ft link read years end update appropriate likely end calendar year nonfiction list coming soon note missing titles list missing purposep pa relattachment wpatt82413 hrefhttpsmarginalrevolutioncomattachment_id82413img sizesmaxwidth 592px 100vw 592px srchttpmarginalrevolutioncomwpcontentuploads202111zbooksjpg alt width592 srcsethttpmarginalrevolutioncomwpcontentuploads202111zbooksjpg 592w httpmarginalrevolutioncomwpcontentuploads202111zbooks300x172jpg 300w classwpimage82413 height340aread morep pthe post relnofollow hrefhttpmarginalrevolutioncommarginalrevolution202111myfavoritefictionof2021htmlmy favorite fiction 2021a appeared relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap |
619d6bf1572489d5834d8c4a | Corporate Democrats Quiet as Military Budget Far Exceeds Cost of Biden’s Agenda | a hrefhttpstruthoutorgarticlescorporatedemocratsquietasmilitarybudgetfarexceedscostofbidensagendaimg sizesmaxwidth 200px 100vw 200px srchttpstruthoutorgwpcontentuploads2021112021_1123lloydaustinmarkmilley200x133jpg width200 altdefense secretary lloyd austin left laughs with chairman of the joint chiefs of staff gen mark milley before their testimony at a senate committee on appropriations hearing on the 2022 budget for the defense department srcsethttpstruthoutorgwpcontentuploads2021112021_1123lloydaustinmarkmilley200x133jpg 200w httpstruthoutorgwpcontentuploads2021112021_1123lloydaustinmarkmilley400x267jpg 400w httpstruthoutorgwpcontentuploads2021112021_1123lloydaustinmarkmilley1200x800jpg 1200w httpstruthoutorgwpcontentuploads2021112021_1123lloydaustinmarkmilley800x534jpg 800w httpstruthoutorgwpcontentuploads2021112021_1123lloydaustinmarkmilley1536x1025jpg 1536w httpstruthoutorgwpcontentuploads2021112021_1123lloydaustinmarkmilley2048x1366jpg 2048w httpstruthoutorgwpcontentuploads2021112021_1123lloydaustinmarkmilley2400x1601jpg 2400w classwppostimage height133aprightwing democrats who have spent the past several months griping about the cost of the build back better act and lopping roughly 2 trillion off the bills top line are facing growing pushback from progressive lawmakers and analysts as congress gets ready to approve a military budget thats far more expensive on an annual basisp
pstephen semler cofounder of the security policy reform institute a hrefhttpsstephensemlersubstackcompbidenseconomicagendaishalftheestimateda monday that projected us military budgets over the next decade will cost roughly 831 trillion double the combined price tag of the biden administrations bigticket agenda items which include the 19 trillion a hrefhttpswwwcommondreamsorgnews20210311presidentbidensignssweeping19trillioncovidreliefpackagelawamerican rescue plana the 550 billion a hrefhttpswwwcommondreamsorgnews20211115afterbidensignsbipartisanbillprogressivesdemandswiftpassagebuildbackbipartisan infrastructure lawa and the 175 trillion a hrefhttpswwwcommondreamsorgnews20211119timedeliverhousedemocratspassbuildbackbetteractzerogopvotesreconciliation packageap
psocial spending bills despite being more urgentrelevant for everyday security than military spending will continue to bear the brunt of austerity politics semler wrote in a blog postp
pthe senate is currently debating a sweeping 778 billion military policy bill that would allocate 768 billion to the pentagon in fiscal year 2022 significantly more than the current budget a hrefhttpswwwcommondreamsorgnews20210409khannacriticizesbidenproposingpentagonbudgetlargertrumpsapproveda under former president donald trumpp
pafter president joe biden a hrefhttpswwwcommondreamsorgnews20210528753000000000defensebudgetfailurebidenpentagonrequestrebukedrequesteda a 753 billion military budget earlier this year committees in the house and senate both narrowly controlled by democrats proceeded to tack on a hrefhttpswwwcommondreamsorgnews20210723hugeoutragesenatepanelapproves25billionpentagonbudgetincrease25 billiona more over a decade that increase alone would amount to more spending than a hrefhttpswwwvoxcom2021102822748554bidenbudgetbuildbackbetterdemocratschildcaretaxesall of the healthcare provisionsa currently in the build back better actp
blockquote classtwittertweet
p dirltr langenstrange that hardly anyone in power yells about inflation for pentagon spending even though its 2x the cost of bidens whole economic agenda a hrefhttpstcoxqpjfs2t4fhttpstcoxqpjfs2t4fa a hrefhttpstcoyl3v38uok7pictwittercomyl3v38uok7ap
p stephen semler stephensemler a hrefhttpstwittercomstephensemlerstatus1462860241905893385ref_srctwsrc5etfwnovember 22 2021apblockquote
pp
pin total as emhuffpostems akbar shahid ahmed a hrefhttpswwwhuffpostcomentryndaabuildbackbetter_n_6197ee6de4b025be1adbcc74reporteda last week the annual pentagon budget approves more than four times as much spending as bidens build back better actp
pthe national defense authorization act would approve 778 billion in spending in 2022 compared to the approximately 170 billion in spending that bidens social policy would entail next year ahmed added hawkish democrats a hrefhttpsfcwcomarticles20210901ndaatoplinerogersspendaspxworkeda with republicans to ensure that the defense bill would be 25 billion greater than bidens proposal for the military budget and to quash progressive efforts to trim costsp
psen bernie sanders ivt chair of the senate budget committee a hrefhttpstwittercomsensandersstatus1462884672145399814tweeteda monday that my colleagues seem to be so concerned with the deficit when it comes to addressing the needs of working people but all of a sudden forget about the deficit when were talking about an annual defense budget of 778 billionp
pwhat hypocrisy added the vermont senator who said he plans to a hrefhttpswwwcommondreamsorgnews20211116weneedgetourprioritiesrightberniesandersno778billionpentagonbudgetvotevote againsta the ndaap
plast week in an effort to block the proposed 25 billion increase sanders and sen ed markey dmass introduced an amendment that would bring the proposed ndaa back down to what biden requested in mayp
plet me be clear this is not a radical idea it is the military spending amount proposed by the president of the united states and the amount requested by the department of defense sanders said in a floor speech i should also point out that this extraordinary level of military spending comes at a time when the department of defense is the only agency of our federal government that has not been able to pass an independent audit and when defense contractors are making enormous profits while paying their ceos exorbitant compensation packagesp
pits unclear whether the sandersmarkey amendment will have any more success than other recent efforts to reduce the latest us military budget which have been a hrefhttpswwwcommondreamsorgnews20210923bidsslashpentagonbudgetfailusmilitaryspendingslammedheightabsurditydefeateda by republicans and democrats a hrefhttpswwwcommondreamsorgnews20210924demswhoopposedpentagoncutsreceivednearly4xmoredonationsweaponsmakersbankrolleda by the defense industryp
pmany of the rightwing house democrats who have held up the build back better act over purported concerns about its costs including reps josh gottheimer of new jersey and stephanie murphy of florida a hrefhttpsclerkhousegovvotes2021285voted with republicansa in september to tank an amendment aimed at reversing the 25 billion addonp
psen joe manchin dwva one of the major obstacles to the build back better act in the upper chamber a hrefhttpswwwsenategovlegislativelisroll_call_listsroll_call_vote_cfmcfmcongress117session1vote00472voteda to advance the full 778 billion ndaa last week without once complaining about its price tag over the past decade manchin a selfstyled enemy of a hrefhttpstwittercomscottwongdcstatus1443325690699517954fiscal insanitya has voted in favor of over a hrefhttpswwwcommondreamsorgnews20211001manchinrejects35trillionsocialinvestmentafterbacking9trillionpentagon9 trilliona in military spendingp
pemthe interceptems jeremy scahill a hrefhttpstheinterceptcom20211121americamilitarismforeignpolicybushobamatrumpbidenwrotea sunday that while there is much media focus these days on the intensely polarized dynamic on capitol hill between democrats and republicans as well as domestic legislative battles among democrats none of this has stopped the work of the empire from moving forwardp
plegislation aimed at increasing funding for social programs education and other public goods is consistently held hostage by politicians harping over the costs scahill noted this has been the case with bidens build back better legislation which has seen some conservative democrats join their republican colleagues in gutting social spending in the name of fiscal responsibilityp
pthe original bbb 10year projection was 35 trillion and has been steadily chiseled down to half that size to appease critics he added juxtapose this with the bipartisan defense spending spree that has the us on course to produce a pentagon budget of more than 7 trillion over the next decade and the priorities of this governments political class come into sharp focusp | hrefhttpstruthoutorgarticlescorporatedemocratsquietasmilitarybudgetfarexceedscostofbidensagendaimg sizesmaxwidth 200px 100vw 200px srchttpstruthoutorgwpcontentuploads2021112021_1123lloydaustinmarkmilley200x133jpg width200 altdefense secretary lloyd austin left laughs chairman joint chiefs staff gen mark milley testimony senate committee appropriations hearing 2022 budget defense department srcsethttpstruthoutorgwpcontentuploads2021112021_1123lloydaustinmarkmilley200x133jpg 200w httpstruthoutorgwpcontentuploads2021112021_1123lloydaustinmarkmilley400x267jpg 400w httpstruthoutorgwpcontentuploads2021112021_1123lloydaustinmarkmilley1200x800jpg 1200w httpstruthoutorgwpcontentuploads2021112021_1123lloydaustinmarkmilley800x534jpg 800w httpstruthoutorgwpcontentuploads2021112021_1123lloydaustinmarkmilley1536x1025jpg 1536w httpstruthoutorgwpcontentuploads2021112021_1123lloydaustinmarkmilley2048x1366jpg 2048w httpstruthoutorgwpcontentuploads2021112021_1123lloydaustinmarkmilley2400x1601jpg 2400w classwppostimage height133aprightwing democrats spent past months griping cost build better act lopping roughly 2 trillion bills line facing growing pushback progressive lawmakers analysts congress gets ready approve military budget thats far expensive annual basisp pstephen semler cofounder security policy reform institute hrefhttpsstephensemlersubstackcompbidenseconomicagendaishalftheestimateda monday projected military budgets decade cost roughly 831 trillion double combined price tag biden administrations bigticket agenda items include 19 trillion hrefhttpswwwcommondreamsorgnews20210311presidentbidensignssweeping19trillioncovidreliefpackagelawamerican rescue plana 550 billion hrefhttpswwwcommondreamsorgnews20211115afterbidensignsbipartisanbillprogressivesdemandswiftpassagebuildbackbipartisan infrastructure lawa 175 trillion hrefhttpswwwcommondreamsorgnews20211119timedeliverhousedemocratspassbuildbackbetteractzerogopvotesreconciliation packageap psocial spending bills despite urgentrelevant everyday security military spending continue bear brunt austerity politics semler wrote blog postp pthe senate currently debating sweeping 778 billion military policy bill allocate 768 billion pentagon fiscal year 2022 significantly current budget hrefhttpswwwcommondreamsorgnews20210409khannacriticizesbidenproposingpentagonbudgetlargertrumpsapproveda president donald trumpp pafter president joe biden hrefhttpswwwcommondreamsorgnews20210528753000000000defensebudgetfailurebidenpentagonrequestrebukedrequesteda 753 billion military budget earlier year committees house senate narrowly controlled democrats proceeded tack hrefhttpswwwcommondreamsorgnews20210723hugeoutragesenatepanelapproves25billionpentagonbudgetincrease25 billiona decade increase spending hrefhttpswwwvoxcom2021102822748554bidenbudgetbuildbackbetterdemocratschildcaretaxesall healthcare provisionsa currently build better actp blockquote classtwittertweet p dirltr langenstrange hardly power yells inflation pentagon spending 2x cost bidens economic agenda hrefhttpstcoxqpjfs2t4fhttpstcoxqpjfs2t4fa hrefhttpstcoyl3v38uok7pictwittercomyl3v38uok7ap p stephen semler stephensemler hrefhttpstwittercomstephensemlerstatus1462860241905893385ref_srctwsrc5etfwnovember 22 2021apblockquote pp pin total emhuffpostems akbar shahid ahmed hrefhttpswwwhuffpostcomentryndaabuildbackbetter_n_6197ee6de4b025be1adbcc74reporteda week annual pentagon budget approves times spending bidens build better actp pthe national defense authorization act approve 778 billion spending 2022 compared approximately 170 billion spending bidens social policy entail year ahmed added hawkish democrats hrefhttpsfcwcomarticles20210901ndaatoplinerogersspendaspxworkeda republicans ensure defense bill 25 billion greater bidens proposal military budget quash progressive efforts trim costsp psen bernie sanders ivt chair senate budget committee hrefhttpstwittercomsensandersstatus1462884672145399814tweeteda monday colleagues concerned deficit comes addressing needs working people sudden forget deficit talking annual defense budget 778 billionp pwhat hypocrisy added vermont senator said plans hrefhttpswwwcommondreamsorgnews20211116weneedgetourprioritiesrightberniesandersno778billionpentagonbudgetvotevote againsta ndaap plast week effort block proposed 25 billion increase sanders sen ed markey dmass introduced amendment bring proposed ndaa biden requested mayp plet clear radical idea military spending proposed president united states requested department defense sanders said floor speech point extraordinary level military spending comes time department defense agency federal government able pass independent audit defense contractors making enormous profits paying ceos exorbitant compensation packagesp pits unclear sandersmarkey amendment success recent efforts reduce latest military budget hrefhttpswwwcommondreamsorgnews20210923bidsslashpentagonbudgetfailusmilitaryspendingslammedheightabsurditydefeateda republicans democrats hrefhttpswwwcommondreamsorgnews20210924demswhoopposedpentagoncutsreceivednearly4xmoredonationsweaponsmakersbankrolleda defense industryp pmany rightwing house democrats held build better act purported concerns costs including reps josh gottheimer new jersey stephanie murphy florida hrefhttpsclerkhousegovvotes2021285voted republicansa september tank amendment aimed reversing 25 billion addonp psen joe manchin dwva major obstacles build better act upper chamber hrefhttpswwwsenategovlegislativelisroll_call_listsroll_call_vote_cfmcfmcongress117session1vote00472voteda advance 778 billion ndaa week complaining price tag past decade manchin selfstyled enemy hrefhttpstwittercomscottwongdcstatus1443325690699517954fiscal insanitya voted favor hrefhttpswwwcommondreamsorgnews20211001manchinrejects35trillionsocialinvestmentafterbacking9trillionpentagon9 trilliona military spendingp pemthe interceptems jeremy scahill hrefhttpstheinterceptcom20211121americamilitarismforeignpolicybushobamatrumpbidenwrotea sunday media focus days intensely polarized dynamic capitol hill democrats republicans domestic legislative battles democrats stopped work empire moving forwardp plegislation aimed increasing funding social programs education public goods consistently held hostage politicians harping costs scahill noted case bidens build better legislation seen conservative democrats join republican colleagues gutting social spending fiscal responsibilityp pthe original bbb 10year projection 35 trillion steadily chiseled half size appease critics added juxtapose bipartisan defense spending spree course produce pentagon budget 7 trillion decade priorities governments political class come sharp focusp |
619d6bf8572489d5834d8c4c | Did Milton Friedman support bailouts? | phugh rockoff does a relnoopener hrefhttpwwwsasrutgerseduvirtualsndewp202101pdf target_blanka 72 pp deep divea on milton friedman on bailouts this is an excellent paper as he also considers friedmans columns and spoken words over the years and he also fleshes out friedmans thoughts on what we now call shadow banks he worried about them friedman was willing to accept a fair number of bailouts here is one excerptp
blockquotepspanspan dirltrin thespan span dirltrbailoutspan span dirltrof spanspan dirltrcontinental ispanspan dirltrllinoisspanspan dirltr a spanspan dirltrcasespan span dirltrthat friedman thought had been handled wellspan span dirltrdepositors and ospanspan dirltrther creditors were protectedspan span dirltrbspanspan dirltrut shareholders were spanspan dirltrmostly spanspan dirltrwiped out and management was replaced the spanspan dirltrprotectionspan span dirltrofspan span dirltrdepositors and other creditorsspan span dirltrcreated an advantage for large banks they spanspan dirltrcould raise funds more easily because they like continental illinois were spanspan dirltrtoo big to fail spanspan dirltrhoweverspan span dirltrfriedman thought that as long asspan span dirltrshareholders spanspan dirltrand managers were spanspan dirltrforced to pay dearly when a financial institution was spanspan dirltrbailed out spanspan dirltrthere would still be an spanspan dirltradequate spanspan dirltrincentive for spanspan dirltrbank managersspan span dirltrto spanspan dirltrexercise prudencespan spanpblockquote
pmore generallyp
blockquotepfor friedman this meant that in the case of financial institutions the benefits of a bailout might outweigh the costspblockquote
pand more speculativelyp
blockquotepspanspan dirltrnspanspan dirltro one can channel spanspan dirltran economist as brillspanspan dirltriant and creative spanspan dirltras spanspan dirltrmilton friedmanspan span dirltrneverthelessspanspan dirltrspan span dirltrhaving come this far spanspan dirltri spanspan dirltrwill make spanspan dirltranspan span dirltrattempt spanspan dirltri spanspan dirltrbelievespan span dirltrthat it would have been consistent spanspan dirltrwith his earlier views spanspan dirltrfor friedman to spanspan dirltrhavespan span dirltrbeen spanspan dirltrspanspan dirltrreluctant to spanspan dirltrcondemnspanspan dirltr spanspan dirltrthe program of bailoutsspan span dirltrundertaken in 2008spanspan dirltrspan span dirltrto use the phrase that he used spanspan dirltrwhen questioned about spanspan dirltrthe rescue of spanspan dirltrlongspanspan dirltrspanspan dirltrterm capital management spanspan dirltri spanspan dirltrthink he would have spanspan dirltrrecognizedspan span dirltrthat the repos issued by lehman brothers and other investment spanspan dirltrbanks were similar to uninsured deposits in commercial banksspanspan dirltr spanspan dirltrthusspan span dirltrmaking spanspan dirltrpossiblespan span dirltra spanspan dirltrdestructivespan span dirltrpanicspanspan dirltr spanspan dirltrin other words he would have spanspan dirltrrecognized the spanspan dirltrlogic of spanspan dirltrthespan span dirltrcontention that 2008 was a spanspan dirltrspanspan dirltrrun on reposspanspan dirltrspan span dirltrand similspanspan dirltrar to earlier spanspan dirltrfinancial panicsspan span dirltrgorton laarits and metrick 2018spanspan dirltrspan span dirltrhe might have spanspan dirltrreminded us of the spanspan dirltrconsequences of the failure to provide help for the spanspan dirltrbous in 1930 however he might well have been criticalspan span dirltrof the structure of spanspan dirltrthe bailoutsspanspan dirltr especially with respect to how various classes of stakeholders spanspan dirltrwere treatedspanspan dirltr span spanpblockquote
pi recall being excoriated a relnoopener hrefhttpsmarginalrevolutioncommarginalrevolution200908werethebailoutsagoodideahtml target_blankin 2009 for suggestinga that friedman would have endorsed some version of the bailouts of that timep
pvia the excellent a relnoopener hrefhttpstwittercomd_a_irwin target_blankdouglas irwina and here is a relnoopener hrefhttpsconversationswithtylercomepisodesdougirwin target_blankmy older cwt with dougap
pthe post a relnofollow hrefhttpmarginalrevolutioncommarginalrevolution202111didmiltonfriedmansupportbailoutshtmldid milton friedman support bailoutsa appeared first on a relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap | phugh rockoff relnoopener hrefhttpwwwsasrutgerseduvirtualsndewp202101pdf target_blanka 72 pp deep divea milton friedman bailouts excellent paper considers friedmans columns spoken words years fleshes friedmans thoughts shadow banks worried friedman willing accept fair number bailouts excerptp blockquotepspanspan dirltrin thespan span dirltrbailoutspan span dirltrof spanspan dirltrcontinental ispanspan dirltrllinoisspanspan dirltr spanspan dirltrcasespan span dirltrthat friedman thought handled wellspan span dirltrdepositors ospanspan dirltrther creditors protectedspan span dirltrbspanspan dirltrut shareholders spanspan dirltrmostly spanspan dirltrwiped management replaced spanspan dirltrprotectionspan span dirltrofspan span dirltrdepositors creditorsspan span dirltrcreated advantage large banks spanspan dirltrcould raise funds easily like continental illinois spanspan dirltrtoo big fail spanspan dirltrhoweverspan span dirltrfriedman thought long asspan span dirltrshareholders spanspan dirltrand managers spanspan dirltrforced pay dearly financial institution spanspan dirltrbailed spanspan dirltrthere spanspan dirltradequate spanspan dirltrincentive spanspan dirltrbank managersspan span dirltrto spanspan dirltrexercise prudencespan spanpblockquote pmore generallyp blockquotepfor friedman meant case financial institutions benefits bailout outweigh costspblockquote pand speculativelyp blockquotepspanspan dirltrnspanspan dirltro channel spanspan dirltran economist brillspanspan dirltriant creative spanspan dirltras spanspan dirltrmilton friedmanspan span dirltrneverthelessspanspan dirltrspan span dirltrhaving come far spanspan dirltri spanspan dirltrwill spanspan dirltranspan span dirltrattempt spanspan dirltri spanspan dirltrbelievespan span dirltrthat consistent spanspan dirltrwith earlier views spanspan dirltrfor friedman spanspan dirltrhavespan span dirltrbeen spanspan dirltrspanspan dirltrreluctant spanspan dirltrcondemnspanspan dirltr spanspan dirltrthe program bailoutsspan span dirltrundertaken 2008spanspan dirltrspan span dirltrto use phrase spanspan dirltrwhen questioned spanspan dirltrthe rescue spanspan dirltrlongspanspan dirltrspanspan dirltrterm capital management spanspan dirltri spanspan dirltrthink spanspan dirltrrecognizedspan span dirltrthat repos issued lehman brothers investment spanspan dirltrbanks similar uninsured deposits commercial banksspanspan dirltr spanspan dirltrthusspan span dirltrmaking spanspan dirltrpossiblespan span dirltra spanspan dirltrdestructivespan span dirltrpanicspanspan dirltr spanspan dirltrin words spanspan dirltrrecognized spanspan dirltrlogic spanspan dirltrthespan span dirltrcontention 2008 spanspan dirltrspanspan dirltrrun reposspanspan dirltrspan span dirltrand similspanspan dirltrar earlier spanspan dirltrfinancial panicsspan span dirltrgorton laarits metrick 2018spanspan dirltrspan span dirltrhe spanspan dirltrreminded spanspan dirltrconsequences failure provide help spanspan dirltrbous 1930 criticalspan span dirltrof structure spanspan dirltrthe bailoutsspanspan dirltr especially respect classes stakeholders spanspan dirltrwere treatedspanspan dirltr span spanpblockquote pi recall excoriated relnoopener hrefhttpsmarginalrevolutioncommarginalrevolution200908werethebailoutsagoodideahtml target_blankin 2009 suggestinga friedman endorsed version bailouts timep pvia excellent relnoopener hrefhttpstwittercomd_a_irwin target_blankdouglas irwina relnoopener hrefhttpsconversationswithtylercomepisodesdougirwin target_blankmy older cwt dougap pthe post relnofollow hrefhttpmarginalrevolutioncommarginalrevolution202111didmiltonfriedmansupportbailoutshtmldid milton friedman support bailoutsa appeared relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap |
619d6c0a572489d5834d8c50 | Respecting the Genius of Ordinary People – Jane McAlevey Pt 2 | a relnofollow hrefhttpstheanalysisnewsrespectingthegeniusofordinarypeoplejanemcaleveypt2 titlerespecting the genius of ordinary people jane mcalevey pt 2img sizesmaxwidth 1024px 100vw 1024px srchttpstheanalysisnewswpcontentuploads202111webrespectingthegeniusofordinarypeople1024x603jpg width1024 alt srcsethttpstheanalysisnewswpcontentuploads202111webrespectingthegeniusofordinarypeople1024x603jpg 1024w httpstheanalysisnewswpcontentuploads202111webrespectingthegeniusofordinarypeople300x177jpg 300w httpstheanalysisnewswpcontentuploads202111webrespectingthegeniusofordinarypeople768x452jpg 768w httpstheanalysisnewswpcontentuploads202111webrespectingthegeniusofordinarypeoplejpg 1100w classwebfeedsfeaturedvisual wppostimage height603aparve error src mismatch url httpswwwyoutubecomwatchv76ay41favu4 src in httpswwwyoutubecomembed76ay41favu4featureoembedampenablejsapi1amporiginhttpstheanalysisnews src gen httpswwwyoutubecomembed76ay41favu4actual comparison url httpswwwyoutubecomwatchv76ay41favu4 src in httpswwwyoutubecomembed76ay41favu4enablejsapi1amporiginhttps3a2f2ftheanalysisp
pa relnofollow hrefhttpstheanalysisnewsrespectingthegeniusofordinarypeoplejanemcaleveypt2sourceap | relnofollow hrefhttpstheanalysisnewsrespectingthegeniusofordinarypeoplejanemcaleveypt2 titlerespecting genius ordinary people jane mcalevey pt 2img sizesmaxwidth 1024px 100vw 1024px srchttpstheanalysisnewswpcontentuploads202111webrespectingthegeniusofordinarypeople1024x603jpg width1024 alt srcsethttpstheanalysisnewswpcontentuploads202111webrespectingthegeniusofordinarypeople1024x603jpg 1024w httpstheanalysisnewswpcontentuploads202111webrespectingthegeniusofordinarypeople300x177jpg 300w httpstheanalysisnewswpcontentuploads202111webrespectingthegeniusofordinarypeople768x452jpg 768w httpstheanalysisnewswpcontentuploads202111webrespectingthegeniusofordinarypeoplejpg 1100w classwebfeedsfeaturedvisual wppostimage height603aparve error src mismatch url httpswwwyoutubecomwatchv76ay41favu4 src httpswwwyoutubecomembed76ay41favu4featureoembedampenablejsapi1amporiginhttpstheanalysisnews src gen httpswwwyoutubecomembed76ay41favu4actual comparison url httpswwwyoutubecomwatchv76ay41favu4 src httpswwwyoutubecomembed76ay41favu4enablejsapi1amporiginhttps3a2f2ftheanalysisp pa relnofollow hrefhttpstheanalysisnewsrespectingthegeniusofordinarypeoplejanemcaleveypt2sourceap |
619d6c51572489d5834d8c54 | 5 Questions About the History of Humanity | pspanjspanoin us live for a 25minute qampa with archaeologist and author david wengrow to discuss his emnew york timesembestselling book emthe dawn of everything a new history of humanityem coauthored with the late anthropologist david graeber register today to learn about how assumptions about social evolution such as the development of agriculture and the origins of inequality are being challenged to reveal new possibilities for understanding human historyp
pa hrefhttpsus02webzoomuswebinarregisterwn_x2hdmnkyrfzltgzmwacwregister todayap
pspandspanecember 15 2021 300330 pm eastern standard time us and canadap
pthe post a relnofollow hrefhttpswwwsapiensorgarchaeology5questionsaboutthehistoryofhumanity5 questions about the history of humanitya appeared first on a relnofollow hrefhttpswwwsapiensorgsapiensap | pspanjspanoin live 25minute qampa archaeologist author david wengrow discuss emnew york timesembestselling book emthe dawn new history humanityem coauthored late anthropologist david graeber register today learn assumptions social evolution development agriculture origins inequality challenged reveal new possibilities understanding human historyp pa hrefhttpsus02webzoomuswebinarregisterwn_x2hdmnkyrfzltgzmwacwregister todayap pspandspanecember 15 2021 300330 pm eastern standard time canadap pthe post relnofollow hrefhttpswwwsapiensorgarchaeology5questionsaboutthehistoryofhumanity5 questions history ofhumanitya appeared relnofollow hrefhttpswwwsapiensorgsapiensap |
619d6ced572489d5834d8c64 | The University of Austin: a meteor aimed at higher ed? | pamericans are beginning to seek alternatives to our established menu of colleges and universities in fact not just americans students from other countries are also choosing alternatives to studying in the us the combined effect has been a sharp drop in american college enrollment which is down overall by about 8 percent over the last two years and more than 14 percent at community colleges international student enrollment is down a total of 15 percent but that masks an even more serious problem enrollment of emnewem foreign students fell last year by 46 percentp
psome of this of course is due to covid and some of it is due to a demographic shift fewer babies born 17 to 20 years ago means fewer young people to fill the seats in lecture halls but other contributing factors are more mysterious why has there been a precipitous drop in the number of males who choose to go to college the malefemale ratio among students is now 46 why have so many colleges declared themselves systemically racist why have colleges turned campus life into a pressure cooker of ideological conformity why do those who run colleges and universities think their path to success is to copy what all the other colleges and universities are doingp
pthe recent announcement of the formation of a new institution the a hrefhttpswwwuaustinorguniversity of austina uatx which intends to break with the herd mentality was met with met with a hrefhttpsspectatorworldcomtopicuniversityaustinsparknewenlightenmenthigh praisea in many quarters and with extreme disdain by many supporters of the legacy institutions lets stick with the disdain for the moment hank reichman professor emeritus of history at california state university and former american association of university professors aaup vicepresident is about as close as one could get to the perfected voice of higher educations leftist establishment the day after uatx sent out its birth announcement a hrefhttpsacademeblogorg20211109welcometoroguesgalleryuniversityreichman happily noteda in a post titled welcome to rogues gallery university that the announcement had garnered widespread ridicule on academic social mediap
pwhat was it that prompted the ridicule reichman focuses on the members of uatxs board of advisors and borrows the sneer of the progressive law professor a hrefhttpswwwlawyersgunsmoneyblogcom202111americasgoingfascistbecauseouruniversitiesaretotalitarianhellholespaul camposa who characterizes these advisors as our most ludicrously selfregarding and mawkishly preening intellectuals the rest of reichmans essay is a long string of ad hominem attacks against individual uatx advisorsp
pthe disdain didnt stop with reichman it fills pages of the emchronicle of higher educationem and eminside higher edem and reverberates across the aaups academe blog those who have praised the creation of uatx such as emnew york timesem columnist ross douthat have been subjected to public shaming as well as when ohio state emeritus professor of english a hrefhttpsacademeblogorg20211117rossdouthatwouldntknowanewcollegefromanoldoneharvey graff schooled douthata for his ideologically biased and historically ignorant opinions in favor of the new enterprisep
pi happen to be among those who think uatx is a good idea at least one worth trying and my organization the national association of scholars has cheered uatxs declaration of purpose but my interest at the moment is not to praise or defend uatx i am rather marveling at the avidity with which the academic establishment has denounced the mere emidea emof a new university that breaks ranks with the current model uatx doesnt yet have a campus a single faculty member or a student but it appears to threaten higher education as though it were a chicxulubsized meteor headed towards harvard yardp
pthe alarm is excellent news for the first time in decades the higher education establishment actually feels threatened i should know i preside over an organization the national association of scholars which formed in the early 1980s for the express purpose of convincing colleges and universities to pull back from the brink it set out with the motto for reasoned scholarship in a free society most of its founders were liberal academics who recognized the rise of hardedged radicalism among the younger faculty they imagined vainly as we now know that once alerted to the dangers colleges and universities would draw some lines the rise of new authoritarian orthodoxies jeopardized the essential foundations of higher education the pursuit of truth free inquiry disciplined critique academic standards disinterested scholarship genuine intellectual authority and cultural depth the nas founders valued openness to new ideasp
pthey worried however that some energetic newcomers saw openness as the opportunity to make sure emtheirem new ideas would be final liberal tolerance of disagreement could be put to rest in favor of the brilliant certainties of a new erap
pthis is by now a very old story it caught the countrys attention in 1987 when allan bloom published a hrefhttpsbookshoporga30579781451683202emthe closing of the american mindema in 1990 roger kimball synthesized the catastrophe into a slim book titled emtenured radicalsem as i write these words i am walled on two sides by rows of floortoceiling bookcases filled with tomes written since by scholars who were not at all happy with the results of this academic revolution here sits emthe breakdown of higher educationem there lies emthe end of collegeem not to be confused with emeducations endem emwhats happened to the university emcries one author emcollege disruptedem answers another some say we have emhigher expectationsem but those expectations hit the brick wall of emminds wide shutemp
pa few despair and give emthe case against education embut many others spin out a dream of redemption they write of emthe university we need alternative universities bettercheaper college learning innovation and the future of higher educationemp
pi have read hundreds of these books it is part of my job a few of them flared into importance for a season a great many of them are written in the tone of a heartbroken parent by the grave of a child some have the stoic urgency of a soldier headed into what he knows will be his last battle and some are works of forced confidence for what else is there to sayp
pi bring all this up because these pronouncements never disturbed the complacency of the higher ed establishment the powers that be in faculty senates provost offices the presidential suites and boardrooms took it in stride that nothing would really change the last time there was a genuine uproar was all the way back in 1987 when allan bloom had the bad manners to point out that higher education had failed democracy and was impoverishing the souls of todays students those postdemocratic soulimpoverished students have now grown up and some are now themselves professors and college presidents and they havent the faintest idea what all the fuss over liberal education is aboutp
pthey are after all both the custodians of liberal education and its stoutest defenders liberal education is about teaching antiracism and the fight against climate change and the need to protect the transgendered and the importance of vaccinations and masks and the urgency of stopping violence against women and the compelling case for open borders and the acute need to protect the vulnerable from hate speech and the burning need for global outreach and gender equity and did i say antiracism yes antiracism above allp
pthese are complicated goals that require a great many expensive interventions and thus a lot of money and professional staff moreover achieving these goals requires defeating the forces of hatred bias and ignorance that surround the college campus like an everthreatening trumpian fine folks mob or like a cloud of heattrapping fossil fuelspewing carbon dioxide smog or like a cordon of unvaxxed superspreadersp
pwell i exaggerate not every college president senses such peril the peril that is more immediately on the minds of many is declining enrollment american higher education for the most part is tuitiondriven and a substantial part of the tuition derives from students who are willing to borrow substantial sums from the federal government to pay the billsp
div
a hrefhttpsspectatorworldcomdcdiarylaunchofferimg alt width1200 srchttpsspectatorworldcomwpcontentuploads202110emailbannerpng classwpimage29978 height217a div
pmy colleagues and i at the nas have been paying close attention to this in a report titled a hrefhttpswwwnasorgreportspricedoutpriced out what college costs americaa we looked at the link between student debt and what might be called woke work in the early days of the pandemic we published our own prescription for hardhit higher ed titled a hrefhttpswwwnasorgreportscriticalcareemcritical careema urging that the billions of dollars colleges and universities were demanding as bailouts be conditioned on serious reformp
pto be sure there was no reform at all but many colleges and universities still find themselves in a precarious situation or as we say in todays parlance in a state of precarity and in their precarity they are alarmed yes very alarmed that someone has come along and proposed a new university that will have none of the hostages to the expensive dysfunctional habits of the legacy institutions and that proposes to compete for faculty and students by laying out a coherent curriculum and abiding by the old ideas of intellectual freedomp
pthe university of austin is a long way from opening its doors and it has to raise a lot of money to get there but it is a serious proposal backed by serious people and the very idea sends shivers down the spines of those whose lives are dedicated to liberal education as we know itp
pthe post a relnofollow hrefhttpsspectatorworldcomtopicuniversityaustinmeteorhighereducationthe university of austin a meteor aimed at higher eda appeared first on a relnofollow hrefhttpsspectatorworldcomthe spectator worldap | pamericans beginning seek alternatives established menu colleges universities fact americans students countries choosing alternatives studying combined effect sharp drop american college enrollment overall 8 percent years 14 percent community colleges international student enrollment total 15 percent masks problem enrollment emnewem foreign students fell year 46 percentp psome course covid demographic shift fewer babies born 17 20 years ago means fewer young people fill seats lecture halls contributing factors mysterious precipitous drop number males choose college malefemale ratio students 46 colleges declared systemically racist colleges turned campus life pressure cooker ideological conformity run colleges universities think path success copy colleges universities doingp pthe recent announcement formation new institution hrefhttpswwwuaustinorguniversity austina uatx intends break herd mentality met met hrefhttpsspectatorworldcomtopicuniversityaustinsparknewenlightenmenthigh praisea quarters extreme disdain supporters legacy institutions lets stick disdain moment hank reichman professor emeritus history california state university american association university professors aaup vicepresident close perfected voice higher educations leftist establishment day uatx sent birth announcement hrefhttpsacademeblogorg20211109welcometoroguesgalleryuniversityreichman happily noteda post titled welcome rogues gallery university announcement garnered widespread ridicule academic social mediap pwhat prompted ridicule reichman focuses members uatxs board advisors borrows sneer progressive law professor hrefhttpswwwlawyersgunsmoneyblogcom202111americasgoingfascistbecauseouruniversitiesaretotalitarianhellholespaul camposa characterizes advisors ludicrously selfregarding mawkishly preening intellectuals rest reichmans essay long string ad hominem attacks individual uatx advisorsp pthe disdain didnt stop reichman fills pages emchronicle higher educationem eminside higher edem reverberates aaups academe blog praised creation uatx emnew york timesem columnist ross douthat subjected public shaming ohio state emeritus professor english hrefhttpsacademeblogorg20211117rossdouthatwouldntknowanewcollegefromanoldoneharvey graff schooled douthata ideologically biased historically ignorant opinions favor new enterprisep pi happen think uatx good idea worth trying organization national association scholars cheered uatxs declaration purpose interest moment praise defend uatx marveling avidity academic establishment denounced mere emidea emof new university breaks ranks current model uatx doesnt campus single faculty member student appears threaten higher education chicxulubsized meteor headed harvard yardp pthe alarm excellent news time decades higher education establishment actually feels threatened know preside organization national association scholars formed early 1980s express purpose convincing colleges universities pull brink set motto reasoned scholarship free society founders liberal academics recognized rise hardedged radicalism younger faculty imagined vainly know alerted dangers colleges universities draw lines rise new authoritarian orthodoxies jeopardized essential foundations higher education pursuit truth free inquiry disciplined critique academic standards disinterested scholarship genuine intellectual authority cultural depth nas founders valued openness new ideasp pthey worried energetic newcomers saw openness opportunity sure emtheirem new ideas final liberal tolerance disagreement rest favor brilliant certainties new erap pthis old story caught countrys attention 1987 allan bloom published hrefhttpsbookshoporga30579781451683202emthe closing american mindema 1990 roger kimball synthesized catastrophe slim book titled emtenured radicalsem write words walled sides rows floortoceiling bookcases filled tomes written scholars happy results academic revolution sits emthe breakdown higher educationem lies emthe end collegeem confused emeducations endem emwhats happened university emcries author emcollege disruptedem answers emhigher expectationsem expectations hit brick wall emminds wide shutemp pa despair emthe case education embut spin dream redemption write emthe university need alternative universities bettercheaper college learning innovation future higher educationemp pi read hundreds books job flared importance season great written tone heartbroken parent grave child stoic urgency soldier headed knows battle works forced confidence sayp pi bring pronouncements disturbed complacency higher ed establishment powers faculty senates provost offices presidential suites boardrooms took stride change time genuine uproar way 1987 allan bloom bad manners point higher education failed democracy impoverishing souls todays students postdemocratic soulimpoverished students grown professors college presidents havent faintest idea fuss liberal education aboutp pthey custodians liberal education stoutest defenders liberal education teaching antiracism fight climate change need protect transgendered importance vaccinations masks urgency stopping violence women compelling case open borders acute need protect vulnerable hate speech burning need global outreach gender equity antiracism yes antiracism allp pthese complicated goals require great expensive interventions lot money professional staff achieving goals requires defeating forces hatred bias ignorance surround college campus like everthreatening trumpian fine folks mob like cloud heattrapping fossil fuelspewing carbon dioxide smog like cordon unvaxxed superspreadersp pwell exaggerate college president senses peril peril immediately minds declining enrollment american higher education tuitiondriven substantial tuition derives students willing borrow substantial sums federal government pay billsp div hrefhttpsspectatorworldcomdcdiarylaunchofferimg alt width1200 srchttpsspectatorworldcomwpcontentuploads202110emailbannerpng classwpimage29978 height217a div pmy colleagues nas paying close attention report titled hrefhttpswwwnasorgreportspricedoutpriced college costs americaa looked link student debt called woke work early days pandemic published prescription hardhit higher ed titled hrefhttpswwwnasorgreportscriticalcareemcritical careema urging billions dollars colleges universities demanding bailouts conditioned reformp pto sure reform colleges universities find precarious situation todays parlance state precarity precarity alarmed yes alarmed come proposed new university hostages expensive dysfunctional habits legacy institutions proposes compete faculty students laying coherent curriculum abiding old ideas intellectual freedomp pthe university austin long way opening doors raise lot money proposal backed people idea sends shivers spines lives dedicated liberal education know itp pthe post relnofollow hrefhttpsspectatorworldcomtopicuniversityaustinmeteorhighereducationthe university austin meteor aimed higher eda appeared relnofollow hrefhttpsspectatorworldcomthe spectator worldap |
619d6dc1572489d5834d8c82 | Best non-fiction books of 2021 | pwhat an incredible year for nonfiction books but let me first start with two picks from 2020 buried under the avalanche of covid news then and missed because i was less mobile than usual these books are not only good enough to make this list but in just about any year emthey are good enough to be the very best book of that yearemp
pedward nelson spana relnoopener hrefhttpsmarginalrevolutioncommarginalrevolution202106theedwardnelsonbookonmiltonfriedmanhtml target_blankmilton friedman and economic debate in the united states 19321972a volumes one and twospanp
palexander mikaberidze a relnoopener hrefhttpsmarginalrevolutioncommarginalrevolution202108howtotellwhenyouarereadingatrulygreathistorybookhtml target_blankthe napoleonic wars a global historyap
palso noteworthy is reviel netz a relnoopener hrefhttpswwwamazoncomscalespaceancientliteraryculturedp1108481477refsr_1_2keywordsrevielnetzqid1637634752qsid14214283993463341sr82sres10090698022c11084814772c08195695932cb005o16uiq2cb000u0spgq2c05211179842c11070145732c05216614552c11070143792c184465866x2cb08jqngx192cb088c2wd5f2cb079jdqkv42cb07jb5pm9p2cb007e9jera2cb01lxhfqmx target_blankscale space and canon in ancient literary culturea which i hope to write more aboutp
pper usual there is typically a short review behind each though not quite always as for 2021 proper here were my favorites noting that i do not impose any quota system whatsoever and yet this list is somehow more cosmopolitan than most such tallieshmm i dont quite know how to put this but this list is much better than the other best books of the year lists these are truly my picks ranked roughly in the order i read themp
pjin xu a relnoopener hrefhttpsmarginalrevolutioncommarginalrevolution202102empireofsilverhtml target_blankempire of silver a new monetary history of chinaap
pcat jarman a relnoopener hrefhttpsmarginalrevolutioncommarginalrevolution202103whativebeenreading187html target_blankriver kings a new history of the vikings from scandinavia to the silk roadsap
pmichela wrong a relnoopener hrefhttpsmarginalrevolutioncommarginalrevolution202104thenewmichelawrongbookhtml target_blankdo not disturb the story of a political murder and an african regime gone badap
pryan bourne a relnoopener hrefhttpsmarginalrevolutioncommarginalrevolution202104whativebeenreading189html target_blankeconomics in one virus an introduction to economic reasoning through covid19ap
pcolin bryar and bill carr a relnoopener hrefhttpsmarginalrevolutioncommarginalrevolution202104whativebeenreading189html target_blankworking backwards insights stories and secrets from amazonap
pivan gibbons a relnoopener hrefhttpsmarginalrevolutioncommarginalrevolution202104partitionhowandwhyirelandwasdividedhtml target_blankpartition how and why ireland was dividedap
pserhii plokhy a relnoopener hrefhttpsmarginalrevolutioncommarginalrevolution202104nuclearfollyahistoryofthecubanmissilecrisishtml target_blanknuclear folly a history of the cuban missile crisisap
palan taylor a relnoopener hrefhttpsmarginalrevolutioncommarginalrevolution202105americanrepublicshtml target_blankamerican republics a continental history of the united states 17831850ap
pwilliam deresiewicz a relnoopener hrefhttpswwwamazoncomdeathartistcreatorsstrugglingbillionairesebookdpb07x186mhxrefsr_1_1dchild1keywordsdeathoftheartistqid1621000874sr81marginalrevol20 target_blankthe death of the artist how creators are struggling to survive in the age of billionaires and big techa brief discussion of it a relnoopener hrefhttpsmarginalrevolutioncommarginalrevolution202105whativebeenreading191html target_blankhereap
proderick matthews a relnoopener hrefhttpsmarginalrevolutioncommarginalrevolution202105peacepovertyandbetrayalhtml target_blankpeace poverty and betrayal a new history of british indiaap
palejandro ruiz carla altesor etal a relnoopener hrefhttpswwwamazoncomfoodoaxacarecipesstoriesculinarydp0525657304refsr_1_1keywordsthefoodofoaxacaqid1637637124qsid14214283993463341sr81sres05256573042c141973542x2c00286035082c02927226642c14408692352c16487656962c16404908922c16315288072c02927358122c02927283282c03454259602c14654360572c07148675272c05175923552c15988096012c1350183830srptabis_book target_blankthe food of oaxaca recipes and stories from mexicos culinary capitalap
ptomas mandl a relnoopener hrefhttpsmarginalrevolutioncommarginalrevolution202105modernparaguaysouthamericasbestkeptsecrethtml target_blankmodern paraguay south americas best kept secretap
pkara walker a relnoopener hrefhttpsmarginalrevolutioncommarginalrevolution202105whativebeenreading193html target_blanka black hole is everything a star longs to beaspanspanp
ptony saich a relnoopener hrefhttpsmarginalrevolutioncommarginalrevolution202106chinafactoftheday65html target_blankfrom rebel to ruler one hundred years of the chinese communist partyap
padeeb khalid a relnoopener hrefhttpsmarginalrevolutioncommarginalrevolution202107chinafactoftheday66html target_blankcentral asia a new history from the imperial conquests to the presentap
prichard zenith a relnoopener hrefhttpsmarginalrevolutioncommarginalrevolution202108whativebeenreading199html target_blankpessoa a biographyap
pjohn b thompson a relnoopener hrefhttpsmarginalrevolutioncommarginalrevolution202108whativebeenreading200html target_blankbook wars the digital revolutionap
pscott sumner a relnoopener hrefhttpswwwamazoncommoneyillusionmonetarismrecessionmonetaryebookdpb09h38ylplrefsr_1_2keywordsscottsumnermoneyillusionqid1637632421qsid14214283993463341sr82sres022677368x2cb084yjp1882cb092rd74g42cb07r2fnt4l2cb002dq6eu42cb001ex8ayk2c14641825152cb000i1m5ou2cb08hmqt31j2cb085sxkrw52cb0039gek6c2cb0881whzhm2cb08byvqt9j2cb086h68bpq2cb07znf14vw2cb075r7bnxv target_blankthe money illusion market monetarism the great recession and the future of monetary policyap
pa relnoopener hrefhttpsmarginalrevolutioncommarginalrevolution202110thegreatestbooksonafricaeverwrittenhtml target_blankarchitectural guide to subsaharan africaap
pjoanne limburg a relnoopener hrefhttpsmarginalrevolutioncommarginalrevolution202110whativebeenreading206html target_blankletters to my weird sisters on autism and feminismap
pmccartney paul a relnoopener hrefhttpswwwamazoncomlyrics1956presentpaulmccartneydp163149256xrefsr_1_2cridr0vk5qkcwr6ykeywordspaulmccartneythelyricsqid1637632456qsid14214283993463341sprefixpaulm2caps2c174sr82sres163149256x2c145844063x2cb07b6vl2gr2cb09jvm1js52c09351129602c16451763392c05933724332c02415193302c15344658552c03162471702c05256486742cb09kn2lb8h2cb09kn5v2d52c03933240952c84480289022cb09kncx4t1srptabis_book target_blankthe lyricsa a remarkably high quality production again showing mccartneys skill as manager and entrepreneur perhaps the biggest revelation is when paul insists that if not for the beatles he would have been an english teacher he also claims that he and not john was the big reader in the beatles it is also striking but not surprising when explaining his lyrics how many times he mentions his mother who passed away when paul was fourteen there is a good david hajdu nyt review a relnoopener hrefhttpswwwnytimescom20211106booksreviewthelyricspaulmccartneyhtml target_blankhereap
pbob spitz a relnoopener hrefhttpswwwamazoncomledzeppelinbiographybobspitzebookdpb08xtljcz7refsr_1_1keywordsbobspitzqid1637632617qsid14214283993463341sr81sres03995624272c03160133152c03933076972c01421808742c031611555x2c16189311482cb008u2q2z22cb07h381xrm2cb00421bn0e2cb09m117sdb2c16632228862cb0049mpvs62c163149256x2cb091wvm1jd2c09351129602c0306846683srptabis_book target_blankled zeppelin the biographya they always end up being better than you think they possibly could be and this is the best and most serious book about themp
pgestalten a relnoopener hrefhttpswwwamazoncomhousedragonnewchinesearchitecturedp3899558723refsr_1_1keywordsbeautyandtheeastqid1637634516qsid14214283993463341sr81sres38995587232cb07n93xf4z2cb08635grys2cb0858mz1zr2cb00sdjg51s2cb077xc7k7v2c06700330492cb00hhfwfvi2cb09m7ljntp2cb07kvlv8sb2cb01a5nz2mc2cb09cg82ypy2cb088s723422cb08hvzl61c2cb07gdl95wl2cb08ynpf44h target_blankbeauty and the east new chinese architecturea selfrecommendingp
pis there a best book of 2021 the categories are hard to compare maybe the seven volumes of a relnoopener hrefhttpsmarginalrevolutioncommarginalrevolution202110thegreatestbooksonafricaeverwrittenhtml target_blankarchitectural guide to subsaharan africaa but is it fair they get seven volumes in this competition the mccartney he took two volumes the pessoa biography roderick matthews on india so much to choose from and apologies to all those i have forgotten or neglectedp
pa relattachment wpatt82419 hrefhttpsmarginalrevolutioncomattachment_id82419img sizesmaxwidth 896px 100vw 896px srchttpmarginalrevolutioncomwpcontentuploads202111zlibraryjpg alt width896 srcsethttpmarginalrevolutioncomwpcontentuploads202111zlibraryjpg 896w httpmarginalrevolutioncomwpcontentuploads202111zlibrary300x114jpg 300w httpmarginalrevolutioncomwpcontentuploads202111zlibrary768x291jpg 768w classwpimage82419 height340aread more and here is a relnoopener hrefhttpsmarginalrevolutioncommarginalrevolution202111myfavoritefictionof2021html target_blankmy favorite fiction of 2021 lista and i will write an addendum to this list as we approach the very end of 2021p
pthe post a relnofollow hrefhttpmarginalrevolutioncommarginalrevolution202111bestnonfictionbooksof2021htmlbest nonfiction books of 2021a appeared first on a relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap | pwhat incredible year nonfiction books let start picks 2020 buried avalanche covid news missed mobile usual books good list year emthey good best book yearemp pedward nelson spana relnoopener hrefhttpsmarginalrevolutioncommarginalrevolution202106theedwardnelsonbookonmiltonfriedmanhtml target_blankmilton friedman economic debate united states 19321972a volumes twospanp palexander mikaberidze relnoopener hrefhttpsmarginalrevolutioncommarginalrevolution202108howtotellwhenyouarereadingatrulygreathistorybookhtml target_blankthe napoleonic wars global historyap palso noteworthy reviel netz relnoopener hrefhttpswwwamazoncomscalespaceancientliteraryculturedp1108481477refsr_1_2keywordsrevielnetzqid1637634752qsid14214283993463341sr82sres10090698022c11084814772c08195695932cb005o16uiq2cb000u0spgq2c05211179842c11070145732c05216614552c11070143792c184465866x2cb08jqngx192cb088c2wd5f2cb079jdqkv42cb07jb5pm9p2cb007e9jera2cb01lxhfqmx target_blankscale space canon ancient literary culturea hope write aboutp pper usual typically short review 2021 proper favorites noting impose quota system whatsoever list cosmopolitan tallieshmm dont know list better best books year lists truly picks ranked roughly order read themp pjin xu relnoopener hrefhttpsmarginalrevolutioncommarginalrevolution202102empireofsilverhtml target_blankempire silver new monetary history chinaap pcat jarman relnoopener hrefhttpsmarginalrevolutioncommarginalrevolution202103whativebeenreading187html target_blankriver kings new history vikings scandinavia silk roadsap pmichela wrong relnoopener hrefhttpsmarginalrevolutioncommarginalrevolution202104thenewmichelawrongbookhtml target_blankdo disturb story political murder african regime gone badap pryan bourne relnoopener hrefhttpsmarginalrevolutioncommarginalrevolution202104whativebeenreading189html target_blankeconomics virus introduction economic reasoning covid19ap pcolin bryar bill carr relnoopener hrefhttpsmarginalrevolutioncommarginalrevolution202104whativebeenreading189html target_blankworking backwards insights stories secrets amazonap pivan gibbons relnoopener hrefhttpsmarginalrevolutioncommarginalrevolution202104partitionhowandwhyirelandwasdividedhtml target_blankpartition ireland dividedap pserhii plokhy relnoopener hrefhttpsmarginalrevolutioncommarginalrevolution202104nuclearfollyahistoryofthecubanmissilecrisishtml target_blanknuclear folly history cuban missile crisisap palan taylor relnoopener hrefhttpsmarginalrevolutioncommarginalrevolution202105americanrepublicshtml target_blankamerican republics continental history united states 17831850ap pwilliam deresiewicz relnoopener hrefhttpswwwamazoncomdeathartistcreatorsstrugglingbillionairesebookdpb07x186mhxrefsr_1_1dchild1keywordsdeathoftheartistqid1621000874sr81marginalrevol20 target_blankthe death artist creators struggling survive age billionaires big techa brief discussion relnoopener hrefhttpsmarginalrevolutioncommarginalrevolution202105whativebeenreading191html target_blankhereap proderick matthews relnoopener hrefhttpsmarginalrevolutioncommarginalrevolution202105peacepovertyandbetrayalhtml target_blankpeace poverty betrayal new history british indiaap palejandro ruiz carla altesor etal relnoopener hrefhttpswwwamazoncomfoodoaxacarecipesstoriesculinarydp0525657304refsr_1_1keywordsthefoodofoaxacaqid1637637124qsid14214283993463341sr81sres05256573042c141973542x2c00286035082c02927226642c14408692352c16487656962c16404908922c16315288072c02927358122c02927283282c03454259602c14654360572c07148675272c05175923552c15988096012c1350183830srptabis_book target_blankthe food oaxaca recipes stories mexicos culinary capitalap ptomas mandl relnoopener hrefhttpsmarginalrevolutioncommarginalrevolution202105modernparaguaysouthamericasbestkeptsecrethtml target_blankmodern paraguay south americas best kept secretap pkara walker relnoopener hrefhttpsmarginalrevolutioncommarginalrevolution202105whativebeenreading193html target_blanka black hole star longs beaspanspanp ptony saich relnoopener hrefhttpsmarginalrevolutioncommarginalrevolution202106chinafactoftheday65html target_blankfrom rebel ruler years chinese communist partyap padeeb khalid relnoopener hrefhttpsmarginalrevolutioncommarginalrevolution202107chinafactoftheday66html target_blankcentral asia new history imperial conquests presentap prichard zenith relnoopener hrefhttpsmarginalrevolutioncommarginalrevolution202108whativebeenreading199html target_blankpessoa biographyap pjohn b thompson relnoopener hrefhttpsmarginalrevolutioncommarginalrevolution202108whativebeenreading200html target_blankbook wars digital revolutionap pscott sumner relnoopener hrefhttpswwwamazoncommoneyillusionmonetarismrecessionmonetaryebookdpb09h38ylplrefsr_1_2keywordsscottsumnermoneyillusionqid1637632421qsid14214283993463341sr82sres022677368x2cb084yjp1882cb092rd74g42cb07r2fnt4l2cb002dq6eu42cb001ex8ayk2c14641825152cb000i1m5ou2cb08hmqt31j2cb085sxkrw52cb0039gek6c2cb0881whzhm2cb08byvqt9j2cb086h68bpq2cb07znf14vw2cb075r7bnxv target_blankthe money illusion market monetarism great recession future monetary policyap pa relnoopener hrefhttpsmarginalrevolutioncommarginalrevolution202110thegreatestbooksonafricaeverwrittenhtml target_blankarchitectural guide subsaharan africaap pjoanne limburg relnoopener hrefhttpsmarginalrevolutioncommarginalrevolution202110whativebeenreading206html target_blankletters weird sisters autism feminismap pmccartney paul relnoopener hrefhttpswwwamazoncomlyrics1956presentpaulmccartneydp163149256xrefsr_1_2cridr0vk5qkcwr6ykeywordspaulmccartneythelyricsqid1637632456qsid14214283993463341sprefixpaulm2caps2c174sr82sres163149256x2c145844063x2cb07b6vl2gr2cb09jvm1js52c09351129602c16451763392c05933724332c02415193302c15344658552c03162471702c05256486742cb09kn2lb8h2cb09kn5v2d52c03933240952c84480289022cb09kncx4t1srptabis_book target_blankthe lyricsa remarkably high quality production showing mccartneys skill manager entrepreneur biggest revelation paul insists beatles english teacher claims john big reader beatles striking surprising explaining lyrics times mentions mother passed away paul fourteen good david hajdu nyt review relnoopener hrefhttpswwwnytimescom20211106booksreviewthelyricspaulmccartneyhtml target_blankhereap pbob spitz relnoopener hrefhttpswwwamazoncomledzeppelinbiographybobspitzebookdpb08xtljcz7refsr_1_1keywordsbobspitzqid1637632617qsid14214283993463341sr81sres03995624272c03160133152c03933076972c01421808742c031611555x2c16189311482cb008u2q2z22cb07h381xrm2cb00421bn0e2cb09m117sdb2c16632228862cb0049mpvs62c163149256x2cb091wvm1jd2c09351129602c0306846683srptabis_book target_blankled zeppelin biographya end better think possibly best book themp pgestalten relnoopener hrefhttpswwwamazoncomhousedragonnewchinesearchitecturedp3899558723refsr_1_1keywordsbeautyandtheeastqid1637634516qsid14214283993463341sr81sres38995587232cb07n93xf4z2cb08635grys2cb0858mz1zr2cb00sdjg51s2cb077xc7k7v2c06700330492cb00hhfwfvi2cb09m7ljntp2cb07kvlv8sb2cb01a5nz2mc2cb09cg82ypy2cb088s723422cb08hvzl61c2cb07gdl95wl2cb08ynpf44h target_blankbeauty east new chinese architecturea selfrecommendingp pis best book 2021 categories hard compare maybe seven volumes relnoopener hrefhttpsmarginalrevolutioncommarginalrevolution202110thegreatestbooksonafricaeverwrittenhtml target_blankarchitectural guide subsaharan africaa fair seven volumes competition mccartney took volumes pessoa biography roderick matthews india choose apologies forgotten neglectedp pa relattachment wpatt82419 hrefhttpsmarginalrevolutioncomattachment_id82419img sizesmaxwidth 896px 100vw 896px srchttpmarginalrevolutioncomwpcontentuploads202111zlibraryjpg alt width896 srcsethttpmarginalrevolutioncomwpcontentuploads202111zlibraryjpg 896w httpmarginalrevolutioncomwpcontentuploads202111zlibrary300x114jpg 300w httpmarginalrevolutioncomwpcontentuploads202111zlibrary768x291jpg 768w classwpimage82419 height340aread relnoopener hrefhttpsmarginalrevolutioncommarginalrevolution202111myfavoritefictionof2021html target_blankmy favorite fiction 2021 lista write addendum list approach end 2021p pthe post relnofollow hrefhttpmarginalrevolutioncommarginalrevolution202111bestnonfictionbooksof2021htmlbest nonfiction books 2021a appeared relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap |
619d6de2572489d5834d8c86 | Kid Rock conservatism | pkid rock feels like he emerged from a time capsule left for us in the nineties perhaps along with dunkaroos and the decaying corpses of the simpsons who were replaced with inferior clones around the dawn of the millenniump
pin those heady days of numetal emjackassem and the attitude era bored suburbanites and neglected rednecks unleashed their frustrations into jubilantly crass and confrontational entertainment that turned the raising of a middle finger into a kind of sacred ritualp
pmr rocks breakout hit bawitdaba hailed the topless dancers and theheroes at the methadone clinic and scorned the crooked cops and all you bastards at the irs both he invited to well bawitdaba da bang da bang diggy diggy diggyp
pthis kind of inchoate antiauthoritarianism finds a voice again on mr rocks new single on dont tell me how to live rock tells the snowflakes and pussies that well they cant tell him how to live every kid got a motherfucking trophy he sneers and every opinion has a millennial offendedp
plet us be frank the song is trash but its trashiness is worn as a badge of pride what else can one conclude when the lyrics feature lines about being like brad pitt except [slinging] more dick and the video features rock soaring on a giant middle finger it emdares emcritics to insult it and in doing so give rock a perverse form of praise you imagine that he was delighted to see emrolling stone emcall his song a hrefhttpswwwgooglecomampswwwrollingstonecommusicmusicnewskidrocksnowflakesfakenewsnewsong1260716ampterriblea let the finger waggers wag their fingers im sure he thinks what matters are the good timesp
phis flaunting of bad taste used to make rock a curious outlier among republicans he offended veterans when he wore an american flag that had been cut open and shaped into a poncho at the 2004 super bowl perhaps evading greater controversy only because janet jacksons nipple slip occurred on the same eveningp
pyet when the nonetheless prowar rock performed at president bushs inauguration in 2005 social conservatives were appalled randy thomasson of the campaign for children and families was moved to a hrefhttpswwwblabbermouthnetnewskidrocksscheduledappearanceatbushinauguralshockingcondemna the singer whose debut single had announced that the best type of oochie coochie is the type that tastes like sushi if this sexcrazed animal whose favorite word is the fword is allowed to sing at bushs inauguration thomasson said this will send a clear message to profamily americans that the republican party has taken them for a ride and ditched them in the gutterp
prock did not appear leaving that honor to hilary duff 3 doors down and a band named fuel whose lead singer no doubt sent mr thomassons blood pressure lurching when he a hrefhttpswwwnbcnewscomidwbna6841404droppeda a cheerful fbomb he then drifted away and voted for obama in 2008 but was back to a hrefhttpsyoutubejkp9wggeesgcampaigning for romneya in 2012 romney even used his 2010 single born free as his campaign song god knows what poor mr thomasson thought of that donald trump in all of his natural irreverence was mr rocks ideal candidate and the singer was among his most energetic supporters in 2016 and 2020p
pmr rock is an especially ornate example of how cultural figures whose crudeness and social liberalism jar with traditional images of republicans have ended up drifting to the right you could also mention dave portnoy ceo of the jockular barstool sports empire or dana white the swollen president of the ultimate fighting championship their antiauthoritarianism puts them at odds with the safetyism and censoriousness of progressives as does their instinctive american patriotism as rock illustrated as far back as 1998 with bawitdaba they do not think much of taxation added to all this is their deep contempt for people who look down their noses at them which applies to suited moralists and liberal sophisticates alikep
pthis demographic sketched out granted in broad terms is an expansive one ranging from the macho libertarianinclined cashflashers of las vegas and miami that the social commentator matthew walther dubbed a hrefhttpstheweekcomarticles964006risebarstoolconservativesbarstool conservativesa to the ranchdreaming southerners who blast out kid rock as they screech into the sun it is an important demographic for republicans as they contemplate 2024p
pit is interesting to reflect on how or whether there can be concordance between kid rockian conservatives and the more religious traditionalist authoritarian and intellectual rightwingers of the new right who a hrefhttpsunherdcom202111theamericanrightscivilwargathereda at yoram hazonys national conservatism conference in orlando the always interesting commentator tanner greer sees an insurmountable contradiction the new right faces a fundamental mismatch of means and ends they hope to build a postlibertarian national order on the backs of the most naturally libertarian demographic in the countryp
pthis greer concludes is an unstable foundation for a postliberal body politic if there ever was onep
div
a hrefhttpsspectatorworldcomdcdiarylaunchofferimg alt width1200 srchttpsspectatorworldcomwpcontentuploads202110emailbannerpng classwpimage29978 height217a div
pwell mutual dislike counts for a lot if traditional and religious conservatives could overlook so much of what president trump has spent his life saying and doing perhaps kid rockian conservatives can overlook what may strike them as the wackier and stuffier elements of the new right if it lands punches on snowflakes oikophobes mask mandaters and music criticsp
pstill there will be conflict or compromise or both a lot of people who might now be singing dont tell me how to live with thoughts of sjws and dr fauci in mind will not take kindly to being told that emactually emthe common good emdoes emmean that people have the right in certain circumstances to tell you what to do you can only imagine how mr rock would respond to that perhaps it would go something like bawitdaba da bang da bang diggy diggy diggy you might disagree with his beliefs but you cannot fault his energyp
pthe post a relnofollow hrefhttpsspectatorworldcomtopickidrockconservatismkid rock conservatisma appeared first on a relnofollow hrefhttpsspectatorworldcomthe spectator worldap | pkid rock feels like emerged time capsule left nineties dunkaroos decaying corpses simpsons replaced inferior clones dawn millenniump pin heady days numetal emjackassem attitude era bored suburbanites neglected rednecks unleashed frustrations jubilantly crass confrontational entertainment turned raising middle finger kind sacred ritualp pmr rocks breakout hit bawitdaba hailed topless dancers theheroes methadone clinic scorned crooked cops bastards irs invited bawitdaba da bang da bang diggy diggy diggyp pthis kind inchoate antiauthoritarianism finds voice mr rocks new single dont tell live rock tells snowflakes pussies cant tell live kid got motherfucking trophy sneers opinion millennial offendedp plet frank song trash trashiness worn badge pride conclude lyrics feature lines like brad pitt [slinging] dick video features rock soaring giant middle finger emdares emcritics insult rock perverse form praise imagine delighted emrolling stone emcall song hrefhttpswwwgooglecomampswwwrollingstonecommusicmusicnewskidrocksnowflakesfakenewsnewsong1260716ampterriblea let finger waggers wag fingers im sure thinks matters good timesp phis flaunting bad taste rock curious outlier republicans offended veterans wore american flag cut open shaped poncho 2004 super bowl evading greater controversy janet jacksons nipple slip occurred eveningp pyet nonetheless prowar rock performed president bushs inauguration 2005 social conservatives appalled randy thomasson campaign children families moved hrefhttpswwwblabbermouthnetnewskidrocksscheduledappearanceatbushinauguralshockingcondemna singer debut single announced best type oochie coochie type tastes like sushi sexcrazed animal favorite word fword allowed sing bushs inauguration thomasson said send clear message profamily americans republican party taken ride ditched gutterp prock appear leaving honor hilary duff 3 doors band named fuel lead singer doubt sent mr thomassons blood pressure lurching hrefhttpswwwnbcnewscomidwbna6841404droppeda cheerful fbomb drifted away voted obama 2008 hrefhttpsyoutubejkp9wggeesgcampaigning romneya 2012 romney 2010 single born free campaign song god knows poor mr thomasson thought donald trump natural irreverence mr rocks ideal candidate singer energetic supporters 2016 2020p pmr rock especially ornate example cultural figures crudeness social liberalism jar traditional images republicans ended drifting right mention dave portnoy ceo jockular barstool sports empire dana white swollen president ultimate fighting championship antiauthoritarianism puts odds safetyism censoriousness progressives instinctive american patriotism rock illustrated far 1998 bawitdaba think taxation added deep contempt people look noses applies suited moralists liberal sophisticates alikep pthis demographic sketched granted broad terms expansive ranging macho libertarianinclined cashflashers las vegas miami social commentator matthew walther dubbed hrefhttpstheweekcomarticles964006risebarstoolconservativesbarstool conservativesa ranchdreaming southerners blast kid rock screech sun important demographic republicans contemplate 2024p pit interesting reflect concordance kid rockian conservatives religious traditionalist authoritarian intellectual rightwingers new right hrefhttpsunherdcom202111theamericanrightscivilwargathereda yoram hazonys national conservatism conference orlando interesting commentator tanner greer sees insurmountable contradiction new right faces fundamental mismatch means ends hope build postlibertarian national order backs naturally libertarian demographic countryp pthis greer concludes unstable foundation postliberal body politic onep div hrefhttpsspectatorworldcomdcdiarylaunchofferimg alt width1200 srchttpsspectatorworldcomwpcontentuploads202110emailbannerpng classwpimage29978 height217a div pwell mutual dislike counts lot traditional religious conservatives overlook president trump spent life saying kid rockian conservatives overlook strike wackier stuffier elements new right lands punches snowflakes oikophobes mask mandaters music criticsp pstill conflict compromise lot people singing dont tell live thoughts sjws dr fauci mind kindly told emactually emthe common good emdoes emmean people right certain circumstances tell imagine mr rock respond like bawitdaba da bang da bang diggy diggy diggy disagree beliefs fault energyp pthe post relnofollow hrefhttpsspectatorworldcomtopickidrockconservatismkid rock conservatisma appeared relnofollow hrefhttpsspectatorworldcomthe spectator worldap |
619d6e0a572489d5834d8c8a | By any other name | blockquote
pthe northern territorys covid19 outbreak is expected to grow beyond lockeddown areas after nine new cases were detected in the remote community of binjari about 320km south of darwinp
pbinjari and nearby rockhole have been placed into strict lockdown in response to the outbreak and the australian defence force has been called in to help with transferring positive cases and close contacts [sic]p
pthe nts chief minister michael gunner on sunday said a 78yearold woman was being treated in royal darwin hospital while the other eight cases had been taken to the howard springs quarantine centrep
blockquote
phere is a relnoopener hrefhttpswwwtheguardiancomaustralianews2021nov21ntcommunitiesofbinjariandrockholeinhardlockdownascovidoutbreakexpectedtoworsen target_blankthe full storya and a relnoopener hrefhttpswwwtheguardiancomaustralianews2021nov23aboriginalhealthgroupsaccusentgovernmentoflackofconsultationoncovidoutbreak target_blankfrom another storyap
blockquotepweve shared our supply of vaccine with aboriginal health organisations so they had enough consistent supply for everyone in their care to have a chance to be vaccinated over the past seven months gunner said in a statementpblockquote
pi wonder what a relnoopener hrefhttpsmobiletwittercomdrelidavidstatus1461906028392591366 target_blankthey think gibraltar should doa didnt all the australians tell me on twitter that things would be back to normal soon once enough vaccines were distributedp
pthe post a relnofollow hrefhttpmarginalrevolutioncommarginalrevolution202111byanyothernamehtmlby any other namea appeared first on a relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap | blockquote pthe northern territorys covid19 outbreak expected grow lockeddown areas new cases detected remote community binjari 320km south darwinp pbinjari nearby rockhole placed strict lockdown response outbreak australian defence force called help transferring positive cases close contacts [sic]p pthe nts chief minister michael gunner sunday said 78yearold woman treated royal darwin hospital cases taken howard springs quarantine centrep blockquote phere relnoopener hrefhttpswwwtheguardiancomaustralianews2021nov21ntcommunitiesofbinjariandrockholeinhardlockdownascovidoutbreakexpectedtoworsen target_blankthe storya relnoopener hrefhttpswwwtheguardiancomaustralianews2021nov23aboriginalhealthgroupsaccusentgovernmentoflackofconsultationoncovidoutbreak target_blankfrom storyap blockquotepweve shared supply vaccine aboriginal health organisations consistent supply care chance vaccinated past seven months gunner said statementpblockquote pi wonder relnoopener hrefhttpsmobiletwittercomdrelidavidstatus1461906028392591366 target_blankthey think gibraltar doa didnt australians tell twitter things normal soon vaccines distributedp pthe post relnofollow hrefhttpmarginalrevolutioncommarginalrevolution202111byanyothernamehtmlby namea appeared relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap |
619d6e21572489d5834d8c8c | Why I am fleeing to the hills | pspanin our current era of wildly overheated political discourse there are few things as remarkable as the gap between peoples stated preferences what they spanispansayspanispan they believe and their revealed preferences what they actually spanispandospanispan we see this in the recent trend for liberal americans particularly in the countrys northwest to begin a speech spana relnoopener hrefhttpstwittercompizzawanchoviesstatus1456639652337647620 target_blankspanwith a preamble acknowledgingspanaspan that they stand on land stolen from one native american tribe or another without showing any intention of actually divesting themselves of their property and returning it to the tribe in question its a purely rhetorical device and surely quite insulting in its effect spanp
pspanweve stolen your land they say and were very sorry about this terrible injustice but well keep it all the same similarly when purveyors of political discourse claim that america is now a white supremacist or even nazi state as in spana relnoopener hrefhttpseandcothesecondcomingofamericanfascism16e88b08fad4gid2cdf6a169b8 target_blankspanthis responsespanaspan to the rittenhouse verdict you wonder why they arent urgently fleeing to some safer location or at the very least organising some kind of underground armed resistance movement people say all kinds of wild things but if they dont follow through on the logic of their claims then its very hard to actually believe themspanp
divdiv
pspana similar dynamic is observable in terms of climate change discourse particularly with the extinction rebellion movement and its offshoot insulate britain both their activists and spokespeople spana relnoopener hrefhttpstwittercommaxcroserstatus1455644914327379978s20 target_blankspanmake the most alarming claimsspanaspan about the imminent end of civilisation perhaps within the next couple of decades but their revealed preferences dont seem to match the intensity of their predictions spanp
pspanpersonally if i genuinely believed that britain was going to become a postapocalyptic wasteland within the next twenty years i wouldnt be campaigning for the government to retrofit british houses with insulation id be selling everything and fleeing to the hills in a desperate effort to keep my family alive and yet they dont i have friends who go on xr demonstrations and repeat their most apocalyptic prophecies yet show no inclination of altering their middleclass lives in london their revealed preferences therefore cast great doubt on their stated beliefsspanp
diva hrefhttpsunherdcom202111thisishowcivilisationscollapserefinnara hrefhttpsunherdcom202111thisishowcivilisationscollapserefinnarimg srchttpsunherdcomwpcontentuploads2021112gettyimages1172305331scalede1637162794528300x171jpgadiva hrefhttpsunherdcom202111thisishowcivilisationscollapserefinnarspanmore from this authorspanaa hrefhttpsunherdcom202111thisishowcivilisationscollapserefinnarh5this is how civilisations collapseh5apa hrefhttpsunherdcom202111thisishowcivilisationscollapserefinnarspanbyspan aris roussinosapdivadiv
pspanit seems that with climate change in particular there are only two modes of thought for most people either nothing will change at all or everything is about to collapse in horrible and worlddestroying ways there is a more obvious conclusion that people seem resistant to thinking about that things will change in many ways for the worse but life will go on as the spana relnoopener hrefhttpsenwikipediaorgwikirupert_read target_blankspangreen philosopher rupert readspana a relnoopener hrefhttpsdocsgooglecomdocumentd1yjbpvci651_e1tsttyuuastj1dbyfahjmet8x7yqsqedit target_blankspanasksspanaspan why do we find it so hard to think about a world where the climate has changed massively veering between it wont make much difference everything is going to be fine to its the apocalypse the end of the world theres nothing we can do but refusing to think about the awful but more middling realities spanp
pspanit would seem more productive then instead of continuing with the path of climate change mitigation which is spana hrefhttpsnewsskycomstoryattenboroughsstarkwarningonclimatechangeitsalreadytoolate12226694spanprobably now too late to succeedspanaspan or of giving everything up for lost to instead focus popular attention on spana hrefhttpswwwinstituteforgovernmentorgukexplainersadaptationclimatechangespanadaptationspanaspan on making the best of a situation we cannot change but which is far from an apocalypse at least for the uk spanp
pspanthe issue at hand is that britain is responsible for a mere 1 of global carbon emissions so that even if we achieved net zero tomorrow nothing will change in terms of arresting climate change chinas increase in coal production spana relnoopener hrefhttpswwwnytimescom20211028businessenergyenvironmentchinacoalclimatehtml target_blankspanthis autumn alonespanaspan is already greater than britains total carbon emissions halting this process is in the real world almost entirely out of our hands spanp
pspanbut if we cant change what is about to happen we can at least prepare for it if you read the climate change commissions spana relnoopener hrefhttpswwwukclimateriskorgwpcontentuploads202106ccraevidencereportenglandsummaryfinalpdf target_blankspanrisk assessmentspanaspan for the rest of the century it assumes that britains temperature will rise by two degrees by 2100 in the worst scenario as much as four degrees such an outcome will be disastrous for much of the worlds population and i am not dismissing the gravity of the situation for billions of guiltless peoplespanp
pspanbut i live in britain and for britain having a similar climate to central france will not be the end of the world but we should start planning for it now just as noone now starves their families in solidarity with the hungry of the global south it is absurd and irresponsible to not plan a resilient and comfortable near future for our own country out of fatalism or an inchoate sense of global solidarityspanp
diva hrefhttpsunherdcom202110insideinsulatebritainrefinnara hrefhttpsunherdcom202110insideinsulatebritainrefinnarimg srchttpsunherdcomwpcontentuploads202110gettyimages1343105701scalede16355055913031300x179jpgadiva hrefhttpsunherdcom202110insideinsulatebritainrefinnarspanmore from this authorspanaa hrefhttpsunherdcom202110insideinsulatebritainrefinnarh5inside insulate britainh5apa hrefhttpsunherdcom202110insideinsulatebritainrefinnarspanbyspan aris roussinosapdivadiv
pspana rise of two degrees will return britain to its climate during the spana relnoopener hrefhttpswwwtheguardiancomenvironment2016jan29moderneuropeansummersarewarmestsinceromantimesstudyfinds target_blankspanroman warm periodspanaspan when an admittedly lower level of civilisation functioned perfectly well the risk assessment highlights the risk of flooding in lowlying areas the risk of drought in summer and the risks of disruption to international trade but its observations are all with sufficient planning and adaptation perfectly manageable it even observes that there are opportunities as well as risks and promotes a vast expansion of vineyards on british soil which with appropriate planning could become a spanspanspanspan50 million annual industry in just such a way if the british government cannot change what is about to happen it can at least start shaping the inevitable near future in ways that are beneficial for this country and by doing so and by being seen to act as if they believe what they claim to believe the government is far more likely to convince people about the inevitability of climate changespanp
pspanto understand why consider the early days of the covid crisis when governments and newspapers were dismissing the severity of the coming pandemic i was convinced to take it seriously by witnessing friends stockpiling masks while we were being assured they were useless and even harmful and laying in stores of food and other essential goods in case of trade disruption seeing people whose opinions you respect take a potential crisis seriously and planning how to navigate the changed world that comes with it is a convincing signal that you should take action yourself it means far more than hearing the government warn about doom on the horizon and then doing absolutely nothing like closing the borders to mitigate against it deeds are convincing in a way words are notspanp
pspanin the same way i personally take climate change seriously i believe in the predictions of the vast majority of the worlds scientists and thinking through the potential outcomes of such a worldchanging process i am planning how to adapt my lifestyle to best manage what is seemingly inevitable in the new year barring some unforeseen eventuality i will sell my house and buy a smallholding somewhere hilly and so at less risk of flooding than the coastal town where i currently live and with enough land that i can ensure my familys food supply in case of trade disruption or rising prices already in suburban kent we produce our own eggs and grow our own vegetables but i want to be selfsufficient in meat and milk beer and cider clean drinking water and bread i intend to document our progress in this column spanp
pspanits a way of living some are calling spana relnoopener hrefhttpswwwdoomsdayparentingcomarticleshomesteadingdoomeroptimism target_blankspandoomer optimismspanaspan i dont believe that society will collapse within my lifetime or that starvation will soon stalk the land but i do think theres a strong possibility that the cost of living will become significantly higher within the next two decades or so spana relnoopener hrefhttpswwwthisismoneycoukmoneybillsarticle10153393consumerspendingslowsamidrisingcostlivinghtml target_blankspanjust as the after effects of covid are now manifestingspanaspan to such a degree that it makes sense to rethink my familys way of living now to ensure a decent future quality of life in the years ahead spanp
diva hrefhttpsunherdcom202111icantescapemyecoanxietyrefinnara hrefhttpsunherdcom202111icantescapemyecoanxietyrefinnarimg srchttpsunherdcomwpcontentuploads2021112gettyimages11753392371300x169jpgadiva hrefhttpsunherdcom202111icantescapemyecoanxietyrefinnarspansuggested readingspanaa hrefhttpsunherdcom202111icantescapemyecoanxietyrefinnarh5i cant escape my ecoanxietyh5apa hrefhttpsunherdcom202111icantescapemyecoanxietyrefinnarspanbyspan henry wismayerapdivadiv
pspanthe question here isnt one of survival in a postapocalyptic wasteland but of ensuring an atmosphere of comfort and plenty in a likely world of spana relnoopener hrefhttpswwwtelegraphcoukbusiness20211020whitehallconsidersmeattaxslashcarbonemissions target_blankspanconsumption taxesspanaspan and spana relnoopener hrefhttpswwwfarmingukcomnewspublictoldtoeatasfewasoneandahalfeggseachweek_59363html target_blankspanrestrictionsspanaspan brought in through poorlythought out climate change mitigation efforts spana hrefhttpswwwipsjournaleutopicseconomyandecologywemustresistcorporategreenwashing5440spanthe intervention of corporate interestsspanaspan and occasional disruptions to international trade the current discourse around spana relnoopener hrefhttpswwwnewscientistcomarticle2295076eatlessmeatandflylesstohelpclimatesayspatrickvallance target_blankspanradically limiting food consumptionspanaspan presents such a dystopian and wildly unattractive future that it is no wonder people reject it especially when it does nothing to address spana hrefhttpswwwbbccomfuturearticle20211025climatehowtomaketherichpayfortheircarbonemissionstextthe20top2012520were20responsibleleast20responsibility20for20causing20themspanthe overconsumption of the worlds richestspanaspan i will not as they say spana relnoopener hrefhttpsideastedcomimpactoftinyhomesontheenvironmentandaffordablehousing target_blankspanlive in the podspanaspan and i will spana relnoopener hrefhttpstimecom5942290eatinsectssaveplanet target_blankspannot eat bugsspanaspan and neither should you we should demand better and there spanispanare spanispanalternative futures spanp
pspanbut first we need to show that were tackling the problem seriously as rupert read remarks in the recent book spana relnoopener hrefhttpswwwpolitybookscombookdetailbook_slugdeepadaptationnavigatingtherealitiesofclimatechaos9781509546831 target_blankispandeep adaptationspaniaspan every time we are seen to be preparing for possiblelikely hard times ahead we are making it possible for people and politics to start to really face climate reality as he observes if you act as if you mean what you say you believe people will believe you if you dont they wont in this way read argues it is a political act to act as if collapse is possible even if you dont believe it is likely just as you still install fire alarms even if you dont believe your house will imminently burn downspanp
pspanas with individuals so with government the governments push for net zero is expending a great deal of political capital on a mitigation effort that whatever its moral worth will do nothing to alter the risk of climate change one way or another in doing so it is alienating many people who appreciate even if only subliminally the vast disjunct between what the government claims is about to happen and its broader actions if the threat is so real people naturally think why isnt the nation mobilising to deal with the coming effects the narrow focus on net zero along with the attempt to prioritise individual essentially meaningless mitigation efforts like eating less meat is at this stage wildly counterproductive spanp
pspaninstead the government should like my family say that they cant change what is coming but that we can at least adapt to it now so that the wrench is less painful when it comes what would that mean on a national level if we accept that spanspanflooding is likely on britains most productive agricultural land spana relnoopener hrefhttpswwwedp24couknewsbusinessclimatecentralinteractivecoastaldemmapshowimpactofcoastalflooding1500592 target_blankspanin east angliaspanaspan we should be planning to spana relnoopener hrefhttpsappcronericoukfeaturearticleswillclimatechangetransformbritishlandscape target_blankspanopen up currently marginal hill pasture for cropsspanaspan to ensure a more stable food supply what would that look like it would probably be less mechanised and smaller scale simply due to the topography so we should be relearning how to manage such a mid20spanspanthspanspan century form of agriculture at sufficient cumulative scale which we are currently not doingspanp
diva hrefhttpsunherdcom202111climatechangewillnotbecatastrophicrefinnara hrefhttpsunherdcom202111climatechangewillnotbecatastrophicrefinnarimg srchttpsunherdcomwpcontentuploads2021112gettyimages1234987599300x200jpgadiva hrefhttpsunherdcom202111climatechangewillnotbecatastrophicrefinnarspansuggested readingspanaa hrefhttpsunherdcom202111climatechangewillnotbecatastrophicrefinnarh5climate change is no catastropheh5apa hrefhttpsunherdcom202111climatechangewillnotbecatastrophicrefinnarspanbyspan michael shellenbergerapdivadiv
pspanif the thames floodplain is at risk of spana relnoopener hrefhttpswwwstandardcouknewslondonlondonfloodingriskmapareasunderwater10yearsb950199html target_blankspanoccasional but devastating floodingspanaspan not from the sea but from builtover inland rivers we should discourage building in flat estuarine land spana relnoopener hrefhttpseandttheietorgcontentarticles202107ukhomesarenotsufficientlyprotectedfromclimatechangeriskavivawarns target_blankspanas insurers are already warningspanaspan and instead rezone hilly land in londons outer suburbs for housebuilding as well as improving londons spana relnoopener hrefhttpswwwbbccouknewsscienceenvironment57969877 target_blankspanoverwhelmed victorian drainage infrastructurespanaspan spanp
pspanif the government is incapable of building hs2 properly it is surely poorlyequipped to deal with the amount of adjustment that will be necessary to maintain currently functional levels of infrastructure we should be making spana relnoopener hrefhttpswiresonlinelibrarywileycomdoifull101002wcc728 target_blankspanrailtracks more resilient to floodingspanaspan building viaducts where necessary and spana relnoopener hrefhttpstheconversationcomfloodingcanhelpresurrectwetlandsandslowclimatechangehereshow148939 target_blankspandigging new water features and marshlandsspanaspan to absorb sudden deposits of water we should be overhauling our water supply to minimise spana hrefhttpswwwtheguardiancomenvironment2020mar25partsofenglandcouldrunoutofwaterunlessurgentactiontakenreportspanthe risk of droughtspanaspan and prevent avoidable water losses spana hrefhttpseandttheietorgcontentarticles201712waterleakagefromukpipesrisestooverthreebillionlitresadaytextengland20and20wales20lost2031water20per20property20each20dayspanthrough leaky pipesspanaspan we should be pedestrianising and spana hrefhttpswwwnytimescom20210702climatetreescitiesheatwaveshtmlspanplanting trees in citiesspanaspan now to make them cool and shady in twenty or thirty years time and building clean new transport infrastructure to take the place of cars we should be building more houses relaxing planning restrictions for family homes in the countryside so that more people are affordably able to take control of their personal family food supply if we claim that disasters are on the horizon yet do not build up the infrastructure now to cope with them why should anyone take these claims seriouslyspanp
pspanthere is a great deal of ingenuity in this country only now being focussed on technologies such as spana relnoopener hrefhttpsworldnuclearnewsorgarticlesfusiondemonstrationplanttobebuiltinuk target_blankspannuclear fusionspanaspan which may soon provide clean sources of almost limitless energy or on spana relnoopener hrefhttpswwwbbccouknewsukenglandderbyshire59359263 target_blankspanfast electric aeroplanesspanaspan and capacious spana relnoopener hrefhttpswwwdezeencom20210618airlanderelectricairshiphavsustainable target_blankspanelectric airshipsspanaspan which may be better used for freight than for human transport the medium term may be uncomfortable but the longterm future may be very good indeed if only for britain spanp
pspanto manage this will take a certain frontier spirit a willingness to make the best of and thrive in a harder situation than we are accustomed to instead of prophesying doom and then doing nothing about it we should be imagining a positive vision of what a britain adapted to climate change would look like a country of highspeed trains hurtling across tall viaducts between new hill towns with spana relnoopener hrefhttpswwwftcomcontenteae46ddcb71411e6961ea1acd97f622d target_blankspanlush vineyardsspanaspan overlooking the broad spana relnoopener hrefhttpswwwsouthamptonacuknews201809wetlandsclimatechangepage target_blankspannew wetlandsspanaspan on what was once farmland it is not too late to make the britain of the near future not just liveable but an improvement on what we have now life will go on it is our duty to make it as comfortable and prosperous as possible not just as individuals but as a nationspanp
a hrefhttpsunherdcom202111whyiamfleeingtothehillsappcommentsview 18 commentsa | pspanin current era wildly overheated political discourse things remarkable gap peoples stated preferences spanispansayspanispan believe revealed preferences actually spanispandospanispan recent trend liberal americans particularly countrys northwest begin speech spana relnoopener hrefhttpstwittercompizzawanchoviesstatus1456639652337647620 target_blankspanwith preamble acknowledgingspanaspan stand land stolen native american tribe showing intention actually divesting property returning tribe question purely rhetorical device surely insulting effectspanp pspanweve stolen land sorry terrible injustice similarly purveyors political discourse claim america white supremacist nazi state spana relnoopener hrefhttpseandcothesecondcomingofamericanfascism16e88b08fad4gid2cdf6a169b8 target_blankspanthis responsespanaspan rittenhouse verdict wonder arent urgently fleeing safer location organising kind underground armed resistance movement people kinds wild things dont follow logic claims hard actually believe themspanp divdiv pspana similar dynamic observable terms climate change discourse particularly extinction rebellion movement offshoot insulate britain activists spokespeople spana relnoopener hrefhttpstwittercommaxcroserstatus1455644914327379978s20 target_blankspanmake alarming claimsspanaspan imminent end civilisation couple decades revealed preferences dont match intensity predictionsspanp pspanpersonally genuinely believed britain going postapocalyptic wasteland years wouldnt campaigning government retrofit british houses insulation id selling fleeing hills desperate effort family alive dont friends xr demonstrations repeat apocalyptic prophecies inclination altering middleclass lives london revealed preferences cast great doubt stated beliefsspanp diva hrefhttpsunherdcom202111thisishowcivilisationscollapserefinnara hrefhttpsunherdcom202111thisishowcivilisationscollapserefinnarimg srchttpsunherdcomwpcontentuploads2021112gettyimages1172305331scalede1637162794528300x171jpgadiva hrefhttpsunherdcom202111thisishowcivilisationscollapserefinnarspanmore authorspanaa hrefhttpsunherdcom202111thisishowcivilisationscollapserefinnarh5this civilisations collapseh5apa hrefhttpsunherdcom202111thisishowcivilisationscollapserefinnarspanbyspan aris roussinosapdivadiv pspanit climate change particular modes thought people change collapse horrible worlddestroying ways obvious conclusion people resistant thinking things change ways worse life spana relnoopener hrefhttpsenwikipediaorgwikirupert_read target_blankspangreen philosopher rupert readspana relnoopener hrefhttpsdocsgooglecomdocumentd1yjbpvci651_e1tsttyuuastj1dbyfahjmet8x7yqsqedit target_blankspanasksspanaspan find hard think world climate changed massively veering wont difference going fine apocalypse end world theres refusing think awful middling realitiesspanp pspanit productive instead continuing path climate change mitigation spana hrefhttpsnewsskycomstoryattenboroughsstarkwarningonclimatechangeitsalreadytoolate12226694spanprobably late succeedspanaspan giving lost instead focus popular attention spana hrefhttpswwwinstituteforgovernmentorgukexplainersadaptationclimatechangespanadaptationspanaspan making best situation change far apocalypse ukspanp pspanthe issue hand britain responsible mere 1 global carbon emissions achieved net zero tomorrow change terms arresting climate change chinas increase coal production spana relnoopener hrefhttpswwwnytimescom20211028businessenergyenvironmentchinacoalclimatehtml target_blankspanthis autumn alonespanaspan greater britains total carbon emissions halting process real world entirely handsspanp pspanbut cant change happen prepare read climate change commissions spana relnoopener hrefhttpswwwukclimateriskorgwpcontentuploads202106ccraevidencereportenglandsummaryfinalpdf target_blankspanrisk assessmentspanaspan rest century assumes britains temperature rise degrees 2100 worst scenario degrees outcome disastrous worlds population dismissing gravity situation billions guiltless peoplespanp pspanbut live britain britain having similar climate central france end world start planning starves families solidarity hungry global south absurd irresponsible plan resilient comfortable near future country fatalism inchoate sense global solidarityspanp diva hrefhttpsunherdcom202110insideinsulatebritainrefinnara hrefhttpsunherdcom202110insideinsulatebritainrefinnarimg srchttpsunherdcomwpcontentuploads202110gettyimages1343105701scalede16355055913031300x179jpgadiva hrefhttpsunherdcom202110insideinsulatebritainrefinnarspanmore authorspanaa hrefhttpsunherdcom202110insideinsulatebritainrefinnarh5inside insulate britainh5apa hrefhttpsunherdcom202110insideinsulatebritainrefinnarspanbyspan aris roussinosapdivadiv pspana rise degrees return britain climate spana relnoopener hrefhttpswwwtheguardiancomenvironment2016jan29moderneuropeansummersarewarmestsinceromantimesstudyfinds target_blankspanroman warm periodspanaspan admittedly lower level civilisation functioned perfectly risk assessment highlights risk flooding lowlying areas risk drought summer risks disruption international trade observations sufficient planning adaptation perfectly manageable observes opportunities risks promotes vast expansion vineyards british soil appropriate planning spanspanspanspan50 million annual industry way british government change happen start shaping inevitable near future ways beneficial country seen act believe claim believe government far likely convince people inevitability climate changespanp pspanto understand consider early days covid crisis governments newspapers dismissing severity coming pandemic convinced seriously witnessing friends stockpiling masks assured useless harmful laying stores food essential goods case trade disruption seeing people opinions respect potential crisis seriously planning navigate changed world comes convincing signal action means far hearing government warn doom horizon absolutely like closing borders mitigate deeds convincing way words notspanp pspanin way personally climate change seriously believe predictions vast majority worlds scientists thinking potential outcomes worldchanging process planning adapt lifestyle best manage seemingly inevitable new year barring unforeseen eventuality sell house buy smallholding hilly risk flooding coastal town currently live land ensure familys food supply case trade disruption rising prices suburban kent produce eggs grow vegetables want selfsufficient meat milk beer cider clean drinking water bread intend document progress columnspanp pspanits way living calling spana relnoopener hrefhttpswwwdoomsdayparentingcomarticleshomesteadingdoomeroptimism target_blankspandoomer optimismspanaspan dont believe society collapse lifetime starvation soon stalk land think theres strong possibility cost living significantly higher decades spana relnoopener hrefhttpswwwthisismoneycoukmoneybillsarticle10153393consumerspendingslowsamidrisingcostlivinghtml target_blankspanjust effects covid manifestingspanaspan degree makes sense rethink familys way living ensure decent future quality life years aheadspanp diva hrefhttpsunherdcom202111icantescapemyecoanxietyrefinnara hrefhttpsunherdcom202111icantescapemyecoanxietyrefinnarimg srchttpsunherdcomwpcontentuploads2021112gettyimages11753392371300x169jpgadiva hrefhttpsunherdcom202111icantescapemyecoanxietyrefinnarspansuggested readingspanaa hrefhttpsunherdcom202111icantescapemyecoanxietyrefinnarh5i cant escape ecoanxietyh5apa hrefhttpsunherdcom202111icantescapemyecoanxietyrefinnarspanbyspan henry wismayerapdivadiv pspanthe question isnt survival postapocalyptic wasteland ensuring atmosphere comfort plenty likely world spana relnoopener hrefhttpswwwtelegraphcoukbusiness20211020whitehallconsidersmeattaxslashcarbonemissions target_blankspanconsumption taxesspanaspan spana relnoopener hrefhttpswwwfarmingukcomnewspublictoldtoeatasfewasoneandahalfeggseachweek_59363html target_blankspanrestrictionsspanaspan brought poorlythought climate change mitigation efforts spana hrefhttpswwwipsjournaleutopicseconomyandecologywemustresistcorporategreenwashing5440spanthe intervention corporate interestsspanaspan occasional disruptions international trade current discourse spana relnoopener hrefhttpswwwnewscientistcomarticle2295076eatlessmeatandflylesstohelpclimatesayspatrickvallance target_blankspanradically limiting food consumptionspanaspan presents dystopian wildly unattractive future wonder people reject especially address spana hrefhttpswwwbbccomfuturearticle20211025climatehowtomaketherichpayfortheircarbonemissionstextthe20top2012520were20responsibleleast20responsibility20for20causing20themspanthe overconsumption worlds richestspanaspan spana relnoopener hrefhttpsideastedcomimpactoftinyhomesontheenvironmentandaffordablehousing target_blankspanlive podspanaspan spana relnoopener hrefhttpstimecom5942290eatinsectssaveplanet target_blankspannot eat bugsspanaspan demand better spanispanare spanispanalternative futuresspanp pspanbut need tackling problem seriously rupert read remarks recent book spana relnoopener hrefhttpswwwpolitybookscombookdetailbook_slugdeepadaptationnavigatingtherealitiesofclimatechaos9781509546831 target_blankispandeep adaptationspaniaspan time seen preparing possiblelikely hard times ahead making possible people politics start face climate reality observes act mean believe people believe dont wont way read argues political act act collapse possible dont believe likely install fire alarms dont believe house imminently burn downspanp pspanas individuals government governments push net zero expending great deal political capital mitigation effort moral worth alter risk climate change way alienating people appreciate subliminally vast disjunct government claims happen broader actions threat real people naturally think isnt nation mobilising deal coming effects narrow focus net zero attempt prioritise individual essentially meaningless mitigation efforts like eating meat stage wildly counterproductivespanp pspaninstead government like family cant change coming adapt wrench painful comes mean national level accept spanspanflooding likely britains productive agricultural land spana relnoopener hrefhttpswwwedp24couknewsbusinessclimatecentralinteractivecoastaldemmapshowimpactofcoastalflooding1500592 target_blankspanin east angliaspanaspan planning spana relnoopener hrefhttpsappcronericoukfeaturearticleswillclimatechangetransformbritishlandscape target_blankspanopen currently marginal hill pasture cropsspanaspan ensure stable food supply look like probably mechanised smaller scale simply topography relearning manage mid20spanspanthspanspan century form agriculture sufficient cumulative scale currently doingspanp diva hrefhttpsunherdcom202111climatechangewillnotbecatastrophicrefinnara hrefhttpsunherdcom202111climatechangewillnotbecatastrophicrefinnarimg srchttpsunherdcomwpcontentuploads2021112gettyimages1234987599300x200jpgadiva hrefhttpsunherdcom202111climatechangewillnotbecatastrophicrefinnarspansuggested readingspanaa hrefhttpsunherdcom202111climatechangewillnotbecatastrophicrefinnarh5climate change catastropheh5apa hrefhttpsunherdcom202111climatechangewillnotbecatastrophicrefinnarspanbyspan michael shellenbergerapdivadiv pspanif thames floodplain risk spana relnoopener hrefhttpswwwstandardcouknewslondonlondonfloodingriskmapareasunderwater10yearsb950199html target_blankspanoccasional devastating floodingspanaspan sea builtover inland rivers discourage building flat estuarine land spana relnoopener hrefhttpseandttheietorgcontentarticles202107ukhomesarenotsufficientlyprotectedfromclimatechangeriskavivawarns target_blankspanas insurers warningspanaspan instead rezone hilly land londons outer suburbs housebuilding improving londons spana relnoopener hrefhttpswwwbbccouknewsscienceenvironment57969877 target_blankspanoverwhelmed victorian drainage infrastructurespanaspanspanp pspanif government incapable building hs2 properly surely poorlyequipped deal adjustment necessary maintain currently functional levels infrastructure making spana relnoopener hrefhttpswiresonlinelibrarywileycomdoifull101002wcc728 target_blankspanrailtracks resilient floodingspanaspan building viaducts necessary spana relnoopener hrefhttpstheconversationcomfloodingcanhelpresurrectwetlandsandslowclimatechangehereshow148939 target_blankspandigging new water features marshlandsspanaspan absorb sudden deposits water overhauling water supply minimise spana hrefhttpswwwtheguardiancomenvironment2020mar25partsofenglandcouldrunoutofwaterunlessurgentactiontakenreportspanthe risk droughtspanaspan prevent avoidable water losses spana hrefhttpseandttheietorgcontentarticles201712waterleakagefromukpipesrisestooverthreebillionlitresadaytextengland20and20wales20lost2031water20per20property20each20dayspanthrough leaky pipesspanaspan pedestrianising spana hrefhttpswwwnytimescom20210702climatetreescitiesheatwaveshtmlspanplanting trees citiesspanaspan cool shady thirty years time building clean new transport infrastructure place cars building houses relaxing planning restrictions family homes countryside people affordably able control personal family food supply claim disasters horizon build infrastructure cope claims seriouslyspanp pspanthere great deal ingenuity country focussed technologies spana relnoopener hrefhttpsworldnuclearnewsorgarticlesfusiondemonstrationplanttobebuiltinuk target_blankspannuclear fusionspanaspan soon provide clean sources limitless energy spana relnoopener hrefhttpswwwbbccouknewsukenglandderbyshire59359263 target_blankspanfast electric aeroplanesspanaspan capacious spana relnoopener hrefhttpswwwdezeencom20210618airlanderelectricairshiphavsustainable target_blankspanelectric airshipsspanaspan better freight human transport medium term uncomfortable longterm future good britainspanp pspanto manage certain frontier spirit willingness best thrive harder situation accustomed instead prophesying doom imagining positive vision britain adapted climate change look like country highspeed trains hurtling tall viaducts new hill towns spana relnoopener hrefhttpswwwftcomcontenteae46ddcb71411e6961ea1acd97f622d target_blankspanlush vineyardsspanaspan overlooking broad spana relnoopener hrefhttpswwwsouthamptonacuknews201809wetlandsclimatechangepage target_blankspannew wetlandsspanaspan farmland late britain near future liveable improvement life duty comfortable prosperous possible individuals nationspanp hrefhttpsunherdcom202111whyiamfleeingtothehillsappcommentsview 18 commentsa |
619d6e24572489d5834d8c8e | The socialism America needs | pclobbered from all sides by the pandemic climate change and disruptions in virtually every industry by the rise of artificial intelligence the capitalist dream is a relnoopener hrefhttpsinsidermagnetsurveyshowspeoplenolongerbelieveworkinghardwillleadtoabetterlife target_blankdyinga and a new mutant form of socialism is growing in its place in the us perhaps its no surprise that most a relnoopener hrefhttpsnypostcom20210812majorityofdemocraticvotersnowprefersocialismtocapitalismpollfinds target_blankdemocratsa have a better opinion of socialism than capitalism far more startling is the fact that they are not alone the republican party and the corporate establishment which once paid lip service to competitive capitalism are both starting to embrace the importance of massive deficit spending and state supportp
pbut unlike the social democracy movements that followed world war two the new socialism focusses not on material aspirations but on climate change gender and race while the old socialism sought to represent the ordinary labourer many on the left today seem to have little more than contempt for old workingclass base and its often less than genteel views on issues such as critical race theoryp
divdiv
pyet perhaps the most critical difference between traditional socialism and its new form relates to growth the new socialisms emphasis on climate change necessarily removes economic growth as a priority quite the opposite in fact a relnoopener hrefhttpswwwsciencedirectcomsciencearticlepiis0959378021000662s0140 target_blankthe green agendaa looks instead towards a shrinking economy and lowered living standards seeking to elevate favoured groups within a stagnant economy rather than generating opportunities for the general populationp
pas a result this new variant of socialism seems more feudal than marxist as a relnoopener hrefhttpsnypostcom20211013karlmarxwouldvehatedalexandriaocasiocortezandtheleft target_blankedwin apontea editor of the socialist blog emthe bellowsem has observed marx opposed utopian socialists with their dreams of a return to the cohesive social order of feudal times instead he favoured using technology and economic growth to lift them upp
diva hrefhttpsunherdcom202111didcriticalracetheorylosevirginiarefinnara hrefhttpsunherdcom202111didcriticalracetheorylosevirginiarefinnarimg srchttpsunherdcomwpcontentuploads202111gettyimages13509840581300x169jpgadiva hrefhttpsunherdcom202111didcriticalracetheorylosevirginiarefinnarspanmore from this authorspanaa hrefhttpsunherdcom202111didcriticalracetheorylosevirginiarefinnarh5did critical race theory lose virginiah5apa hrefhttpsunherdcom202111didcriticalracetheorylosevirginiarefinnarspanbyspan joel kotkinapdivadiv
palexandria ocasiocortez may not realise that a relnoopener hrefhttpswidworlddocumentwhyiseuropemoreequalthantheunitedstatesworldinequalitylabwp202019 target_blankthe muchadmired european socialist systema was built on the back of a private sector but the truth is that virtually all the successful welfare states germany netherlands scandinavia rose a relnoopener hrefhttpswwwjstororgstable43294504 target_blankon competitive economiesa swedish steel dutch chemicals german machine tools and cars were critical to funding socialist programs in capitalist countries but as this model slowly crumbles as a relnoopener hrefhttpseceuropaeueurostatwebproductseurostatnewsddn202107051 target_blankeuropea loses its competitive edge to china and elsewhere this lesson appears to have been forgotten and in its place has risen a new socialism that serves a relnoopener hrefhttpswwwrealclearenergyorgarticles20211109net_zero_and_green_financial_repression_802581html target_blankwall streeta the city and the tech oligarchyp
pthe usual response from environmental activists is that the rapid transition to zero carbon will create oodles of new wellpaid jobs in a relnoopener hrefhttpsnabtuorgpress_releasestwonewenergyconstructionstudies target_blankrealitya however these jobs generally pay less offer fewer hours and are rarely unionised the reality facing the middle class is an acceleration of our class divides and lower living standards its long been a relnoopener hrefhttpswwwtheguardiancomusnews2021aug22citiesclimatechangedensesprawlyimbynimby target_blankemde rigueurem on the green lefta to cut back on homeownership a relnoopener hrefhttpswwwwalesonlinecouknewsuknewsdriverspaypermilenew21606705 target_blanklimita use of private cars or even fly on vacation in other words those who will suffer most are the very people whom socialism is supposed to save already energy poverty is on the rise in those places from a relnoopener hrefhttpsthebreakthroughorgjournalno14summer2021greenjimcrow target_blankcaliforniaa a relnoopener hrefhttpswwwcnncom20210930businesseuropeenergypovertyindexhtml target_blankto the eua where punitive fuel costs have been increasedp
pelsewhere supply chain problems and inflation are now dismissed as a relnoopener hrefhttpswwwindependentcouknewsworldamericasuspoliticswhitehouseronklainsupplychainb1938387html target_blankhighclass problemsa even if it also means a relnoopener hrefhttpswwwbloombergcomnewsarticles20211104americanmilkisgettingmoreexpensivewithpricesup26 target_blankhigh pricesa for essentials such as milk gas and rent ema relnoopener hrefhttpswwwmsncomenusmoneymarketsstopshoppingaraapqboq target_blankthe atlanticaem a premier voice of the gentry left grumbles that americas central organizing principle is thoughtless consumption echoing the kind of homily handed out by medieval clerics to disgruntled serfsp
pyet nowhere is the hierarchical nature of feudalistic socialism clearer than in the property markets social democrats may have once celebrated people owning homes or cars but new greentinged policies would lead to those becoming an option only for the rich while opening a vast market for a relnoopener hrefhttpswwwbloombergcomopinionarticles20210805firsttimehomebuyersaregettingsqueezedoutbywallstreet target_blankfinancial firmsa to buy single family homes and turn them into rentals just look at a relnoopener hrefhttpsmichaelshellenbergersubstackcompwhyiamnota20progressivetokeneyj1c2vyx2lkijoznta0mjgwmswicg9zdf9pzci6mzk4mzy1nzgsil8ioijwujdpriisimlhdci6mtyyodyxmdyzmcwizxhwijoxnji4nje0mjmwlcjpc3mioijwdwitmjc5ndawiiwic3viijoicg9zdc1yzwfjdglvbij9whwaojnnqgbwfeo3b2vcpkawezdymqe_psnmrmf3cw target_blankcaliforniaa where green progressives wield almost unlimited power and which is now home to rising inequality a relnoopener hrefhttpswwwbusinessinsidercomcaliforniahashighestpovertylevelintheuscensusbureau20219 target_blankthe nations highest poverty ratea and the second lowest percentage of homeownersp
diva hrefhttpsunherdcom202110canthesouthescapeitsdemonsrefinnara hrefhttpsunherdcom202110canthesouthescapeitsdemonsrefinnarimg srchttpsunherdcomwpcontentuploads2021102gettyimages1052872664scalede1633255105610300x169jpgadiva hrefhttpsunherdcom202110canthesouthescapeitsdemonsrefinnarspanmore from this authorspanaa hrefhttpsunherdcom202110canthesouthescapeitsdemonsrefinnarh5can the south escape its demonsh5apa hrefhttpsunherdcom202110canthesouthescapeitsdemonsrefinnarspanbyspan joel kotkinapdivadiv
pof course this mindset is not confined to the left in the uk for example a relnoopener hrefhttpswwwconservativehomecomplatform202107craigmackinlaythegovernmentisfoolingitselfifitthinksitcangodownthenetzeropathwithoutelectoraldamagehtmlmc_cid045a5a55e9mc_eid4961da7cb1 target_blankboris johnsons conservativesa have proposed climatebased rules that would force homeowners their political base to retrofit their homes for thousands of pounds while forcing them to abandon affordable gas heaters for less effective electric ones this reflects what a relnoopener hrefhttpswwwopendemocracynetenoureconomydegrowthdelusion target_blankone socialista neatly labels ecothatcherism in a relnoopener hrefhttpswwwconservativehomecomplatform202107craigmackinlaythegovernmentisfoolingitselfifitthinksitcangodownthenetzeropathwithoutelectoraldamagehtmlmc_cid045a5a55e9mc_eid4961da7cb1 target_blankbritainap
pbut there can be little doubt that the biggest change is taking place on the left historically the british and australian labour parties the french socialist party americas democrats and canadas liberals evolved from a strong workingclass base but in recent years for both economic and cultural reasons these parties have become dominated by professionals academics and government workers increasingly bent on introducing paternalistic puritan policiesp
pultimately many of the old leftwing parties may end up losing out to the ascendant greens who could be the real winners of the rise of new socialism it is not inconceivable that they could take power across europe particularly in a relnoopener hrefhttpswwwbbccomnewsworldeurope58910712 target_blankgermanya where the countrys a relnoopener hrefhttpswwwwsjcomarticlesgermanyeconomylaggingbehindeuropesupplychain11636383954 target_blanktraditional industrial basea has shrunk in the us although theres not much chance of the greens challenging the ruling political duopoly there are a relnoopener hrefhttpsunherdcom202111howthedemocratscouldsplit target_blankclear signsa that the democrats could find themselves torn between the need to represent both progressives and the partys bluecollar basep
pyet it didnt have to be this way the lefts green policies might be big on virtue but moves to eliminate energy and industrial jobs make no sense if we are going to depend on fossil fuels for at least the next few decades it seems futile to be shutting down domestic pipelines curbing energy production and raising electricity prices while begging the saudis or the detestable putin regime to drill morep
pa more traditional socialist would promote domestic production particularly natural gas while also trying to shift production away from a relnoopener hrefhttpswwwyahoocomnowchinadoublesdowncoaldespite230000975html target_blankcoaldependenta china the worlds primary emitter chinas xi continues to a relnoopener hrefhttpswwwnytimescom20211013businesschinaelectricityshortagehtml target_blankbuild new coal plantsa and arrange for longterm oil supplies from the middle east unlike our leftwing parties xi knows the grip on keeping power rests on meeting the aspirations of his subjects not dampening thembr
diva hrefhttpsunherdcom202109westerncultureisdeadrefinnara hrefhttpsunherdcom202109westerncultureisdeadrefinnarimg srchttpsunherdcomwpcontentuploads202109gettyimages1233729882e16324789528391300x184jpgadiva hrefhttpsunherdcom202109westerncultureisdeadrefinnarspansuggested readingspanaa hrefhttpsunherdcom202109westerncultureisdeadrefinnarh5the west has lost its rootsh5apa hrefhttpsunherdcom202109westerncultureisdeadrefinnarspanbyspan paul kingsnorthapdivadiv
pto remain relevant the left needs to return to the basics a relnoopener hrefhttpswwwscielobrjrepatpdjqgdjpzv4pwtvxr6p6xzlangen target_blanksocial democracya as first developed in places like sweden sought to bolster families and allow for improvements in daily life throughout history economic growth has been critical to making societies wealthier while making it far easier to distribute salves to the poor invest in environmental improvements and work to improve conditions for historically disadvantaged minorities good jobs and economic expansion notes economic historian a relnoopener hrefhttpswwwamazoncoukmoralconsequenceseconomicgrowthdp1400095719 target_blankbenjamin friedmana are the best antidote for rising intolerance and incivilityp
pis there still hope for a more socially beneficial kind of socialism certainly elements of the recently passed bipartisan infrastructure bill could help american industry compete with china people more than anything want roads bridges and ports fixed but all this risks being undone if the democrats continue to press for more extreme measures a relnoopener hrefhttpswwwvoxcom2021101822724808democratssenatedisadvantageshorklein target_blankmore moderate democratsa will lose their seats and the gop will gain control of the housep
pmany on a relnoopener hrefhttpsjacobinmagcom202111democratsbidenpennsteinelectionscenterleftreconciliation target_blankthe lefta deny the electoral reality and claim the party can only win by moving towards a relnoopener hrefhttpswwwwsjcomarticlesbuildbackbettertaxincreasessubsidieshouseholdincome11634592447 target_blankmore assertive redistributiona antiracist and draconian climate policies meanwhile the republicans are redoubling efforts to forge a social democratic agenda crafting an aggressive programme of tax breaks for working families upholding educational choice in states such as virginia and committing to aggressive reshoring for industry floridas senator a relnoopener hrefhttpswwwyahoocomnewsrubiocallsgoprebranddivorce215928892html target_blankmarco rubioa has even called for a divorce with the financial and corporate elitep
pits an encouraging sign even though such moves will be adamantly opposed by the a relnoopener hrefhttpsnationalinterestorgfeaturecaseeconomicarmscontrol195250page02c3 target_blankbearers of libertarian orthodoxya who have shaped the party for a generation and have the support of many of the partys big funders in the end then both the libertarians and feudal socialists could find themselves rejected by the majority of the population after all a society bedevilled by rising inequality racial tensions a pandemic and complex issues around climate change is as unlikely to accept honeyed words about the market being efficient as it would tolerate an increasingly intrusive state that squashes their aspirations in the name of environmental virtuep
psomething else is needed policies that address the competitive economy while preserving upward mobility economic growth and an environment improved by technological changes in other words we need a socialism that is rooted in the needs of the working and middle classes not one that seeks to keep them in their placep
a hrefhttpsunherdcom202111thesocialismamericaneedsappcommentsview 5 commentsa | pclobbered sides pandemic climate change disruptions virtually industry rise artificial intelligence capitalist dream relnoopener hrefhttpsinsidermagnetsurveyshowspeoplenolongerbelieveworkinghardwillleadtoabetterlife target_blankdyinga new mutant form socialism growing place surprise relnoopener hrefhttpsnypostcom20210812majorityofdemocraticvotersnowprefersocialismtocapitalismpollfinds target_blankdemocratsa better opinion socialism capitalism far startling fact republican party corporate establishment paid lip service competitive capitalism starting embrace importance massive deficit spending state supportp pbut unlike social democracy movements followed world war new socialism focusses material aspirations climate change gender race old socialism sought represent ordinary labourer left today little contempt old workingclass base genteel views issues critical race theoryp divdiv pyet critical difference traditional socialism new form relates growth new socialisms emphasis climate change necessarily removes economic growth priority opposite fact relnoopener hrefhttpswwwsciencedirectcomsciencearticlepiis0959378021000662s0140 target_blankthe green agendaa looks instead shrinking economy lowered living standards seeking elevate favoured groups stagnant economy generating opportunities general populationp pas result new variant socialism feudal marxist relnoopener hrefhttpsnypostcom20211013karlmarxwouldvehatedalexandriaocasiocortezandtheleft target_blankedwin apontea editor socialist blog emthe bellowsem observed marx opposed utopian socialists dreams return cohesive social order feudal times instead favoured technology economic growth lift upp diva hrefhttpsunherdcom202111didcriticalracetheorylosevirginiarefinnara hrefhttpsunherdcom202111didcriticalracetheorylosevirginiarefinnarimg srchttpsunherdcomwpcontentuploads202111gettyimages13509840581300x169jpgadiva hrefhttpsunherdcom202111didcriticalracetheorylosevirginiarefinnarspanmore authorspanaa hrefhttpsunherdcom202111didcriticalracetheorylosevirginiarefinnarh5did critical race theory lose virginiah5apa hrefhttpsunherdcom202111didcriticalracetheorylosevirginiarefinnarspanbyspan joel kotkinapdivadiv palexandria ocasiocortez realise relnoopener hrefhttpswidworlddocumentwhyiseuropemoreequalthantheunitedstatesworldinequalitylabwp202019 target_blankthe muchadmired european socialist systema built private sector truth virtually successful welfare states germany netherlands scandinavia rose relnoopener hrefhttpswwwjstororgstable43294504 target_blankon competitive economiesa swedish steel dutch chemicals german machine tools cars critical funding socialist programs capitalist countries model slowly crumbles relnoopener hrefhttpseceuropaeueurostatwebproductseurostatnewsddn202107051 target_blankeuropea loses competitive edge china lesson appears forgotten place risen new socialism serves relnoopener hrefhttpswwwrealclearenergyorgarticles20211109net_zero_and_green_financial_repression_802581html target_blankwall streeta city tech oligarchyp pthe usual response environmental activists rapid transition zero carbon create oodles new wellpaid jobs relnoopener hrefhttpsnabtuorgpress_releasestwonewenergyconstructionstudies target_blankrealitya jobs generally pay offer fewer hours rarely unionised reality facing middle class acceleration class divides lower living standards long relnoopener hrefhttpswwwtheguardiancomusnews2021aug22citiesclimatechangedensesprawlyimbynimby target_blankemde rigueurem green lefta cut homeownership relnoopener hrefhttpswwwwalesonlinecouknewsuknewsdriverspaypermilenew21606705 target_blanklimita use private cars fly vacation words suffer people socialism supposed save energy poverty rise places relnoopener hrefhttpsthebreakthroughorgjournalno14summer2021greenjimcrow target_blankcaliforniaa relnoopener hrefhttpswwwcnncom20210930businesseuropeenergypovertyindexhtml target_blankto eua punitive fuel costs increasedp pelsewhere supply chain problems inflation dismissed relnoopener hrefhttpswwwindependentcouknewsworldamericasuspoliticswhitehouseronklainsupplychainb1938387html target_blankhighclass problemsa means relnoopener hrefhttpswwwbloombergcomnewsarticles20211104americanmilkisgettingmoreexpensivewithpricesup26 target_blankhigh pricesa essentials milk gas rent ema relnoopener hrefhttpswwwmsncomenusmoneymarketsstopshoppingaraapqboq target_blankthe atlanticaem premier voice gentry left grumbles americas central organizing principle thoughtless consumption echoing kind homily handed medieval clerics disgruntled serfsp pyet hierarchical nature feudalistic socialism clearer property markets social democrats celebrated people owning homes cars new greentinged policies lead option rich opening vast market relnoopener hrefhttpswwwbloombergcomopinionarticles20210805firsttimehomebuyersaregettingsqueezedoutbywallstreet target_blankfinancial firmsa buy single family homes turn rentals look relnoopener hrefhttpsmichaelshellenbergersubstackcompwhyiamnota20progressivetokeneyj1c2vyx2lkijoznta0mjgwmswicg9zdf9pzci6mzk4mzy1nzgsil8ioijwujdpriisimlhdci6mtyyodyxmdyzmcwizxhwijoxnji4nje0mjmwlcjpc3mioijwdwitmjc5ndawiiwic3viijoicg9zdc1yzwfjdglvbij9whwaojnnqgbwfeo3b2vcpkawezdymqe_psnmrmf3cw target_blankcaliforniaa green progressives wield unlimited power home rising inequality relnoopener hrefhttpswwwbusinessinsidercomcaliforniahashighestpovertylevelintheuscensusbureau20219 target_blankthe nations highest poverty ratea second lowest percentage homeownersp diva hrefhttpsunherdcom202110canthesouthescapeitsdemonsrefinnara hrefhttpsunherdcom202110canthesouthescapeitsdemonsrefinnarimg srchttpsunherdcomwpcontentuploads2021102gettyimages1052872664scalede1633255105610300x169jpgadiva hrefhttpsunherdcom202110canthesouthescapeitsdemonsrefinnarspanmore authorspanaa hrefhttpsunherdcom202110canthesouthescapeitsdemonsrefinnarh5can south escape demonsh5apa hrefhttpsunherdcom202110canthesouthescapeitsdemonsrefinnarspanbyspan joel kotkinapdivadiv pof course mindset confined left uk example relnoopener hrefhttpswwwconservativehomecomplatform202107craigmackinlaythegovernmentisfoolingitselfifitthinksitcangodownthenetzeropathwithoutelectoraldamagehtmlmc_cid045a5a55e9mc_eid4961da7cb1 target_blankboris johnsons conservativesa proposed climatebased rules force homeowners political base retrofit homes thousands pounds forcing abandon affordable gas heaters effective electric ones reflects relnoopener hrefhttpswwwopendemocracynetenoureconomydegrowthdelusion target_blankone socialista neatly labels ecothatcherism relnoopener hrefhttpswwwconservativehomecomplatform202107craigmackinlaythegovernmentisfoolingitselfifitthinksitcangodownthenetzeropathwithoutelectoraldamagehtmlmc_cid045a5a55e9mc_eid4961da7cb1 target_blankbritainap pbut little doubt biggest change taking place left historically british australian labour parties french socialist party americas democrats canadas liberals evolved strong workingclass base recent years economic cultural reasons parties dominated professionals academics government workers increasingly bent introducing paternalistic puritan policiesp pultimately old leftwing parties end losing ascendant greens real winners rise new socialism inconceivable power europe particularly relnoopener hrefhttpswwwbbccomnewsworldeurope58910712 target_blankgermanya countrys relnoopener hrefhttpswwwwsjcomarticlesgermanyeconomylaggingbehindeuropesupplychain11636383954 target_blanktraditional industrial basea shrunk theres chance greens challenging ruling political duopoly relnoopener hrefhttpsunherdcom202111howthedemocratscouldsplit target_blankclear signsa democrats find torn need represent progressives partys bluecollar basep pyet didnt way lefts green policies big virtue moves eliminate energy industrial jobs sense going depend fossil fuels decades futile shutting domestic pipelines curbing energy production raising electricity prices begging saudis detestable putin regime drill morep pa traditional socialist promote domestic production particularly natural gas trying shift production away relnoopener hrefhttpswwwyahoocomnowchinadoublesdowncoaldespite230000975html target_blankcoaldependenta china worlds primary emitter chinas xi continues relnoopener hrefhttpswwwnytimescom20211013businesschinaelectricityshortagehtml target_blankbuild new coal plantsa arrange longterm oil supplies middle east unlike leftwing parties xi knows grip keeping power rests meeting aspirations subjects dampening thembr diva hrefhttpsunherdcom202109westerncultureisdeadrefinnara hrefhttpsunherdcom202109westerncultureisdeadrefinnarimg srchttpsunherdcomwpcontentuploads202109gettyimages1233729882e16324789528391300x184jpgadiva hrefhttpsunherdcom202109westerncultureisdeadrefinnarspansuggested readingspanaa hrefhttpsunherdcom202109westerncultureisdeadrefinnarh5the west lost rootsh5apa hrefhttpsunherdcom202109westerncultureisdeadrefinnarspanbyspan paul kingsnorthapdivadiv pto remain relevant left needs return basics relnoopener hrefhttpswwwscielobrjrepatpdjqgdjpzv4pwtvxr6p6xzlangen target_blanksocial democracya developed places like sweden sought bolster families allow improvements daily life history economic growth critical making societies wealthier making far easier distribute salves poor invest environmental improvements work improve conditions historically disadvantaged minorities good jobs economic expansion notes economic historian relnoopener hrefhttpswwwamazoncoukmoralconsequenceseconomicgrowthdp1400095719 target_blankbenjamin friedmana best antidote rising intolerance incivilityp pis hope socially beneficial kind socialism certainly elements recently passed bipartisan infrastructure bill help american industry compete china people want roads bridges ports fixed risks undone democrats continue press extreme measures relnoopener hrefhttpswwwvoxcom2021101822724808democratssenatedisadvantageshorklein target_blankmore moderate democratsa lose seats gop gain control housep pmany relnoopener hrefhttpsjacobinmagcom202111democratsbidenpennsteinelectionscenterleftreconciliation target_blankthe lefta deny electoral reality claim party win moving relnoopener hrefhttpswwwwsjcomarticlesbuildbackbettertaxincreasessubsidieshouseholdincome11634592447 target_blankmore assertive redistributiona antiracist draconian climate policies republicans redoubling efforts forge social democratic agenda crafting aggressive programme tax breaks working families upholding educational choice states virginia committing aggressive reshoring industry floridas senator relnoopener hrefhttpswwwyahoocomnewsrubiocallsgoprebranddivorce215928892html target_blankmarco rubioa called divorce financial corporate elitep pits encouraging sign moves adamantly opposed relnoopener hrefhttpsnationalinterestorgfeaturecaseeconomicarmscontrol195250page02c3 target_blankbearers libertarian orthodoxya shaped party generation support partys big funders end libertarians feudal socialists find rejected majority population society bedevilled rising inequality racial tensions pandemic complex issues climate change unlikely accept honeyed words market efficient tolerate increasingly intrusive state squashes aspirations environmental virtuep psomething needed policies address competitive economy preserving upward mobility economic growth environment improved technological changes words need socialism rooted needs working middle classes seeks placep hrefhttpsunherdcom202111thesocialismamericaneedsappcommentsview 5 commentsa |
619ebd7c52b2b940271f6227 | Groomer Schools 2: Queer Futurity and the Sexual Abuse of Your Children | h4the new discourses podcast with james lindsay episode 55h4
pin the a hrefhttpsnewdiscoursescom202111groomerschools1longculturalmarxisthistorysexeducationprevious episodea of the new discourses podcast james lindsay revealed the long history of the problem of groomer schools and horrible as it is it barely communicates just how bad things really are in this followup episode lindsay reads through an academic paper at the intersection of early childhood education and queer theory two subjects that should never be mixed the 2019 paper is called queer futurity and childhood innocence beyond the injury of development by hannah dyer of carleton university canada in this episode of the podcast james reads through this paper in full offering his usual level of commentary and revealing just how insidious and dangerous the agenda in the public schools is critical race theory is honestly among the least of our problems if you can believe it join him and prepare to be appalled at what the critical marxists who have taken over our education system have in mind for our childrenp
hr
pemsubscribe to the new discourses podcast on spanspana relnoopener noreferrer hrefhttpssoundcloudcomnewdiscourses target_blanksoundcloudaspanspan spanspana relnoopener noreferrer hrefhttpspodcastsapplecomuspodcastnewdiscoursesid1499880546 target_blankapple podcastsaspanspan spanspana relnoopener noreferrer hrefhttpspodcastsgooglecomfeedahr0cdovl2zlzwrzlnnvdw5ky2xvdwquy29tl3vzzxjzl3nvdw5ky2xvdwq6dxnlcnm6nzgxmte2mzi1l3nvdw5kcy5yc3m target_blankgoogle podcastsaspanspan spanspana relnoopener noreferrer hrefhttpsopenspotifycomshow0hfzdaxi5l4lnjqstfwgzpsikd5rtswgt1epiuyrixmlgw target_blankspotifyaspanspan spanspana relnoopener noreferrer hrefhttpswwwstitchercompodcastnewdiscourses target_blankstitcheraspanspana relnoopener noreferrer hrefhttpswwwstitchercompodcastnewdiscourses target_blanka spanspana relnoopener noreferrer hrefhttpswwwyoutubecomplaylistlistpl2hruftaprxcqcbydcaullid2d9exyny target_blankyoutubeaspanspan or by spanspana relnoopener noreferrer hrefhttpsfeedssoundcloudcomuserssoundcloudusers781116325soundsrss target_blankrssaspanspanemp
pemprevious episodes of the new discourses podcast are available spanspana relnoopener hrefhttpsnewdiscoursescomtagndpodcast target_blankhereaspanspanemp
pthe post a relnofollow hrefhttpsnewdiscoursescom202111groomerschools2queerfuturityandthesexualabuseofyourchildrengroomer schools 2 queer futurity and the sexual abuse of your childrena appeared first on a relnofollow hrefhttpsnewdiscoursescomnew discoursesap | h4the new discourses podcast james lindsay episode 55h4 pin hrefhttpsnewdiscoursescom202111groomerschools1longculturalmarxisthistorysexeducationprevious episodea new discourses podcast james lindsay revealed long history problem groomer schools horrible barely communicates bad things followup episode lindsay reads academic paper intersection early childhood education queer theory subjects mixed 2019 paper called queer futurity childhood innocence injury development hannah dyer carleton university canada episode podcast james reads paper offering usual level commentary revealing insidious dangerous agenda public schools critical race theory honestly problems believe join prepare appalled critical marxists taken education system mind childrenp hr pemsubscribe new discourses podcast spanspana relnoopener noreferrer hrefhttpssoundcloudcomnewdiscourses target_blanksoundcloudaspanspanspanspana relnoopener noreferrer hrefhttpspodcastsapplecomuspodcastnewdiscoursesid1499880546 target_blankapple podcastsaspanspanspanspana relnoopener noreferrer hrefhttpspodcastsgooglecomfeedahr0cdovl2zlzwrzlnnvdw5ky2xvdwquy29tl3vzzxjzl3nvdw5ky2xvdwq6dxnlcnm6nzgxmte2mzi1l3nvdw5kcy5yc3m target_blankgoogle podcastsaspanspanspanspana relnoopener noreferrer hrefhttpsopenspotifycomshow0hfzdaxi5l4lnjqstfwgzpsikd5rtswgt1epiuyrixmlgw target_blankspotifyaspanspanspanspana relnoopener noreferrer hrefhttpswwwstitchercompodcastnewdiscourses target_blankstitcheraspanspana relnoopener noreferrer hrefhttpswwwstitchercompodcastnewdiscourses target_blankaspanspana relnoopener noreferrer hrefhttpswwwyoutubecomplaylistlistpl2hruftaprxcqcbydcaullid2d9exyny target_blankyoutubeaspanspan byspanspana relnoopener noreferrer hrefhttpsfeedssoundcloudcomuserssoundcloudusers781116325soundsrss target_blankrssaspanspanemp pemprevious episodes new discourses podcast available spanspana relnoopener hrefhttpsnewdiscoursescomtagndpodcast target_blankhereaspanspanemp pthe post relnofollow hrefhttpsnewdiscoursescom202111groomerschools2queerfuturityandthesexualabuseofyourchildrengroomer schools 2 queer futurity sexual abuse childrena appeared relnofollow hrefhttpsnewdiscoursescomnew discoursesap |
619ebd9852b2b940271f622b | Tyler Cowen on complementarity and gratitude | blockquotepone fan with a helpful perspective on the wizards is tyler cowen a professor of economics at nearby george mason university he says that even he was surprised they were able to move wall and then westbrooks contracts so effectively but whats more interesting to him about the wizards these days is whats happening on the court they have quite a few players who are good enough shooters cowen said in an email when everyone on the floor is a good enough shooter the good enough shooters are better than you might thinkp
pthis is a useful way of thinking about the entire team in a league where the ultimate goal is greatness the wizards are showing the power of pretty good its the sort of progress that precedes successp
ptheir ceiling still might be pretty low cowen said but for the time being we can enjoy the ridepblockquote
phere is a relnoopener hrefhttpswwwwsjcomarticleswashingtonwizardsnba11637727165 target_blankmore from ben cohen at the wall street journalap
pthe post a relnofollow hrefhttpmarginalrevolutioncommarginalrevolution202111tylercowenoncomplementarityandgratitudehtmltyler cowen on complementarity and gratitudea appeared first on a relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap | blockquotepone fan helpful perspective wizards tyler cowen professor economics nearby george mason university says surprised able wall westbrooks contracts effectively whats interesting wizards days whats happening court players good shooters cowen said email floor good shooter good shooters better thinkp pthis useful way thinking entire team league ultimate goal greatness wizards showing power pretty good sort progress precedes successp ptheir ceiling pretty low cowen said time enjoy ridepblockquote phere relnoopener hrefhttpswwwwsjcomarticleswashingtonwizardsnba11637727165 target_blankmore ben cohen wall street journalap pthe post relnofollow hrefhttpmarginalrevolutioncommarginalrevolution202111tylercowenoncomplementarityandgratitudehtmltyler cowen complementarity gratitudea appeared relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap |
619ebdad52b2b940271f622f | Abolish Intellectual Property Rights? | div
picture
source sizesminwidth 600px 331px 100vw typeimagewebp srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202111podcast_thumbnail_8140317jpgwebp 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202111podcast_thumbnail_81403171200x675jpgwebp 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202111podcast_thumbnail_8140317800x450jpgwebp 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202111podcast_thumbnail_8140317600x338jpgwebp 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202111podcast_thumbnail_8140317331x186jpgwebp 331w
source sizesminwidth 600px 331px 100vw typeimagejpeg srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202111podcast_thumbnail_8140317jpg 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202111podcast_thumbnail_81403171200x675jpg 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202111podcast_thumbnail_8140317800x450jpg 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202111podcast_thumbnail_8140317600x338jpg 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202111podcast_thumbnail_8140317331x186jpg 331w
img width1200 altpodcast_thumbnail_8140317 srchttpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202111podcast_thumbnail_8140317800x450jpg height675
picture
div
pspanthe united states constitution explicitly calls for copyright and patent laws to quotpromote the progress of science and useful artsquot by quotauthors and inventorsquot but would getting rid of spanispanallspanispan intellectual property laws actually encourage spanispanmorespanispan creativity and innovation by inventors writers and artistsspanp
pspanthat was the topic of a november 15 a hrefhttpswwwthesohoforumorgstephankinsellavsrichardepsteinbiosoho forum debatea held in new york cityspanp
pspana hrefhttpstwittercomnskinsellastephan kinsellaa whos spent 28 years as a practicing patent a hrefhttpwwwkinsellalawcomlaw attorneya argued in favor of the proposition that quotall patent and copyright law should be abolishedquotspanp
pspanhe believes that governmentcreated intellectual property laws empower patent and copyright trolls and powerful corporate interests while limiting the free flow of information thus reducing the rate of innovation and creativity spanp
pspana hrefhttpswwwhooverorgprofilesrichardepsteinrichard epsteina the laurence a tisch professor of law at nyu school of law says that our current system isnt perfect but sees copyright and patents as a natural extension of private property rights and believes that it should be defended by libertarians accordingly spanp
pspanthe debate took place in new york city in front of a live audience and was moderated by soho forum director a hrefhttpstwittercomgenesohoforumgene epsteinaspanp
pemnarrated by nick gillespieemem edited by john osterhoudt production by caveat photos by brett raneyemp
pthe post a relnofollow hrefhttpsreasoncompodcast20211124abolishintellectualpropertyrightsabolish intellectual property rightsa appeared first on a relnofollow hrefhttpsreasoncomreasoncomap | div picture source sizesminwidth 600px 331px 100vw typeimagewebp srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202111podcast_thumbnail_8140317jpgwebp 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202111podcast_thumbnail_81403171200x675jpgwebp 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202111podcast_thumbnail_8140317800x450jpgwebp 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202111podcast_thumbnail_8140317600x338jpgwebp 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202111podcast_thumbnail_8140317331x186jpgwebp 331w source sizesminwidth 600px 331px 100vw typeimagejpeg srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202111podcast_thumbnail_8140317jpg 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202111podcast_thumbnail_81403171200x675jpg 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202111podcast_thumbnail_8140317800x450jpg 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202111podcast_thumbnail_8140317600x338jpg 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202111podcast_thumbnail_8140317331x186jpg 331w img width1200 altpodcast_thumbnail_8140317 srchttpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202111podcast_thumbnail_8140317800x450jpg height675 picture div pspanthe united states constitution explicitly calls copyright patent laws quotpromote progress science useful artsquot quotauthors inventorsquot getting rid spanispanallspanispan intellectual property laws actually encourage spanispanmorespanispan creativity innovation inventors writers artistsspanp pspanthat topic november 15 hrefhttpswwwthesohoforumorgstephankinsellavsrichardepsteinbiosoho forum debatea held new york cityspanp pspana hrefhttpstwittercomnskinsellastephan kinsellaa whos spent 28 years practicing patent hrefhttpwwwkinsellalawcomlaw attorneya argued favor proposition quotall patent copyright law abolishedquotspanp pspanhe believes governmentcreated intellectual property laws empower patent copyright trolls powerful corporate interests limiting free flow information reducing rate innovation creativity spanp pspana hrefhttpswwwhooverorgprofilesrichardepsteinrichard epsteina laurence tisch professor law nyu school law says current system isnt perfect sees copyright patents natural extension private property rights believes defended libertarians accordinglyspanp pspanthe debate took place new york city live audience moderated soho forum director hrefhttpstwittercomgenesohoforumgene epsteinaspanp pemnarrated nick gillespieemem edited john osterhoudt production caveat photos brett raneyemp pthe post relnofollow hrefhttpsreasoncompodcast20211124abolishintellectualpropertyrightsabolish intellectual property rightsa appeared relnofollow hrefhttpsreasoncomreasoncomap |
619ebdf452b2b940271f6239 | Abolish Copyrights and Patents? A Soho Forum Debate | div
picture
source sizesminwidth 600px 331px 100vw typeimagewebp srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202111vid_8140312_thumbnail2jpgwebp 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202111vid_8140312_thumbnail21200x675jpgwebp 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202111vid_8140312_thumbnail2800x450jpgwebp 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202111vid_8140312_thumbnail2600x338jpgwebp 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202111vid_8140312_thumbnail2331x186jpgwebp 331w
source sizesminwidth 600px 331px 100vw typeimagejpeg srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202111vid_8140312_thumbnail2jpg 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202111vid_8140312_thumbnail21200x675jpg 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202111vid_8140312_thumbnail2800x450jpg 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202111vid_8140312_thumbnail2600x338jpg 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202111vid_8140312_thumbnail2331x186jpg 331w
img width1200 altvid_8140312_thumbnail 2 srchttpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202111vid_8140312_thumbnail2800x450jpg height675
picture
div
pspanthe united states constitution explicitly calls for copyright and patent laws to quotpromote the progress of science and useful artsquot by quotauthors and inventorsquot but would getting rid of spanispanallspanispan intellectual property laws actually encourage spanispanmorespanispan creativity and innovation by inventors writers and artistsspanp
pspanthat was the topic of a november 15 a hrefhttpswwwthesohoforumorgstephankinsellavsrichardepsteinbiosoho forum debatea held in new york cityspanp
pspana hrefhttpstwittercomnskinsellastephan kinsellaa whos spent 28 years as a practicing patent a hrefhttpwwwkinsellalawcomlaw attorneya argued in favor of the proposition that quotall patent and copyright law should be abolishedquotspanp
pspanhe believes that governmentcreated intellectual property laws empower patent and copyright trolls and powerful corporate interests while limiting the free flow of information thus reducing the rate of innovation and creativity spanp
pspana hrefhttpswwwhooverorgprofilesrichardepsteinrichard epsteina the laurence a tisch professor of law at new york university school of law says that our current system isnt perfect but sees copyright and patents as a natural extension of private property rights and believes that it should be defended by libertarians accordingly spanp
pspanthe debate took place in front of a live audience and was moderated by soho forum director a hrefhttpstwittercomgenesohoforumgene epsteinaspanp
pemnarrated by nick gillespie eememdited by john osterhoudt produced by caveat photos by brett raneyemp
pthe post a relnofollow hrefhttpsreasoncomvideo20211124abolishcopyrightsandpatentsasohoforumdebateabolish copyrights and patents a soho forum debatea appeared first on a relnofollow hrefhttpsreasoncomreasoncomap | div picture source sizesminwidth 600px 331px 100vw typeimagewebp srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202111vid_8140312_thumbnail2jpgwebp 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202111vid_8140312_thumbnail21200x675jpgwebp 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202111vid_8140312_thumbnail2800x450jpgwebp 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202111vid_8140312_thumbnail2600x338jpgwebp 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202111vid_8140312_thumbnail2331x186jpgwebp 331w source sizesminwidth 600px 331px 100vw typeimagejpeg srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202111vid_8140312_thumbnail2jpg 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202111vid_8140312_thumbnail21200x675jpg 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202111vid_8140312_thumbnail2800x450jpg 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202111vid_8140312_thumbnail2600x338jpg 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202111vid_8140312_thumbnail2331x186jpg 331w img width1200 altvid_8140312_thumbnail 2 srchttpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202111vid_8140312_thumbnail2800x450jpg height675 picture div pspanthe united states constitution explicitly calls copyright patent laws quotpromote progress science useful artsquot quotauthors inventorsquot getting rid spanispanallspanispan intellectual property laws actually encourage spanispanmorespanispan creativity innovation inventors writers artistsspanp pspanthat topic november 15 hrefhttpswwwthesohoforumorgstephankinsellavsrichardepsteinbiosoho forum debatea held new york cityspanp pspana hrefhttpstwittercomnskinsellastephan kinsellaa whos spent 28 years practicing patent hrefhttpwwwkinsellalawcomlaw attorneya argued favor proposition quotall patent copyright law abolishedquotspanp pspanhe believes governmentcreated intellectual property laws empower patent copyright trolls powerful corporate interests limiting free flow information reducing rate innovation creativity spanp pspana hrefhttpswwwhooverorgprofilesrichardepsteinrichard epsteina laurence tisch professor law new york university school law says current system isnt perfect sees copyright patents natural extension private property rights believes defended libertarians accordinglyspanp pspanthe debate took place live audience moderated soho forum director hrefhttpstwittercomgenesohoforumgene epsteinaspanp pemnarrated nick gillespie eememdited john osterhoudt produced caveat photos brett raneyemp pthe post relnofollow hrefhttpsreasoncomvideo20211124abolishcopyrightsandpatentsasohoforumdebateabolish copyrights patents soho forum debatea appeared relnofollow hrefhttpsreasoncomreasoncomap |
619ebe2952b2b940271f6241 | Carlsen vs. Nepo | phere is a relnoopener hrefhttpswwwbloombergcomopinionarticles20211124chessworldchampionship2021itscarlsenversusnepoandcustomversuschangeutm_sourcetwitterutm_mediumsocialutm_contentviewutm_campaignsocialfloworganiccmpid3dsocialflowtwitterviewsrefhtohjx5y target_blankmy bloomberg columna on that topicp
blockquote
phe [carlsen] recently a relnoopener hrefhttpschess24comenreadnewscarlsengoodoutcometofaceneponotfabiording target_blankopineda that he is lucky to be facing nepo rather than two other potential challengers fabio caruana or ding liren thats the kind of trash talk most sports competitors frown upon for fear of motivating opponentsp
pcarlsen also has been a relnoopener hrefhttpslichessorgdrnykterstein target_blankengaginga in online marathons of a relnoopener hrefhttpswwwchesscomtermsbulletchesswhatis target_blankbullet chessa exactly the kind of attentiondisrupting energydraining stunt contenders are supposed to avoid in a bullet game each player has only one minute for all the moves the pace is so rapid the games are hard to watch much less play carlsen also made a recent appearance in dortmund germany in part to pose for a photo with a norwegian soccer player nepo in contrast a relnoopener hrefhttpsfivethirtyeightcomfeaturesaschessboomsmagnuscarlsenreturnstodefendhiscrown target_blankclaimsa to have done an insane amount of work for the eventp
pwill the fast thinking of bullet chess help carlsen see more moves during the much slower time controls of the match with nepo a championship game can easily last four hours or more or maybe the bullet success will intimidate nepop
pcarlsen also is making it clear that for him chess is a a relnoopener hrefhttpswwwnytimescom20211122sportsmagnuscarlsenchesshtml target_blankbusinessa proposition his parents set up a company in his name when he was 16 and the commercial empire since has expanded carlsen has worked as a fashion model endorsed an online sports betting site and worked with a norwegian water company he sponsors a leading chess app and has organized his own series of online chess tournaments played with more rapid time controls during the pandemic those events arguably have attracted more attention than any of the mainstream tournamentsp
pcarlsen is probably at the point where even a loss in the match would barely affect his income stream and that is a dangerous motivational place to bep
pnepo is considered a supertalented but inconsistent player one who does not bounce back well from adversity but if he stays focused he could pose a formidable challenge he was never expected to be a challenger in the first place so he may feel he has little to lose and in accord with his naturally aggressive style he can take all the chances he wants carlsen is considered the a relnoopener hrefhttpswwwchesscomarticleview2021worldchesschampionshipsmarterchesspredictions target_blanksuperiora player perhaps the greatest ever and remains a heavy a relnoopener hrefhttpswwwoddscheckercomchesscarlsenvnepomniachtchiwinner target_blankfavoritea with the sports betting sitespblockquote
pi am picking carlsen to win and on the future of chessp
blockquote
pcarlsen has argued that the mainstream matches of classical chess are too slow and yield too many draws he would a relnoopener hrefhttpswwwtheguardiancomsport2021nov19chessmagnuscarlsenandiannepomniachtchifaceofffor2mindubai target_blankprefera a time limit of around 25 minutes per game per player to become the default why shouldnt the world of chess switch over to a system that spectators seem to preferp
pif carlsen retains his title he may well lead such a switch and it would be hard for the chess establishment to resist if nepo wins the match carlsen might secede from the current system causing the chess world to splinterp
pwhat we are seeing in the leadup to this match is this a healthy chess world is going to be a more diversely organized chess world with a lot of disagreement over which forms of chess are most important twitch a relnoopener hrefhttpswwwtwitchtvgmhikaru target_blankstreaminga and a relnoopener hrefhttpswwwyoutubecomresultssearch_querybotezchess target_blankyoutubea already have joined the mix chess is likely to retain its recent a relnoopener hrefhttpswwwbloombergcomopinionarticles20181113worldchesschampionship2018ismadefortheinternet target_blankpopularitya but in doing so it will fully realize its destiny as the a relnoopener hrefhttpsenwikipediaorgwikiesports target_blankesporta it has already become the good news is that if you dont like the outcome of the upcoming chess drama you can find another one to watch the next dayp
blockquote
precommendedp
pthe post a relnofollow hrefhttpmarginalrevolutioncommarginalrevolution202111carlsenvsnepohtmlcarlsen vs nepoa appeared first on a relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap | phere relnoopener hrefhttpswwwbloombergcomopinionarticles20211124chessworldchampionship2021itscarlsenversusnepoandcustomversuschangeutm_sourcetwitterutm_mediumsocialutm_contentviewutm_campaignsocialfloworganiccmpid3dsocialflowtwitterviewsrefhtohjx5y target_blankmy bloomberg columna topicp blockquote phe [carlsen] recently relnoopener hrefhttpschess24comenreadnewscarlsengoodoutcometofaceneponotfabiording target_blankopinedathat lucky facing nepo potential challengers fabio caruana ding liren thats kind trash talk sports competitors frown fear motivating opponentsp pcarlsen beena relnoopener hrefhttpslichessorgdrnykterstein target_blankengagingain online marathons ofa relnoopener hrefhttpswwwchesscomtermsbulletchesswhatis target_blankbullet chessaexactly kind attentiondisrupting energydraining stunt contenders supposed avoid bullet game player minute moves pace rapid games hard watch play carlsen recent appearance dortmund germany pose photo norwegian soccer player nepo contrasta relnoopener hrefhttpsfivethirtyeightcomfeaturesaschessboomsmagnuscarlsenreturnstodefendhiscrown target_blankclaimsato insane work eventp pwill fast thinking bullet chess help carlsen moves slower time controls match nepo championship game easily hours moreor maybe bullet success intimidate nepop pcarlsen making clear chess aa relnoopener hrefhttpswwwnytimescom20211122sportsmagnuscarlsenchesshtml target_blankbusinessaproposition parents set company 16 commercial empire expanded carlsen worked fashion model endorsed online sports betting site worked norwegian water company sponsors leading chess app organized series online chess tournaments played rapid time controls pandemic events arguably attracted attention mainstream tournamentsp pcarlsen probably point loss match barely affect income stream dangerous motivational place bep pnepo considered supertalented inconsistent player bounce adversity stays focused pose formidable challenge expected challenger place feel little lose accord naturally aggressive style chances wants carlsen considered thea relnoopener hrefhttpswwwchesscomarticleview2021worldchesschampionshipsmarterchesspredictions target_blanksuperioraplayer greatest remains heavya relnoopener hrefhttpswwwoddscheckercomchesscarlsenvnepomniachtchiwinner target_blankfavoriteawith sports betting sitespblockquote pi picking carlsen win future chessp blockquote pcarlsen argued mainstream matches classical chess slow yield draws woulda relnoopener hrefhttpswwwtheguardiancomsport2021nov19chessmagnuscarlsenandiannepomniachtchifaceofffor2mindubai target_blankpreferaa time limit 25 minutes game player default shouldnt world chess switch system spectators preferp pif carlsen retains title lead switch hard chess establishment resist nepo wins match carlsen secede current system causing chess world splinterp pwhat seeing leadup match healthy chess world going diversely organized chess world lot disagreement forms chess important twitcha relnoopener hrefhttpswwwtwitchtvgmhikaru target_blankstreamingaanda relnoopener hrefhttpswwwyoutubecomresultssearch_querybotezchess target_blankyoutubeaalready joined mix chess likely retain recenta relnoopener hrefhttpswwwbloombergcomopinionarticles20181113worldchesschampionship2018ismadefortheinternet target_blankpopularitya fully realize destiny thea relnoopener hrefhttpsenwikipediaorgwikiesports target_blankesportait good news dont like outcome upcoming chess drama find watch dayp blockquote precommendedp pthe post relnofollow hrefhttpmarginalrevolutioncommarginalrevolution202111carlsenvsnepohtmlcarlsen vs nepoa appeared relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap |
619ebe2c52b2b940271f6243 | David Thewlis Q&A: “When would I like to live? Any time before all this nonsense began” | pdavid thewlis was born in blackpool in 1963 his breakout role was the main character johnny in mike leighs 1993 film emnakedem he is also known for playing remus lupin in the emharry potter emfilmsp
h4whats your earliest memoryh4
pwhen i was aged three or four and loitering in the alley behind my fathers toy shop pulling my invisible dog on a piece of parcel string and out of the corner of my eye spying my nose for the first timep
h4who are your heroesh4
pin love my wife hermine in art john lennon patti smith samuel beckett bob mortimer john cooper clarke in life and death doctors nurses dentists too begrudgingly but when ive screamed out for themp
h4what book last changed your thinkingh4
pemsumem by david eagleman forty tales of possible afterlives many of them are unthinkably grim but just one of his positive scenarios would be a real bonus at the end of all this if only it were truep
h4which political figure do you look up toh4
pi have enormous admiration for alexandria ocasiocortez like all politicians she stands to fall from grace but for now she seems to embody power sincerity and hope for her generationp
h4in which time and place other than your own would you like to liveh4
pany time before all this nonsense began i dont know what year that was just before we started planting things and had to find all our grub in the bushes although i have sensitive feet and wouldnt mind some sort of footwear so precisely what year would that bep
h4what would be your emmastermind emspecialist subjecth4
pthe life and music of the beatles or emseinfeldem episodesp
h4what tv show could you not live withouth4
pi watch very little tv these days and prefer life that way though i would really miss emwould i lie to youem especially the bob mortimer episodesp
h4who would paint your portraith4
pstuart pearson wright he has already done it he had me running naked through soho and put my head atop his body being 12 years younger than me i didnt object p
h4whats your theme tuneh4
pwith my little stick of blackpool rock by george formby p
h4whats the best piece of advice youve ever receivedh4
pto drop gce chemistry and take cse drama my chemistry teacher caught me in the corridor twisted my ear and said it was the worst decision i would ever make i hope hes been watching these past 40 years p
h4whats currently bugging youh4
pim writing this sat in a hammock in provence so well bugs whats wrong with them why cant they be nicep
h4what single thing would make your life betterh4
pa languagelearning pillp
h4when were you happiesth4
pi was never happier than right now apart from these bloody bugs ive been bitten three times since i first mentioned themp
h4in another life what job might you have chosenh4
pto be a painter would be my ideal i try to act how i feel and i write play music direct and take photographs but im sure i could express it best of all with a paintbrush if i was any good but im notp
h4are we all doomedh4
pit depends what you mean by we and all and doomed but yes maybe not these bugsp
pemshooting martha by david thewlis is published by weidenfeld amp nicolsonemp
pstrongem[see also a hrefhttpswwwnewstatesmancomuncategorized202111carolinelucasqaevenifyoureinaminorityofonethetruthisstillthetruthcaroline lucas qampa even if youre in a minority of one the truth is still the trutha]emstrongp | pdavid thewlis born blackpool 1963 breakout role main character johnny mike leighs 1993 film emnakedem known playing remus lupin emharry potter emfilmsp h4whats earliest memoryh4 pwhen aged loitering alley fathers toy shop pulling invisible dog piece parcel string corner eye spying nose timep h4who heroesh4 pin love wife hermine art john lennon patti smith samuel beckett bob mortimer john cooper clarke life death doctors nurses dentists begrudgingly ive screamed themp h4what book changed thinkingh4 pemsumem david eagleman tales possible afterlives unthinkably grim positive scenarios real bonus end truep h4which political figure look toh4 pi enormous admiration alexandria ocasiocortez like politicians stands fall grace embody power sincerity hope generationp h4in time place like liveh4 pany time nonsense began dont know year started planting things find grub bushes sensitive feet wouldnt mind sort footwear precisely year bep h4what emmastermind emspecialist subjecth4 pthe life music beatles oremseinfeldem episodesp h4what tv live withouth4 pi watch little tv days prefer life way miss emwould lie youem especially bob mortimer episodesp h4who paint portraith4 pstuart pearson wright running naked soho head atop body 12 years younger didnt objectp h4whats theme tuneh4 pwith little stick blackpool rock george formbyp h4whats best piece advice youveever receivedh4 pto drop gce chemistry cse drama chemistry teacher caught corridor twisted ear said worst decision makei hope hes watching past40 yearsp h4whats currently bugging youh4 pim writing sat hammock provence bugs whats wrong cant nicep h4what single thing life betterh4 pa languagelearning pillp h4when happiesth4 pi happier right apart bloody bugs ive bitten times mentioned themp h4in life job chosenh4 pto painter ideal try act feel write play music direct photographs im sure express best paintbrush good im notp h4are doomedh4 pit depends mean doomed yes maybe bugsp pemshooting martha david thewlisis published weidenfeld amp nicolsonemp pstrongem[see hrefhttpswwwnewstatesmancomuncategorized202111carolinelucasqaevenifyoureinaminorityofonethetruthisstillthetruthcaroline lucas qampa youre minority truth trutha]emstrongp |
619ebe5e52b2b940271f6247 | Do Things Have to Be This Way? | figureimg srchttpswwwsapiensorgwpcontentuploads20211105_peopleinadoublestar1000x588jpeg width1076 alta group of people lie on an orange and brown floor making a double star shape with their bodies height588figcaptionsmalli
span[nocaption]span
smallhenrik sorensengetty images
small
ismallfigcaptionfigureblockquotepspanespanxcerpted from a hrefhttpsusmacmillancombooks9780374157357emthe dawn of everything a new history of humanityemaem em 2021 by david graeber and david wengrow reprinted with permission from farrar straus and girouxpblockquote
pspanmspanost of human history is irreparably lost to us our species emhomo sapiensem has existed for at least 200000 years but for most of that time we have next to no idea what was happening in northern spain for instance at the cave of altamira paintings and engravings were created over a period of at least 10000 years between around 25000 and 15000 bc presumably a lot of dramatic events occurred during this period we have no way of knowing what most of them werep
pspantspanhis is of little consequence to most people since most people rarely think about the broad sweep of human history anyway they dont have much reason to insofar as the question comes up at all its usually when reflecting on why the world seems to be in such a mess and why human beings so often treat one another badlythe reasons for war greed exploitation systematic indifference to others suffering were we always like that or did something at some point go terribly wrongp
pspanispant is basically a theological debate essentially the question is are humans innately good or innately evil but if you think about it the question framed in these terms makes very little sense good and evil are purely human concepts it would never occur to anyone to argue about whether a fish or a tree was good or evil because good and evil are concepts humans made up in order to compare ourselves with one anotherp
pspannspanonetheless on those occasions when people do reflect on the lessons of ancient history they almost invariably come back to questions of this kind we are all familiar with the christian answer people once lived in a state of innocence yet were tainted by original sin we desired to be godlike and have been punished for it now we live in a fallen state while hoping for future redemptionp
pspantspanoday the popular version of this story is typically some updated variation on jeanjacques rousseaus a hrefhttpswwwgutenbergorgebooks11136ema discourse upon the origin and the foundation of the inequality among mankindema which he wrote in 1754 once upon a time the story goes we were huntergatherers living in a prolonged state of childlike innocence in tiny bands these bands were egalitarian they could be for the very reason that they were so small it was only after the agricultural revolution and then still more the rise of cities that this happy condition came to an end ushering in civilization and the statewhich also meant the appearance of written literature science and philosophy but at the same time almost everything bad in human life patriarchy standing armies mass executions and annoying bureaucrats demanding that we spend much of our lives filling in formsp
pfigure classwpcaptiona hrefhttpswwwsapiensorgwpcontentuploads20211102_dawnofeverythingbookjacketscaledjpgimg sizesmaxwidth 350px 100vw 350px srchttpswwwsapiensorgwpcontentuploads20211102_dawnofeverythingbookjacket683x1024jpg alta yellow book cover shows the title the dawn of everything a new history of humanity in red font width350 srcsethttpswwwsapiensorgwpcontentuploads20211102_dawnofeverythingbookjacket683x1024jpg 683w httpswwwsapiensorgwpcontentuploads20211102_dawnofeverythingbookjacket200x300jpg 200w httpswwwsapiensorgwpcontentuploads20211102_dawnofeverythingbookjacket768x1152jpg 768w httpswwwsapiensorgwpcontentuploads20211102_dawnofeverythingbookjacket1024x1536jpg 1024w httpswwwsapiensorgwpcontentuploads20211102_dawnofeverythingbookjacket1366x2048jpg 1366w httpswwwsapiensorgwpcontentuploads20211102_dawnofeverythingbookjacketscaledjpg 1707w classwpimage20493 height525afigcaptionsmalli
pspanspan smallfarrar straus and giroux
smallpismallfigcaption
figurepspanospanf course this is a very crude simplification but it really does seem to be the foundational story that rises to the surface whenever anyone from industrial psychologists to revolutionary theorists says something like but of course human beings spent most of their evolutionary history living in groups of 10 or 20 people or agriculture was perhaps humanitys worst mistake many popular writers todayincluding jared diamond francis fukuyama and yuval noah hararimake the argument quite explicitly the problem is that anyone seeking an alternative to this rather depressing view of history will quickly find that the only one on offer is actually even worse if not rousseau then thomas hobbesp
pspanhspanobbess a hrefhttpswwwgutenbergorgebooks3207emleviathanema published in 1651 is in many ways the founding text of modern political theory it held that humans being the selfish creatures they are life in an original state of nature was in no sense innocent it must instead have been solitary poor nasty brutish and short basically a state of war with everybody fighting against everybody else insofar as there has been any progress from this benighted state of affairs a hobbesian would argue it has been largely due to exactly those repressive mechanisms that rousseau was complaining about governments courts bureaucracies police this view of things has been around for a very long timep
pspanhspanuman society in this view is founded on the collective repression of our baser instincts which becomes all the more necessary when humans are living in large numbers in the same place the modernday hobbesian then would argue that yes we did live most of our evolutionary history in tiny bands who could get along mainly because they shared a common interest in the survival of their offspring parental investment as evolutionary biologists call it but even these were in no sense founded on equality there was always in this version some alphamale leader hierarchy and domination and cynical selfinterest have always been the basis of human society its just that collectively we have learned its to our advantage to prioritize our longterm interests over our shortterm instincts or better to create laws that force us to confine our worst impulses to socially useful areas like the economy while forbidding them everywhere elsep
pspanaspans the reader can probably detect from our tone we dont much like the choice between these two alternatives our objections can be classified into three broad categories as accounts of the general course of human history theyp
pspanspan1 simply arent truep
pspanspan2 have dire political implications andp
pspanspan3 make the past needlessly dullp
pemthe dawn of everythingem is an attempt to begin to tell another more hopeful and more interesting story one which at the same time takes better account of what the last few decades of research have taught us partly this is a matter of bringing together evidence that has accumulated in archaeology anthropology and kindred disciplines evidence that points toward a completely new account of how human societies developed over roughly the last 30000 years almost all of this research goes against the familiar narrative but too often the most remarkable discoveries remain confined to the work of specialists or have to be teased out by reading between the lines of scientific publicationsp
pspantspano give just a sense of how different the emerging picture is it is clear now that human societies before the advent of farming were not confined to small egalitarian bands on the contrary the world of huntergatherers as it existed before the coming of agriculture was one of bold social experiments resembling a carnival parade of political forms far more than it does the drab abstractions of evolutionary theory agriculture in turn did not mean the inception of private property nor did it mark an irreversible step toward inequality in fact many of the first farming communities were relatively free of ranks and hierarchies and far from setting class differences in stone a surprising number of the worlds earliest cities were organized on robustly egalitarian lines with no need for authoritarian rulers ambitious warriorpoliticians or even bossy administratorsp
pfigure classwpcaptiona hrefhttpswwwsapiensorgwpcontentuploads20211103_peopleonabenchjpegimg sizesmaxwidth 1000px 100vw 1000px srchttpswwwsapiensorgwpcontentuploads20211103_peopleonabenchjpeg alta group of people in colorful clothing are configured in different positions on an orange bench against an orange wall width1000 srcsethttpswwwsapiensorgwpcontentuploads20211103_peopleonabenchjpeg 1000w httpswwwsapiensorgwpcontentuploads20211103_peopleonabench395x300jpeg 395w httpswwwsapiensorgwpcontentuploads20211103_peopleonabench768x583jpeg 768w classwpimage20498 height759afigcaptionsmalli
pspanspan smallhenrik sorensengetty images
smallpismallfigcaption
figurepspanispann short the prevalent big picture of human historyshared by modernday followers of hobbes and rousseau alikehas almost nothing to do with the facts but to begin making sense of the new information thats now before our eyes it is not enough to compile and sift vast quantities of data a conceptual shift is also requiredp
pspantspano make that shift means retracing some of the initial steps that led to our modern notion of social evolution the idea that human societies could be arranged according to stages of development each with their own characteristic technologies and forms of organization huntergatherers farmers urbanindustrial society and so on such notions have their roots in a conservative backlash against critiques of european civilization which began to gain ground in the early decades of the 18th centuryp
pspantspanhe origins of that critique however lie not with the philosophers of the enlightenment much though they initially admired and imitated it but with a hrefhttpswwwlaphamsquarterlyorgdemocracyhidingplainsightindigenous commentators and observers of european societya such as the native american huronwendat statesman kandiaronk revisiting what we will call the indigenous critique means taking seriously contributions to social thought that come from outside the european canon and in particular from those indigenous peoples who western philosophers tend to cast either in the role of historys angels or its devilsp
pspansspanince the financial crash of 2008 and the upheavals that followed the question of inequality and with it the longterm history of inequalityhave become major topics for debate something of a consensus has emerged among intellectuals and even to some degree the political classes that levels of social inequality have got out of hand and that most of the worlds problems result in one way or another from an everwidening gulf between the haves and the havenots pointing this out is in itself a challenge to global power structures at the same time though it frames the issue in a way that people who benefit from those structures can still find ultimately reassuring since it implies no meaningful solution to the problem would ever be possiblep
pspandspanebating inequality allows one to tinker with the numbers argue about a hrefhttpsdataoecdorginequalityincomeinequalityhtmgini coefficientsa and thresholds of dysfunction readjust tax regimes or social welfare mechanisms even shock the public with figures showing just how bad things have become can you imagine the richest 1 percent of the worlds population own 44 percent of the worlds wealthbut it also allows one to do all this without addressing any of the factors that people actually object to about such unequal social arrangements for instance that some manage to turn their wealth into power over others or that other people end up being told their needs are not important and their lives have no intrinsic worth the last we are supposed to believe is just the inevitable effect of inequality and inequality the inevitable result of living in any large complex urban technologically sophisticated society presumably it will always be with us its just a matter of degreep
pqwhat ultimately matters is whether we can rediscover the freedoms that make us human in the first placeqp
pspantspanoday there is a veritable boom of thinking about inequality since 2011 global inequality has regularly featured as a top item for debate in the world economic forum at davos there are inequality indexes institutes for the study of inequality and a relentless stream of publications trying to project the current obsession with property distribution back into the stone age there have even been attempts to calculate income levels and gini coefficients for paleolithic mammoth hunters they both turn out to be a hrefhttpswwwnytimescom20150710opiniontoeachageitsinequalityhtmlvery lowa its almost as if we feel some need to come up with mathematical formulae justifying the expression already popular in the days of rousseau that in such societies everyone was equal because they were all equally poorp
pspantspanhe ultimate effect of all these stories about an original state of innocence and equality is to make wistful pessimism about the human condition seem like common sense the natural result of viewing ourselves through historys broad lens yes living in a truly egalitarian society might be possible if youre a pygmy or a kalahari bushman but if you want to create a society of true equality today youre going to have to figure out a way to go back to becoming tiny bands of foragers again with no significant personal property since foragers require a pretty extensive territory to forage in this would mean having to reduce the worlds population by something like 999 percentp
pspanospantherwise the best we can hope for is to adjust the size of the boot that will forever be stomping on our faces or perhaps to wangle a bit more wiggle room in which some of us can temporarily duck out of its wayp
pspanaspan first step toward a more accurate and hopeful picture of world history might be to abandon the garden of eden once and for all and simply do away with the notion that for hundreds of thousands of years everyone on earth shared the same idyllic form of social organization strangely enough though this is often seen as a reactionary move so are you saying true equality has never been achieved that its therefore impossible it seems to us that such objections are both counterproductive and frankly unrealisticp
pspanfspanirst of all its bizarre to imagine that say during the roughly 10000 some would say more like 20000 years in which people painted on the walls of altamira no onenot only in altamira but anywhere on earthexperimented with alternative forms of social organization whats the chance of thatp
pfigure classwpcaptiona hrefhttpswwwsapiensorgwpcontentuploads20211101_opticalillusionjpegimg sizesmaxwidth 1065px 100vw 1065px srchttpswwwsapiensorgwpcontentuploads20211101_opticalillusion1065x799jpeg alttwo rows of people wearing colorful clothing lean against dark orange and light orange surfaces width1065 srcsethttpswwwsapiensorgwpcontentuploads20211101_opticalillusion1065x799jpeg 1065w httpswwwsapiensorgwpcontentuploads20211101_opticalillusion400x300jpeg 400w httpswwwsapiensorgwpcontentuploads20211101_opticalillusion768x576jpeg 768w httpswwwsapiensorgwpcontentuploads20211101_opticalillusionjpeg 1500w classwpimage20488 height799afigcaptionsmalli
pspanspan smallhenrik sorensengetty images
smallpismallfigcaption
figurepspansspanecond of all is not the capacity to experiment with different forms of social organization itself a quintessential part of what makes us human that is beings with the capacity for selfcreation even freedom the ultimate question of human history is not our equal access to material resources land calories means of production much though these things are obviously important but our equal capacity to contribute to decisions about how to live together of course to exercise that capacity implies that there should be something meaningful to decide in the first placep
pspanispanf as many are suggesting our species future now hinges on our capacity to create something different say a system in which wealth cannot be freely transformed into power or where some people are not told their needs are unimportant or that their lives have no intrinsic worth then what ultimately matters is whether we can rediscover the freedoms that make us human in the first placep
pspanwspanhat if we treat people from the beginning as imaginative intelligent playful creatures who deserve to be understood as such what if instead of telling a story about how our species fell from some idyllic state of equality we ask how we came to be trapped in such tight conceptual shackles that we can no longer even imagine the possibility of reinventing ourselvesp
pemthis excerpt has been edited slightly for length style and clarityemp
pthe post a relnofollow hrefhttpswwwsapiensorgculturedawnofeverythingexcerptdo things have to be this waya appeared first on a relnofollow hrefhttpswwwsapiensorgsapiensap | figureimg srchttpswwwsapiensorgwpcontentuploads20211105_peopleinadoublestar1000x588jpeg width1076 alta group people lie orange brown floor making double star shape bodies height588figcaptionsmalli span[nocaption]span smallhenrik sorensengetty images small ismallfigcaptionfigureblockquotepspanespanxcerpted hrefhttpsusmacmillancombooks9780374157357emthe dawn new history humanityemaem em 2021 david graeber david wengrow reprinted permission farrar straus girouxpblockquote pspanmspanost human history irreparably lost speciesemhomo sapiensem existed 200000 years time idea happening northern spain instance cave altamira paintings engravings created period 10000 years 25000 15000 bc presumably lot dramatic events occurred period way knowing werep pspantspanhis little consequence people people rarely think broad sweep human history dont reason insofar question comes usually reflecting world mess human beings treat badlythe reasons war greed exploitation systematic indifference suffering like point terribly wrongp pspanispant basically theological debate essentially question humans innately good innately evil think question framed terms makes little sense good evil purely human concepts occur argue fish tree good evil good evil concepts humans order compare anotherp pspannspanonetheless occasions people reflect lessons ancient history invariably come questions kind familiar christian answer people lived state innocence tainted original sin desired godlike punished live fallen state hoping future redemptionp pspantspanoday popular version story typically updated variation jeanjacques rousseausa hrefhttpswwwgutenbergorgebooks11136ema discourse origin foundation inequality mankindema wrote 1754 time story goes huntergatherers living prolonged state childlike innocence tiny bands bands egalitarian reason small agricultural revolution rise cities happy condition came end ushering civilization statewhich meant appearance written literature science philosophy time bad human life patriarchy standing armies mass executions annoying bureaucrats demanding spend lives filling formsp pfigure classwpcaptiona hrefhttpswwwsapiensorgwpcontentuploads20211102_dawnofeverythingbookjacketscaledjpgimg sizesmaxwidth 350px 100vw 350px srchttpswwwsapiensorgwpcontentuploads20211102_dawnofeverythingbookjacket683x1024jpg alta yellow book cover shows title dawn new history humanity red font width350 srcsethttpswwwsapiensorgwpcontentuploads20211102_dawnofeverythingbookjacket683x1024jpg 683w httpswwwsapiensorgwpcontentuploads20211102_dawnofeverythingbookjacket200x300jpg 200w httpswwwsapiensorgwpcontentuploads20211102_dawnofeverythingbookjacket768x1152jpg 768w httpswwwsapiensorgwpcontentuploads20211102_dawnofeverythingbookjacket1024x1536jpg 1024w httpswwwsapiensorgwpcontentuploads20211102_dawnofeverythingbookjacket1366x2048jpg 1366w httpswwwsapiensorgwpcontentuploads20211102_dawnofeverythingbookjacketscaledjpg 1707w classwpimage20493 height525afigcaptionsmalli pspanspan smallfarrar straus giroux smallpismallfigcaption figurepspanospanf course crude simplification foundational story rises surface industrial psychologists revolutionary theorists says like course human beings spent evolutionary history living groups 10 20 people agriculture humanitys worst mistake popular writers todayincluding jared diamond francis fukuyama yuval noah hararimake argument explicitly problem seeking alternative depressing view history quickly find offer actually worse rousseau thomas hobbesp pspanhspanobbessa hrefhttpswwwgutenbergorgebooks3207emleviathanema published 1651 ways founding text modern political theory held humans selfish creatures life original state nature sense innocent instead solitary poor nasty brutish short basically state war everybody fighting everybody insofar progress benighted state affairs hobbesian argue largely exactly repressive mechanisms rousseau complaining governments courts bureaucracies police view things long timep pspanhspanuman society view founded collective repression baser instincts necessary humans living large numbers place modernday hobbesian argue yes live evolutionary history tiny bands mainly shared common interest survival offspring parental investment evolutionary biologists sense founded equality version alphamale leader hierarchy domination cynical selfinterest basis human society collectively learned advantage prioritize longterm interests shortterm instincts better create laws force confine worst impulses socially useful areas like economy forbidding elsep pspanaspans reader probably detect tone dont like choice alternatives objections classified broad categories accounts general course human history theyp pspanspan1 simply arent truep pspanspan2 dire political implications andp pspanspan3 past needlessly dullp pemthe dawn everythingem attempt begin tell hopeful interesting story time takes better account decades research taught partly matter bringing evidence accumulated archaeology anthropology kindred disciplines evidence points completely new account human societies developed roughly 30000 years research goes familiar narrative remarkable discoveries remain confined work specialists teased reading lines scientific publicationsp pspantspano sense different emerging picture clear human societies advent farming confined small egalitarian bands contrary world huntergatherers existed coming agriculture bold social experiments resembling carnival parade political forms far drab abstractions evolutionary theory agriculture turn mean inception private property mark irreversible step inequality fact farming communities relatively free ranks hierarchies far setting class differences stone surprising number worlds earliest cities organized robustly egalitarian lines need authoritarian rulers ambitious warriorpoliticians bossy administratorsp pfigure classwpcaptiona hrefhttpswwwsapiensorgwpcontentuploads20211103_peopleonabenchjpegimg sizesmaxwidth 1000px 100vw 1000px srchttpswwwsapiensorgwpcontentuploads20211103_peopleonabenchjpeg alta group people colorful clothing configured different positions orange bench orange wall width1000 srcsethttpswwwsapiensorgwpcontentuploads20211103_peopleonabenchjpeg 1000w httpswwwsapiensorgwpcontentuploads20211103_peopleonabench395x300jpeg 395w httpswwwsapiensorgwpcontentuploads20211103_peopleonabench768x583jpeg 768w classwpimage20498 height759afigcaptionsmalli pspanspan smallhenrik sorensengetty images smallpismallfigcaption figurepspanispann short prevalent big picture human historyshared modernday followers hobbes rousseau alikehas facts begin making sense new information thats eyes compile sift vast quantities data conceptual shift requiredp pspantspano shift means retracing initial steps led modern notion social evolution idea human societies arranged according stages development characteristic technologies forms organization huntergatherers farmers urbanindustrial society notions roots conservative backlash critiques european civilization began gain ground early decades 18th centuryp pspantspanhe origins critique lie philosophers enlightenment initially admired imitated hrefhttpswwwlaphamsquarterlyorgdemocracyhidingplainsightindigenous commentators observers european societya native american huronwendat statesman kandiaronk revisiting indigenous critique means taking seriously contributions social thought come outside european canon particular indigenous peoples western philosophers tend cast role historys angels devilsp pspansspanince financial crash 2008 upheavals followed question inequality longterm history inequalityhave major topics debate consensus emerged intellectuals degree political classes levels social inequality got hand worlds problems result way everwidening gulf haves havenots pointing challenge global power structures time frames issue way people benefit structures find ultimately reassuring implies meaningful solution problem possiblep pspandspanebating inequality allows tinker numbers argue hrefhttpsdataoecdorginequalityincomeinequalityhtmgini coefficientsa thresholds dysfunction readjust tax regimes social welfare mechanisms shock public figures showing bad things imagine richest 1 percent worlds population 44 percent worlds wealthbut allows addressing factors people actually object unequal social arrangements instance manage turn wealth power people end told needs important lives intrinsic worth supposed believe inevitable effect inequality inequality inevitable result living large complex urban technologically sophisticated society presumably matter degreep pqwhat ultimately matters rediscover freedoms human placeqp pspantspanoday veritable boom thinking inequality 2011 global inequality regularly featured item debate world economic forum davos inequality indexes institutes study inequality relentless stream publications trying project current obsession property distribution stone age attempts calculate income levels gini coefficients paleolithic mammoth hunters turn hrefhttpswwwnytimescom20150710opiniontoeachageitsinequalityhtmlvery lowa feel need come mathematical formulae justifying expression popular days rousseau societies equal equally poorp pspantspanhe ultimate effect stories original state innocence equality wistful pessimism human condition like common sense natural result viewing historys broad lens yes living truly egalitarian society possible youre pygmy kalahari bushman want create society true equality today youre going figure way tiny bands foragers significant personal property foragers require pretty extensive territory forage mean having reduce worlds population like 999 percentp pspanospantherwise best hope adjust size boot forever stomping faces wangle bit wiggle room temporarily duck wayp pspanaspan step accurate hopeful picture world history abandon garden eden simply away notion hundreds thousands years earth shared idyllic form social organization strangely seen reactionary saying true equality achieved impossible objections counterproductive frankly unrealisticp pspanfspanirst bizarre imagine roughly 10000 like 20000 years people painted walls altamira onenot altamira earthexperimented alternative forms social organization whats chance thatp pfigure classwpcaptiona hrefhttpswwwsapiensorgwpcontentuploads20211101_opticalillusionjpegimg sizesmaxwidth 1065px 100vw 1065px srchttpswwwsapiensorgwpcontentuploads20211101_opticalillusion1065x799jpeg alttwo rows people wearing colorful clothing lean dark orange light orange surfaces width1065 srcsethttpswwwsapiensorgwpcontentuploads20211101_opticalillusion1065x799jpeg 1065w httpswwwsapiensorgwpcontentuploads20211101_opticalillusion400x300jpeg 400w httpswwwsapiensorgwpcontentuploads20211101_opticalillusion768x576jpeg 768w httpswwwsapiensorgwpcontentuploads20211101_opticalillusionjpeg 1500w classwpimage20488 height799afigcaptionsmalli pspanspan smallhenrik sorensengetty images smallpismallfigcaption figurepspansspanecond capacity experiment different forms social organization quintessential makes human beings capacity selfcreation freedom ultimate question human history equal access material resources land calories means production things obviously important equal capacity contribute decisions live course exercise capacity implies meaningful decide placep pspanispanf suggesting species future hinges capacity create different system wealth freely transformed power people told needs unimportant lives intrinsic worth ultimately matters rediscover freedoms human placep pspanwspanhat treat people beginning imaginative intelligent playful creatures deserve understood instead telling story species fell idyllic state equality ask came trapped tight conceptual shackles longer imagine possibility reinventing ourselvesp pemthis excerpt edited slightly length style clarityemp pthe post relnofollow hrefhttpswwwsapiensorgculturedawnofeverythingexcerptdo things thiswaya appeared relnofollow hrefhttpswwwsapiensorgsapiensap |
619ebe8352b2b940271f624b | CDC Director Rochelle Walensky Lauded the Success of China's 'Really Strict' Lockdowns | div
picture
source sizesminwidth 600px 331px 100vw typeimagewebp srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202111zumaamericasthirtytwo8037252400x1350jpgwebp 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202111zumaamericasthirtytwo8037251200x675jpgwebp 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202111zumaamericasthirtytwo803725800x450jpgwebp 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202111zumaamericasthirtytwo803725600x338jpgwebp 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202111zumaamericasthirtytwo803725331x186jpgwebp 331w
source sizesminwidth 600px 331px 100vw typeimagejpeg srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202111zumaamericasthirtytwo8037252400x1350jpg 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202111zumaamericasthirtytwo8037251200x675jpg 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202111zumaamericasthirtytwo803725800x450jpg 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202111zumaamericasthirtytwo803725600x338jpg 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202111zumaamericasthirtytwo803725331x186jpg 331w
img width1200 altzumaamericasthirtytwo803725 srchttpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202111zumaamericasthirtytwo803725800x450jpg height675
picture
div
pa little over a year ago rochelle walenskythen a professor of medicine at harvard medical school now the director of the centers for disease control and prevention cdcgave an interview to wbur in which she noted the purported successes of lockdown policies in authoritarian countriesp
pquotto give you a sense of what lockdowns were able to do in other countriesand i mean really strict lockdownsin china their death rate is three per millionquot she a hrefhttpstwittercommichaelpsengerstatus1462882966053392392saida lamenting that the death rates in comparatively lax sweden and the us were much higherp
pwhether chinas quotreally strictquot lockdowns can truly be deemed a success largely depends on whether that governments reported covid19 cases and death totalsa hrefhttpswwwfoxnewscomworldchinascoronaviruscasesisthecommunistregimelyingtotheworld are accurateaan important question given how much the chinese communist party a hrefhttpstwittercomjerometenkstatus1242078996067688451has already lieda about the pandemicand whether it will ever be possible to relax them more than a year after walensky sounded an admiring note chinas pandemic authoritarianism is still in fullswing despite sporadic shutdowns of entire cities the country has not completely stamped out of the coronavirus dozens of new cases are reported everyday and again a hrefhttpswwwnytimescom20211112worldasiachinazerocovidhtmlits difficult to saya if those numbers represent undercounts at every stage of the pandemic chinese government officials have a hrefhttpswwwcnncom20200412asiachinacoronavirusresearchrestrictionsintlhnkindexhtmlmisleda their own citizens and indeed the rest of the planet a hrefhttpswwwaxioscomtwitterfactcheckschineseofficial27762aac153b4b77ad6375826fe04eb3htmlabout the virusap
pbut even if china does have covid19 under control harsh pandemic mitigation measures exact a steep price in return one chinese town bordering myanmar was a hrefhttpswwwnprorgsectionsgoatsandsoda202111051052811962onechinesetownhasstartedafieryonlinedebateaboutchinaszerocovidpolicrecently locked downa by the government and what followed was brutally repressivep
blockquotepresidents left starving inside makeshift quarantine centers fashioned out of shipping containers businesses forbidden from selling goods even online a baby reportedly a hrefhttpmthepapercnrss_newsdetail_15147916fromsinatesteda for covid 74 timesp
pearlier this year his wife went to work one morning only to be forced to find somewhere else to stay for a 45day quarantine after the city district was sealed off because of a handful of cases discovered nearby she was rounded up and told to shelter in place with no date of release and no regular supply of food wang says he was finally able to get her out by asking a wellconnected friend to bring her to a hospital on medical grounds after which she did another two week hotel quarantine before being allowed to return homep
pyet despite the anger in ruili most people in china support the countrys strict pandemic prevention policies despite their a hrefhttpswwwnprorgsectionsgoatsandsoda202109021033396323chinaisimposingstrictlockdownstocontainnewcovidoutbreaksbuttheresachuge economic costa and the risk of being suddenly quarantined or tested a hrefhttpswwwnprorg202111011051146829shanghaidisneylandcovid19shutdownduring frequent contacttracing investigationsa local governments are under enormous pressure to ensure no infections crop up officials who fail are often publicly shamed and firedp
ppeople unlucky enough to test positive or more commonly cross paths with a close contact can find themselves ensnared in successive and expensive quarantines others have found themselves stuck in limbo unable to leave cities under lockdown including ruili and also banned from returning to their hometownspblockquote
pas emreasonems eric boehm noted china is hardly an exception in this regard the quest for covid zero has steered many countries down the path of illiberalism and oppression quotmore than a relnoopener hrefhttpswwwideaintgsodindicesprofilecovid19world target_blank20 percent of countriesa have used their militaries to enforce covid controlsquot a hrefhttpsreasoncom20211123covid19madedemocraciesmoreauthoritarianandauthoritarianismevenworsewrotea boehm citing a new report from the international institute for democracy and electoral assistance quotaccording to the report a relnoopener hrefhttpswwwideaintgsodindicesprofilecovid19world target_blank69 countriesa have made violating covid restrictions an imprisonable offense with twothirds of those countries being ones the group considers to be democracies albania and mexico have the most punitive laws on the books allowing prison sentences of 15 years and 12 years respectively for violating pandemicrelated protocolsquotp
pwhen health officials like walensky fantasize about what they could do if the us government was just a bit less constrained by civil liberties protections and human rights law it is these repressive regimes that they seek to emulatep
pbut tellingly this kind fantasizing only ever seems to run in one directiontoward bigger and more powerful government heres a question does walensky ever fantasize about how the us coronavirus response have been improved by a government that was smaller and more constrained because theres a good argument to be made that emless emauthoritarianism and central control would mean fewer americans dying of covid19p
pnothing illustrates this point better than the federal drug administrations a hrefhttpswwwpfizercomnewspressreleasepressreleasedetailpfizersnovelcovid19oralantiviraltreatmentcandidatefailure to immediately approve paxlovida pfizers pillform covid19 therapeutic which may reduce the risk of death by a whopping 89 percent substack writer scott alexander a hrefhttpsastralcodextensubstackcompwhenwillthefdaapprovepaxlovidutm_mediumemailutm_campaignctanotesa that prediction markets believe the fda will approve the drug somewhere between january and march for the fda this is remarkably fastbut it still means that thousands of people will die needlessly between now and the date that the drug is approved if the fda would get out of the way people could take the drug much sooner and lives would be savedp
pquotits pretty weird that the fda agrees paxlovid is so great that its unethical to study it further because it would be unconscionable to design a study with a nopaxlovid control groupbut also the fda has not approved paxlovid it remains illegal and nobody is allowed to use itquot wrote alexander quotone would hope this is because the fda plans to approve paxlovid immediately but the prediction market expects it to take six weeks during which time we expect about 50000 more americans to die of covidquotp
pthese delays are costly but hardly surprising after all the fda has repeatedly failed to approve covid19 tests that would doubtlessly save lives if the government would make it legal for americans to purchase themp
pquotcompanies trying to get the food and drug administrations approval for rapid covid19 tests describe an arbitrary opaque process that meanders on sometimes long after their products have been approved in other countries that prioritize accessibility and affordability over perfect accuracyquot a hrefhttpswwwpropublicaorgarticlehereswhyrapidcovidtestsaresoexpensiveandhardtofindwrotea lydia depillis and eric umansky in empropublicaemp
pit gets worsep
blockquote
p datappblocktypecopy datappid510the fda reviewer who quit this may described what the delays looked like from the inside with a background in virology he could evaluate the hundreds of pages in an application within a few days but then something strange happened the applications would go nowhere for months as higherup officials seemed paralyzed by indecisionp
p datappblocktypecopy datappid520quoti could easily process dozens of them but i ended up with one or two in my queue constantly they would stay there foreverquot he said quoti had a lot of free timequotp
p datappblocktypecopy datappid530his experience is reflected in an a hrefhttpswwwfdagovmedia152992downloadoutside reviewa of the eua process conducted by the consulting firm booz allen hamilton which found that the median number of days it took the fda to issue a decision on original applications rose to 99 in november 2020 from 29 the previous april with denials taking substantially longer than authorizations the assessment also found quotlimited understanding in the test developer community on how to appropriately validate a diagnostic testquotp
blockquote
p datappblocktypecopy datappid530instead of waxing philosophical about what might have been possible if the us government were less constrained it would be nice if federal health bureaucrats conceded that the most ideal pieinthesky scenario is one in which their authority was emmore emlimited rather than less if walensky and her ilk care about saving lives they should daydream about smaller government not stricter lockdownsp
pthe post a relnofollow hrefhttpsreasoncomp8140258cdc director rochelle walensky lauded the success of chinas really strict lockdownsa appeared first on a relnofollow hrefhttpsreasoncomreasoncomap | div picture source sizesminwidth 600px 331px 100vw typeimagewebp srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202111zumaamericasthirtytwo8037252400x1350jpgwebp 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202111zumaamericasthirtytwo8037251200x675jpgwebp 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202111zumaamericasthirtytwo803725800x450jpgwebp 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202111zumaamericasthirtytwo803725600x338jpgwebp 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202111zumaamericasthirtytwo803725331x186jpgwebp 331w source sizesminwidth 600px 331px 100vw typeimagejpeg srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202111zumaamericasthirtytwo8037252400x1350jpg 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202111zumaamericasthirtytwo8037251200x675jpg 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202111zumaamericasthirtytwo803725800x450jpg 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202111zumaamericasthirtytwo803725600x338jpg 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202111zumaamericasthirtytwo803725331x186jpg 331w img width1200 altzumaamericasthirtytwo803725 srchttpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202111zumaamericasthirtytwo803725800x450jpg height675 picture div pa little year ago rochelle walenskythen professor medicine harvard medical school director centers disease control prevention cdcgave interview wbur noted purported successes lockdown policies authoritarian countriesp pquotto sense lockdowns able countriesand mean strict lockdownsin china death rate millionquot hrefhttpstwittercommichaelpsengerstatus1462882966053392392saida lamenting death rates comparatively lax sweden higherp pwhether chinas quotreally strictquot lockdowns truly deemed success largely depends governments reported covid19 cases death totalsa hrefhttpswwwfoxnewscomworldchinascoronaviruscasesisthecommunistregimelyingtotheworld accurateaan important question given chinese communist party hrefhttpstwittercomjerometenkstatus1242078996067688451has lieda pandemicand possible relax year walensky sounded admiring note chinas pandemic authoritarianism fullswing despite sporadic shutdowns entire cities country completely stamped coronavirus dozens new cases reported everyday hrefhttpswwwnytimescom20211112worldasiachinazerocovidhtmlits difficult saya numbers represent undercounts stage pandemic chinese government officials hrefhttpswwwcnncom20200412asiachinacoronavirusresearchrestrictionsintlhnkindexhtmlmisleda citizens rest planet hrefhttpswwwaxioscomtwitterfactcheckschineseofficial27762aac153b4b77ad6375826fe04eb3htmlabout virusap pbut china covid19 control harsh pandemic mitigation measures exact steep price return chinese town bordering myanmar hrefhttpswwwnprorgsectionsgoatsandsoda202111051052811962onechinesetownhasstartedafieryonlinedebateaboutchinaszerocovidpolicrecently locked downa government followed brutally repressivep blockquotepresidents left starving inside makeshift quarantine centers fashioned shipping containers businesses forbidden selling goods online baby reportedlya hrefhttpmthepapercnrss_newsdetail_15147916fromsinatestedafor covid 74 timesp pearlier year wife went work morning forced find stay 45day quarantine city district sealed handful cases discovered nearby rounded told shelter place date release regular supply food wang says finally able asking wellconnected friend bring hospital medical grounds week hotel quarantine allowed return homep pyet despite anger ruili people china support countrys strict pandemic prevention policies despite theira hrefhttpswwwnprorgsectionsgoatsandsoda202109021033396323chinaisimposingstrictlockdownstocontainnewcovidoutbreaksbuttheresachuge economic costaand risk suddenly quarantined testeda hrefhttpswwwnprorg202111011051146829shanghaidisneylandcovid19shutdownduring frequent contacttracing investigationsa local governments enormous pressure ensure infections crop officials fail publicly shamed firedp ppeople unlucky test positive commonly cross paths close contact find ensnared successive expensive quarantines found stuck limbo unable leave cities lockdown including ruili banned returning hometownspblockquote pasemreasonems eric boehm noted china hardly exception regard quest covid zero steered countries path illiberalism oppression quotmore thana relnoopener hrefhttpswwwideaintgsodindicesprofilecovid19world target_blank20 percent countriesa militaries enforce covid controlsquot hrefhttpsreasoncom20211123covid19madedemocraciesmoreauthoritarianandauthoritarianismevenworsewrotea boehm citing new report international institute democracy electoral assistance quotaccording reporta relnoopener hrefhttpswwwideaintgsodindicesprofilecovid19world target_blank69 countriesa violating covid restrictions imprisonable offense twothirds countries ones group considers democracies albania mexico punitive laws books allowing prison sentences 15 years 12 years respectively violating pandemicrelated protocolsquotp pwhen health officials like walensky fantasize government bit constrained civil liberties protections human rights law repressive regimes seek emulatep pbut tellingly kind fantasizing run directiontoward bigger powerful government heres question walensky fantasize coronavirus response improved government smaller constrained theres good argument emlessemauthoritarianism central control mean fewer americans dying covid19p pnothing illustrates point better federal drug administrations hrefhttpswwwpfizercomnewspressreleasepressreleasedetailpfizersnovelcovid19oralantiviraltreatmentcandidatefailure immediately approve paxlovida pfizers pillform covid19 therapeutic reduce risk death whopping 89 percent substack writer scott alexander hrefhttpsastralcodextensubstackcompwhenwillthefdaapprovepaxlovidutm_mediumemailutm_campaignctanotesa prediction markets believe fda approve drug january march fda remarkably fastbut means thousands people die needlessly date drug approved fda way people drug sooner lives savedp pquotits pretty weird fda agrees paxlovid great unethical study unconscionable design study nopaxlovid control groupbut fda approved paxlovid remains illegal allowed use itquot wrote alexander quotone hope fda plans approve paxlovid immediately prediction market expects weeks time expect 50000 americans die covidquotp pthese delays costly hardly surprising fda repeatedly failed approve covid19 tests doubtlessly save lives government legal americans purchase themp pquotcompanies trying food drug administrations approval rapid covid19 tests describe arbitrary opaque process meanders long products approved countries prioritize accessibility affordability perfect accuracyquot hrefhttpswwwpropublicaorgarticlehereswhyrapidcovidtestsaresoexpensiveandhardtofindwrotea lydia depillis eric umansky inempropublicaemp pit gets worsep blockquote p datappblocktypecopy datappid510the fda reviewer quit described delays looked like inside background virology evaluate hundreds pages application days strange happened applications months higherup officials paralyzed indecisionp p datappblocktypecopy datappid520quoti easily process dozens ended queue constantly stay foreverquot said quoti lot free timequotp p datappblocktypecopy datappid530his experience reflected ana hrefhttpswwwfdagovmedia152992downloadoutside reviewaof eua process conducted consulting firm booz allen hamilton found median number days took fda issue decision original applications rose 99 november 2020 29 previous april denials taking substantially longer authorizations assessment found quotlimited understanding test developer community appropriately validate diagnostic testquotp blockquote p datappblocktypecopy datappid530instead waxing philosophical possible government constrained nice federal health bureaucrats conceded ideal pieinthesky scenario authority wasemmoreemlimited walensky ilk care saving lives daydream smaller government stricter lockdownsp pthe post relnofollow hrefhttpsreasoncomp8140258cdc director rochelle walensky lauded success chinas strict lockdownsa appeared relnofollow hrefhttpsreasoncomreasoncomap |
619ebea252b2b940271f6255 | Black Friday’s carnival of consumerism feels increasingly untethered from reality | pover recent years various awareness days and months have increasingly appeared in our calendars for example november is simultaneously national diabetes month mens health awareness month and even national novel writing monthp
pbig business has managed to get in on the act and carve out its own awareness day black friday as it is officially known is the resulting orgy of consumption that now afflicts us in the final week of novemberp
pa cultural imposition from the united states the term black friday was first coined in 1869 after plummeting food prices caused the stock market to crash since then it has unfathomably morphed into an allout celebration of shopping a day on which stores offer highly promoted sales at heavily discounted prices in the us it is routinely the busiest shopping day of the year an a relnoreferrer noopener hrefhttpswwwfindercomblackfridaystatistics target_blankestimateda 724 million american adults plan to shop on black friday which falls on 26 november this yearp
pthose who intend to stay at home neednt feel left out black friday offers something for nonparticipantscombatants too videos of people trampling each other to get their hands on things they could never normally afford an unedifying and ghoulish spectacle have in recent years become a source of popular online entertainment with black friday brawl a relnoreferrer noopener hrefhttpswwwyoutubecomwatchvvpz97zblsck target_blankvideosa clocking up tens of thousands of views on youtubep
ppublic entertainment has often been derived from watching poor folk fight each other in this case for fridge freezers and widescreen televisions but you neednt engage in poorbaiting to recognise that black friday truly brings out the worst in people black friday falls on the day after thanksgiving in the us thus a mere 24 hours after being thankful for what they have frenzied consumers lay siege to retail stores and the unfortunate staff who work there who said americans dont understand ironyp
pthere is a human cost to all of this the black friday death count website a relnoreferrer noopener hrefhttpswwwgooglecomurlsatrctjqesrcssourcewebcdcadrjauact8ved2ahukewjq0tfnmk70ahx0gf0hhsg_ceiqfnoecaiqaqurlhttps3a2f2fblackfridaydeathcountcom2fusgaovvaw3_oewibhkgaqlzmdv1fks_ target_blankrecordsa the grim tally of americans killed and injured while out foraging for bargains 14 deaths and 117 injuries since 2010 the former includes walter vance a 61yearold pharmacist who a relnoreferrer noopener hrefhttpswwwhuffingtonpostcoukentryblackfridaytarget_n_1115372 target_blankcollapseda at a target store in west virginia in 2011 rather than coming to his aid frenzied shoppers stepped over vances incapacitated body as they searched for discounted goods he later died in hospitalp
pa few years before in 2008 a walmart worker was a relnoreferrer noopener hrefhttpswwwtheguardiancomworld2008nov29walmartblackfridayshoppersstampede target_blankkilleda when out of control shoppers smashed down the doors of one of the companys stores in long island new york according to police and witnesses store officials who rushed to the victims aid were also trampled and reportedly shouted at when they tried to close the store because of the deathp
pblack friday first arrived in the uk in 2010 announced initially by the online retailer amazon as a celebration of consumerism it didnt truly take off until 2013 when supermarket chain asda owned at the time by us retail giant walmart started promoting heavily discounted deals along with the emergence of the exploitative gig economy this formed part of a broader attempt by business to return capitalism to profitability in the aftermath of the global financial crash as governments in the west tightened their belts and announced solemnly that there was no money left citizens were urged to shop even harder as consumer spending powered the recoveryp
ptoday as we emerge from the pandemic we appear to be tiring of the destructive hype a report by sitecore a digital marketing agency finds that 40 per cent of brits believe black friday no longer offers good deals while more than a third 35 per cent a relnoreferrer noopener hrefhttpswwwdailystarpostcomclimatechangeandcovidpandemicarekillingoffblackfriday2 target_blankassociatea the day with overconsumption the same poll records that nearly six in ten of us 58 per cent prefer experiencebased gifts over more stuff another survey by globaldata a relnoreferrer noopener hrefhttpswwwglobaldatacomblackfriday2021stillopportunityukretailerschristmasspendcomesearlysaysglobaldata target_blankfounda that nearly twothirds of shoppers 62 per cent are not intending to buy anything on black friday this yearp
pblack fridays carnival of consumerism feels increasingly untethered from reality in what are for many people financially straightened times british consumers have already a relnoreferrer noopener hrefhttpswwwtheguardiancommoney2021oct26ukshoppers4bndebtbuynowpaylaterdeals target_blankracked upa more than 41bn in outstanding debt this year moreover the bank of england is preparing to wean us off of record low interest rates and a hrefhttpswwwnewstatesmancomtheexplainer202111inflationisatatenyearhighwhatdoesthismeanforyouinflation sits at its highest level in a decadea in the us household debt a relnoreferrer noopener hrefhttpswwwdailymailcouknewsarticle10184031ushouseholddebthitsrecordhigh15trillionhomecarpricessoarhtml target_blanknow standsa at a whopping 152trnp
pas the emails and promotions arrive in our inboxes this week enticing us to buy things we would never normally buy there is an even bigger elephant in the room a 2019 report which looked at 94 of the worlds biggest cities a relnoreferrer noopener hrefhttpsnewrepubliccomarticle154147climatechangesymptomconsumerculturedisease target_blankfounda that the consumption of goods and services including food clothing aviation electronics construction and vehicles was responsible for 10 per cent of global greenhouse gas emissionsp
pblack friday together with christmas plays its own part in environmental degradation between thanksgiving and new years day american household waste a relnoreferrer noopener hrefhttpsblogepagov20161221creativewaystocutyourholidaywaste target_blankreportedlya increases by more than 25 per centp
pmindless consumerism may power the economy but it is hastening the destruction of the planet and at a time when most of us are looking to government to reverse climate change according to 2020 polling a relnoreferrer noopener hrefhttpswwwglobalwitnessorgenpressreleasesyougovpollfindsmajoritybritishpublicwantukleadworldtacklingclimatechange target_blanktwothirdsa of britons want the government to take action on climate change a similar a relnoreferrer noopener hrefhttpswwwpewresearchorgscience20200623twothirdsofamericansthinkgovernmentshoulddomoreonclimate target_blankfigurea was polled in the usp
pyet outsourcing it all to government is a cop out as individuals we must undoubtedly reform our own behaviour too we might kickstart that process by staying at home on this black friday also known simply as friday and eschewing the bargains that are rarely any such thing nine in ten black friday deals are a relnoreferrer noopener hrefhttpswwwtelegraphcoukmoneyconsumeraffairsnine10blackfridaydealsnotcheaperrestyear target_blankno cheapera than the rest of the yearp
pas a country we neednt slavishly follow every cultural fad emanating from the united states the home of possessive individualism to possess to grab there is also more to life than shopping indeed sustaining a liveable planet depends on each of us acknowledging as muchp
pstrongem[see also a hrefhttpswwwnewstatesmancomthebusinessinterview202111darkstoreswontconquergrocerydeliverybeeliveryspaulgottonthefutureofshoppingdark stores wont conquer grocery delivery beeliverys paul gott on the future of shoppinga]emstrongp | pover recent years awareness days months increasingly appeared calendars example november simultaneously national diabetes month mens health awareness month national novel writing monthp pbig business managed act carve awareness day black friday officially known resulting orgy consumption afflicts final week novemberp pa cultural imposition united states term black friday coined 1869 plummeting food prices caused stock market crash unfathomably morphed allout celebration shopping day stores offer highly promoted sales heavily discounted prices routinely busiest shopping day year relnoreferrer noopener hrefhttpswwwfindercomblackfridaystatistics target_blankestimateda 724 million american adults plan shop black friday falls 26 november yearp pthose intend stay home neednt feel left black friday offers nonparticipantscombatants videos people trampling hands things normally afford unedifying ghoulish spectacle recent years source popular online entertainment black friday brawl relnoreferrer noopener hrefhttpswwwyoutubecomwatchvvpz97zblsck target_blankvideosa clocking tens thousands views youtubep ppublic entertainment derived watching poor folk fight case fridge freezers widescreen televisions neednt engage poorbaiting recognise black friday truly brings worst people black friday falls day thanksgiving mere 24 hours thankful frenzied consumers lay siege retail stores unfortunate staff work said americans dont understand ironyp pthere human cost black friday death count website relnoreferrer noopener hrefhttpswwwgooglecomurlsatrctjqesrcssourcewebcdcadrjauact8ved2ahukewjq0tfnmk70ahx0gf0hhsg_ceiqfnoecaiqaqurlhttps3a2f2fblackfridaydeathcountcom2fusgaovvaw3_oewibhkgaqlzmdv1fks_ target_blankrecordsa grim tally americans killed injured foraging bargains 14 deaths 117 injuries 2010 includes walter vance 61yearold pharmacist relnoreferrer noopener hrefhttpswwwhuffingtonpostcoukentryblackfridaytarget_n_1115372 target_blankcollapseda target store west virginia 2011 coming aid frenzied shoppers stepped vances incapacitated body searched discounted goods later died hospitalp pa years 2008 walmart worker relnoreferrer noopener hrefhttpswwwtheguardiancomworld2008nov29walmartblackfridayshoppersstampede target_blankkilleda control shoppers smashed doors companys stores long island new york according police witnesses store officials rushed victims aid trampled reportedly shouted tried close store deathp pblack friday arrived uk 2010 announced initially online retailer amazon celebration consumerism didnt truly 2013 supermarket chain asda owned time retail giant walmart started promoting heavily discounted deals emergence exploitative gig economy formed broader attempt business return capitalism profitability aftermath global financial crash governments west tightened belts announced solemnly money left citizens urged shop harder consumer spending powered recoveryp ptoday emerge pandemic appear tiring destructive hype report sitecore digital marketing agency finds 40 cent brits believe black friday longer offers good deals 35 cent relnoreferrer noopener hrefhttpswwwdailystarpostcomclimatechangeandcovidpandemicarekillingoffblackfriday2 target_blankassociatea day overconsumption poll records nearly 58 cent prefer experiencebased gifts stuff survey globaldata relnoreferrer noopener hrefhttpswwwglobaldatacomblackfriday2021stillopportunityukretailerschristmasspendcomesearlysaysglobaldata target_blankfounda nearly twothirds shoppers 62 cent intending buy black friday yearp pblack fridays carnival consumerism feels increasingly untethered reality people financially straightened times british consumers relnoreferrer noopener hrefhttpswwwtheguardiancommoney2021oct26ukshoppers4bndebtbuynowpaylaterdeals target_blankracked upa 41bn outstanding debt year bank england preparing wean record low interest rates hrefhttpswwwnewstatesmancomtheexplainer202111inflationisatatenyearhighwhatdoesthismeanforyouinflation sits highest level decadea household debt relnoreferrer noopener hrefhttpswwwdailymailcouknewsarticle10184031ushouseholddebthitsrecordhigh15trillionhomecarpricessoarhtml target_blanknow standsa ata whopping 152trnp pas emails promotions arrive inboxes week enticing buy things normally buy bigger elephant room 2019 report looked 94 worlds biggest cities relnoreferrer noopener hrefhttpsnewrepubliccomarticle154147climatechangesymptomconsumerculturedisease target_blankfounda consumption goods services including food clothing aviation electronics construction vehicles responsible 10 cent global greenhouse gas emissionsp pblack friday christmas plays environmental degradation thanksgiving new years day american household waste relnoreferrer noopener hrefhttpsblogepagov20161221creativewaystocutyourholidaywaste target_blankreportedlya increases 25 centp pmindless consumerism power economy hastening destruction planet time looking government reverse climate change according 2020 polling relnoreferrer noopener hrefhttpswwwglobalwitnessorgenpressreleasesyougovpollfindsmajoritybritishpublicwantukleadworldtacklingclimatechange target_blanktwothirdsa britons want government action climate change similar relnoreferrer noopener hrefhttpswwwpewresearchorgscience20200623twothirdsofamericansthinkgovernmentshoulddomoreonclimate target_blankfigurea polled usp pyet outsourcing government cop individuals undoubtedly reform behaviour kickstart process staying home black friday known simply friday eschewing bargains rarely thing black friday deals relnoreferrer noopener hrefhttpswwwtelegraphcoukmoneyconsumeraffairsnine10blackfridaydealsnotcheaperrestyear target_blankno cheapera rest yearp pas country neednt slavishly follow cultural fad emanating united states home possessive individualism possess grab life shopping sustaining liveable planet depends acknowledging muchp pstrongem[see hrefhttpswwwnewstatesmancomthebusinessinterview202111darkstoreswontconquergrocerydeliverybeeliveryspaulgottonthefutureofshoppingdark stores wont conquer grocery delivery beeliverys paul gott future shoppinga]emstrongp |
619ebf5152b2b940271f626d | The anatomy of gender discrimination | pthat is the topic of a relnoopener hrefhttpswwwbloombergcomopinionarticles20211123workplacestereotypesundercutgenderequalityinjobpromotionsutm_campaignsocialfloworganicutm_contentbusinessweekutm_sourcetwitterutm_mediumsocialcmpidsocialflowtwitterbusinessweeksrefhtohjx5y target_blankmy latest bloomberg columna here is one excerptp
blockquotepmaybe the men on average did have greater ambition and thus promotion potential one reason could be that women on average spend more time at home a relnoopener hrefhttpswwwpewresearchorgsocialtrends20130314chapter6timeinworkandleisurepatternsbygenderandfamilystructure target_blankraising childrena than men for very demanding executive jobs even a small difference in time and travel availability could make a big difference in job performancep
pand yet even if thats the case there could still be a discrimination problem even if women and men differ on average there is a probability distribution for each group and those distributions usually will overlap that is there will be many women who are willing and able to meet any workplace standard thrown at them and many men with limited ambitionp
pif you think men and women are different on average the unfairness can become all the emmoreem severe for the potential top performers in this context employers will look at the most talented women and for reasons of stereotyping dramatically underestimate their potential including for leadership positionsp
peconomic reasoning suggests another subtle effect at play promotion to the top involves a series of steps along a career ladder often many steps if there is a discrimination tax at each step even if only a small one those taxes can produce a discouraging effect it resembles the old problem of the medieval river that has too many tolls on it levied by too many independent principalities the net effect can be to make the river too costly to traverse even if each prince is taking only a small amountpblockquote
pwith a citation to zaua further belowp
pthe post a relnofollow hrefhttpmarginalrevolutioncommarginalrevolution202111theanatomyofgenderdiscriminationhtmlthe anatomy of gender discriminationa appeared first on a relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap | pthat topic relnoopener hrefhttpswwwbloombergcomopinionarticles20211123workplacestereotypesundercutgenderequalityinjobpromotionsutm_campaignsocialfloworganicutm_contentbusinessweekutm_sourcetwitterutm_mediumsocialcmpidsocialflowtwitterbusinessweeksrefhtohjx5y target_blankmy latest bloomberg columna excerptp blockquotepmaybe men average greater ambition promotion potential reason women average spend time homea relnoopener hrefhttpswwwpewresearchorgsocialtrends20130314chapter6timeinworkandleisurepatternsbygenderandfamilystructure target_blankraising childrenathan men demanding executive jobs small difference time travel availability big difference job performancep pand thats case discrimination problem women men differ average probability distribution group distributions usually overlap women willing able meet workplace standard thrown men limited ambitionp pif think men women different average unfairness theemmoreemsevere potential performers context employers look talented women reasons stereotyping dramatically underestimate potential including leadership positionsp peconomic reasoning suggests subtle effect play promotion involves series steps career ladder steps discrimination tax step small taxes produce discouraging effect resembles old problem medieval river tolls levied independent principalities net effect river costly traverse prince taking small amountpblockquote pwith citation zaua belowp pthe post relnofollow hrefhttpmarginalrevolutioncommarginalrevolution202111theanatomyofgenderdiscriminationhtmlthe anatomy gender discriminationa appeared relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap |
619ebfb652b2b940271f6281 | Is the WHO inventing diseases? | pspancan you be addicted to video games in 2018 the who decided to create a new entry in its big book of recognised diseases the spana relnoopener hrefhttpsicdwhointen target_blankspaninternational classification of diseasesspanaspan or icd11 that entry was spana relnoopener hrefhttpsicdwhointbrowse11lmenhttpidwhointicdentity1448597234 target_blankspangaming disorderspanaspan or internet gaming disorder igd also known as gaming addiction which involves impaired control over gaming gaming [taking] precedence over other life interests and daily activities [and] negative consequencesspanp
pspanyou can even be treated for it you can get spana relnoopener hrefhttpswwwcnwlnhsuknewsawardwillbeonemostimportantmomentsmycareercnwlsprofhenriettabowdenjonesreflectsbeingnamedpsychiatristyear target_blankspanspecialist treatment at a dedicated nhs clinicspanaspan south korea has gaming spana relnoopener hrefhttpswwwvicecomenarticledp5k8zinsidethesouthkoreanrehabclinicthattreatsgamingaddictswithgermanscifi922 target_blankspanrehab centresspanaspan gaming addicts have lost interest in their own lives and do not feel the passing of time in the real world according to a doctor who treats the condition therespanp
divdiv
pspanbut it is far from clear that gaming disorder or gaming addiction exists at least as a welldefined condition separate from any other compulsive behaviour and there is a hint that the who has made the decision under political pressure from china and other countries spanp
pspanthe whospana hrefhttpswwwwhointnewsroomquestionsandanswersitemaddictivebehavioursgamingdisorderspan saysspanaspan that its decision was based on reviews of available evidence and reflects a consensus of experts from different disciplines but when you look at whocommissioned evidence the studies are completely wild this spana relnoopener hrefhttpspubmedncbinlmnihgov32241295 target_blankspanreview of the literaturespanaspan carried out on behalf of the who found that the prevalence of igd ranged from 021575 in general populations spana relnoopener hrefhttpsjournalssagepubcomdoiepub1011770004867420962851 target_blankspanthis onespanaspan was rather less crazy but the studies it was aggregating found that between 016 and 14 of people had the disease spana relnoopener hrefhttpspubmedncbinlmnihgov28436212 target_blankspananotherspanaspan found 07 to 25spanp
pspanfor comparison about 8 of people who take opioids in the us end up addicted so video games might if we take those numbers at face value be several times as addictive as opioid painkillers which seems unexpected or equally it could barely exist at allspanp
diva hrefhttpsunherdcom202111thereisnospikingepidemicrefinnara hrefhttpsunherdcom202111thereisnospikingepidemicrefinnarimg srchttpsunherdcomwpcontentuploads2021112gettyimages1234289673scalede1636397459472300x178jpgadiva hrefhttpsunherdcom202111thereisnospikingepidemicrefinnarspanmore from this authorspanaa hrefhttpsunherdcom202111thereisnospikingepidemicrefinnarh5there is no spiking epidemich5apa hrefhttpsunherdcom202111thereisnospikingepidemicrefinnarspanbyspan tom chiversapdivadiv
pspanthe problem says dr spana relnoopener hrefhttpswwwbathspaacukourpeoplepeteretchells target_blankspanpete etchellsspanaspan a psychologist at bath spa university and author of spana relnoopener hrefhttpswwwamazoncoukdpb07l484rfnrefdpkindleredirect_encodingutf8btkr1 target_blankispanlost in a good gamespaniaspan is that depending on your definition your understanding of who has or doesnt have this disease varies wildly in the literature that is because he says we dont know what it looks like we dont know what it is and we dont know what its unique features are that separate it from other behavioural or impulse disordersspanp
pspanobviously some people have problems with playing video games too much you will have read stories about south korean teenagers wetting themselves rather than getting up from their gaming chair or people spana relnoopener hrefhttpswwwncbinlmnihgovpmcarticlespmc6560378 target_blankspandeveloping blood clotsspanaspan but rare anecdotes dont tell us much about the wider problem and people can develop problematic relationships with almost every form of enjoyable human activity with exercise with sex with spana relnoopener hrefhttpsenwikipediaorgwikitanning_dependence target_blankspantanningspanaspanspanp
pspanthe question is whether there is something unique to gaming which causes these problems dr spana relnoopener hrefhttpstwittercomshuhbillskee target_blankspanandy przybylskispanaspan a psychologist at the oxford internet institute has worked on gaming addiction in the past and argues that as far as we know there isnt he carried out spana relnoopener hrefhttpspeerjcomarticles3838p1 target_blankspana study in 2017spanaspan which looked at people who were classified as addicted to gaming at one time and checked whether they still were six months later if gaming addiction was comparable to say tobacco gambling or alcohol addiction then youd expect that most people would be spanp
pspanbut spana relnoopener hrefhttpswwwbuzzfeedcomtomchiversthisstudysaysvideogameaddictionisactuallysuperrare target_blankspanas it turned outspanaspan of the 6000 people recruited none of them met the diagnostic criteria for gaming disorder at both the beginning and the end of the study that is no one stayed addicted for six months dr netta weinstein another author of the study told me at the time that its a question of whether a diagnosis is stable and it suggests that internet gaming probably isnt an addiction like smoking or alcoholspanp
pspanprzybylski then was surprised to see that the who decided to classify igd as a separate illness and has been spana relnoopener hrefhttpstwittercomshuhbillskeestatus1448304296794247171 target_blankspanasking the whospanaspan whether or not they have any more evidence recently he received an email which said it is challenging if not impossible to document and communicate through who channels the rationale and justification for each decision spanp
pspanbut obviously you spanispancanspanispan prove or at least provide strong and convincing evidence for the existence of most illnesses and the who could very straightforwardly point to that evidence theres a reason why covid denialists are considered crackpots and cranks because its pretty straightforward to develop diagnostic tests which show you the presence of a virus and you can tell that the presence of that virus correlates strongly with a particular set of negative health outcomesspanp
diva hrefhttpsunherdcom202111thegreatclimatechangefallacyrefinnara hrefhttpsunherdcom202111thegreatclimatechangefallacyrefinnarimg srchttpsunherdcomwpcontentuploads202111gettyimages1350600662300x183jpgadiva hrefhttpsunherdcom202111thegreatclimatechangefallacyrefinnarspanmore from this authorspanaa hrefhttpsunherdcom202111thegreatclimatechangefallacyrefinnarh5the great climate change fallacyh5apa hrefhttpsunherdcom202111thegreatclimatechangefallacyrefinnarspanbyspan tom chiversapdivadiv
pspanwith psychiatric conditions of course the picture is often messier you cant swab someone and see if they have depression you can only ask them a series of questions or observe their behaviour but there are established criteria by which to do so and when you test someone with one twice a week apart they spana relnoopener hrefhttpswatermarksilverchaircomkqv087pdftokenaqecahi208be49ooan9kkhw_ercy7dm3zl_9cf3qfkac485ysgaaasgwgglebgkqhkig9w0bbwagggk1miicsqibadccaqogcsqgsib3dqehataebglghkgbzqmeas4weqqmgkulvj20bl8hiwfgageqgiice1nvvg70kgypyjq7atettdhhrurzqrn7egk4m_mmooxo0kzcyuwseagnknzomeja9yz9zjcx6tlrf3ln4nrp8n18bnkbonqgbshkamp7pcdbowrqzww10xc74gghzbedqht4of_r83h8onwuy_xmzkg4ubegoyyvhxq0sczxuuhfbtxzi5xuvqf3pvnduvhgb6tvv3fvily0jwmo5tpvgwonb2rbbsgu7_8gaautgefw2gzxux8rezs17zq0oak6f6fektuv5tnc6hd_l7mtyw7twvpuupkt5xvnomi9nsgthsdqwukftmuuwpuksjkvdg73mwxehxknka07qqwbtw_dpvj7qg9tn_n0rktg4tzcd8fjy7ndjr8nun9aivehwnwzvis9nopegglnki1hzaw8fmbfdkt8rjlu7khf5hotffxjzih5zs5c5wogjkbf60jot4wwovziuelbdc4l0fhwdvmkdcatdp95vpucb2hr2vv9haeqizfub9asmk4kl5vngf3hfxulhnumzmhgbtmwraduzqt7cimnslu46gfnctxautdxctztagitatmlp_avs902lt1itmxl1tzjs7tpr8oaddeshzbz2xbyljy1plmca3nzlvyqqtjnslhuqvwuliu4jzocunrrrkpusxr5hs5deoou24ngr4lv5ktsng6d7f3vucphy1tuyfqqubqbhxy2e6ktrwuye686yvhc0xjrgckzfq9bohgieqx5mvrua6llqoeo_xwwkpq8uhumavqdvv6gl6ous6dhorywboqu_dygnibeameqqik1s4ncryg9rhyml_ygistdj target_blankspanusually give the same answerspanaspanspanp
pspanbut with gaming disorder as weve seen that doesnt seem to be the case so the who creating a new diagnostic category is a big deal it gives clinicians licence to treat the disorder and perhaps more importantly it tells people and parents that gaming disorder is a real thing its a very emotive topic says etchells if you say suddenly that games can be addictive so many people play them that that can be a really scary thing we already know that parents are scared and concerned throwing it out there without any explanation or caveating i feel its quite irresponsible he worries that the who decision will pathologise normal healthy behaviour like playing video games after work to destressspanp
pspanthe question then is why has the who done it they didnt need to the american psychiatric association spana relnoopener hrefhttpswwwpsychiatryorgpatientsfamiliesinternetgaming target_blankspanhasnt yet added itspanaspan to the diagnostic and statistical manual of mental disorders and the royal college of psychiatrists hasnt formally recognised it spanp
pspanone possible answer is that the who has been pressured into doing it spana relnoopener hrefhttpswwwresearchgatenetprofilegeoffreyreed target_blankspanprofessor geoffrey reedspanaspan a medical psychologist at columbia university and senior project officer for the whos icd11 spana relnoopener hrefhttpstwittercomcjferguson1111status1461100257442418697photo1 target_blankspantold another psychologist by emailspanaspan in 2016 that the who was under enormous pressure especially from asian countries to include igdspanp
pspanive asked both professor reed and the who about this the who has declined to comment at short notice and if prof reed gets back to me ill include any response herespanp
pspanthere has been huge concern about video gaming in several east asian countries in japan and spana relnoopener hrefhttpswwwwiredcoukarticlehikikomorisouthkoreacovid target_blankspansouth koreaspanaspan there have been years of worries about the spanema relnoopener hrefhttpswwwncbinlmnihgovpmcarticlespmc4912003 target_blankspanhikikomorispanaemspan young adults who shut themselves off from society living in their parents homes never leaving eating delivery food watching netflix browsing the internet and playing games the phenomenon has also been spana relnoopener hrefhttpswwwfrontiersinorgarticles103389fpsyt201900512full target_blankspanwidely reportedspanaspan in china hong kong and singapore these countries are huge consumers and producers of video games and notably of spectator esports and people have been quick to blame video games for the conditionspanp
pspanand this has led to a widespread reaction which looks suspiciously like a moral panic south korea spana relnoopener hrefhttpsenwikipediaorgwikishutdown_law target_blankspanbanned under16s spanaspanfrom playing internet games between the hours of midnight and 6am in 2011 to improve childrens sleep a decision that was spana relnoopener hrefhttpswwwengadgetcomsouthkoreagamingshutdownlawend163212494htmlguccounter1guce_referrerahr0chm6ly9lbi53awtpcgvkaweub3jnlwguce_referrer_sigaqaaan3g3gh32ld6u123_gm2itr3zq3h3gsgma5f3mb1lnem7qoilxccpmjxanetb83pgehcquss2iyavcad2sobwawrpmwn2pm8x6_xru9drszscbhirorc8sipogo6egn387oqsya0fuxbsqmwyqqy1dwx6hdw4uf8dhvpdedz2xbm target_blankspanonly overturnedspanaspan in august etchells says that research showed the ban was counterproductive it increased childrens time on the internet and had no meaningful effect on increasing sleep china recently enacted spana relnoopener hrefhttpswwwengadgetcom20191107chinagamingaddictionregulationshtml target_blankspanan even more stringent lawspanaspan banning under18s from using internet games between 10pm and 8am spanp
pspansocieties are entitled to ban anything they want of course but the concern is that theyre hiding behind science to do it its an extreme example of people pathologising things they find distasteful says dr stuart ritchie a psychologist at kings college london some people find video games distasteful they dont like the idea of kids shooting at each other but you have to ask what the quality of the evidence is przybylski agrees if people want to create rules they should create rules but if youre saying its based on evidence or science you should show your notesspanp
diva hrefhttpsunherdcom202110doesgrandtheftautosavelivesrefinnara hrefhttpsunherdcom202110doesgrandtheftautosavelivesrefinnarimg srchttpsunherdcomwpcontentuploads202110https___d1e00ek4ebabmscloudfrontnet_production_28993ca1a36c4382a18e4e9f8bcfa1bb300x168jpgadiva hrefhttpsunherdcom202110doesgrandtheftautosavelivesrefinnarspansuggested readingspanaa hrefhttpsunherdcom202110doesgrandtheftautosavelivesrefinnarh5does grand theft auto save livesh5apa hrefhttpsunherdcom202110doesgrandtheftautosavelivesrefinnarspanbyspan stuart ritchieapdivadiv
pspanwere talking about very complex generational issues and trying to explain them by looking at one simple factor and thats never the case says etchells if there was a simple causal link he points out given the billions of users youd expect to see enormous effects not weird ambiguous trends in messy dataspanp
pspanthe trouble is as przybylski says that mental health provision is poorly resourced and expensive if a teenager is diagnosed with a mental health condition in the uk he says they can age out of being a teenager before youre seen by a psychiatrist video game addiction on the other hand is shiny and exciting and it sounds cheap because it seems like theres an off switch just turn off the consolespanp
pspanbut it comes at a cost for one thing even if emhikikomoriem is a real problem in china and other countries and even if a causal link can be shown to video games it makes no sense to create a global diagnosis for a highly regionspecific problem for another it frightens gamers and their parents perhaps unnecessarily and gives cover to any old quack or charlatan who wants to promise to treat gaming addiction at their expensive clinic despite there being no clear diagnostic criteria and no agreed treatmentspanp
pspanmost of all though theres a reputational risk for the who its putting its credibility on the line says przybylski its supposed to be a neutral scientific body it cannot be seen to be making scientific decisions for political reasons for the last two years its spana relnoopener hrefhttpswwwtheatlanticcompoliticsarchive202004worldhealthorganizationblamepandemiccoronavirus609820 target_blankspanfaced criticismspanaspan of cosying up to china over covid praising the chinese government for transparency and for setting a new standard for outbreak response even as it spana relnoopener hrefhttpswwwwashingtonpostcomworld20200204chinesedoctorhascoronavirus target_blankspancensured doctorsspanaspan for trying to spread the word about the disease if it transpires that the who has put gaming disorder into the icd11 as a result of political pressure whether from china or elsewhere its credibility will be even more underminedspanp
pspanthe academic community and the who have really dropped the ball on gaming disorder says etchells rather than being brave enough to stop take stock and work out whether it really exists at all as a coherent concept i can see how its difficult for the who to go against these strong opinions but they need to he says they cant come up with disease classifications built on politicsspanp
a hrefhttpsunherdcom202111whatschinagotagainstgamingappcommentsview 3 commentsa | pspancan addicted video games 2018 decided create new entry big book recognised diseases spana relnoopener hrefhttpsicdwhointen target_blankspaninternational classification diseasesspanaspan icd11 entry spana relnoopener hrefhttpsicdwhointbrowse11lmenhttpidwhointicdentity1448597234 target_blankspangaming disorderspanaspan internet gaming disorder igd known gaming addiction involves impaired control gaming gaming [taking] precedence life interests daily activities [and] negative consequencesspanp pspanyou treated spana relnoopener hrefhttpswwwcnwlnhsuknewsawardwillbeonemostimportantmomentsmycareercnwlsprofhenriettabowdenjonesreflectsbeingnamedpsychiatristyear target_blankspanspecialist treatment dedicated nhs clinicspanaspan south korea gaming spana relnoopener hrefhttpswwwvicecomenarticledp5k8zinsidethesouthkoreanrehabclinicthattreatsgamingaddictswithgermanscifi922 target_blankspanrehab centresspanaspan gaming addicts lost interest lives feel passing time real world according doctor treats condition therespanp divdiv pspanbut far clear gaming disorder gaming addiction exists welldefined condition separate compulsive behaviour hint decision political pressure china countriesspanp pspanthe whospana hrefhttpswwwwhointnewsroomquestionsandanswersitemaddictivebehavioursgamingdisorderspan saysspanaspan decision based reviews available evidence reflects consensus experts different disciplines look whocommissioned evidence studies completely wild spana relnoopener hrefhttpspubmedncbinlmnihgov32241295 target_blankspanreview literaturespanaspan carried behalf found prevalence igd ranged 021575 general populations spana relnoopener hrefhttpsjournalssagepubcomdoiepub1011770004867420962851 target_blankspanthis onespanaspan crazy studies aggregating found 016 14 people disease spana relnoopener hrefhttpspubmedncbinlmnihgov28436212 target_blankspananotherspanaspan found 07 25spanp pspanfor comparison 8 people opioids end addicted video games numbers face value times addictive opioid painkillers unexpected equally barely exist allspanp diva hrefhttpsunherdcom202111thereisnospikingepidemicrefinnara hrefhttpsunherdcom202111thereisnospikingepidemicrefinnarimg srchttpsunherdcomwpcontentuploads2021112gettyimages1234289673scalede1636397459472300x178jpgadiva hrefhttpsunherdcom202111thereisnospikingepidemicrefinnarspanmore authorspanaa hrefhttpsunherdcom202111thereisnospikingepidemicrefinnarh5there spiking epidemich5apa hrefhttpsunherdcom202111thereisnospikingepidemicrefinnarspanbyspan tom chiversapdivadiv pspanthe problem says dr spana relnoopener hrefhttpswwwbathspaacukourpeoplepeteretchells target_blankspanpete etchellsspanaspan psychologist bath spa university author spana relnoopener hrefhttpswwwamazoncoukdpb07l484rfnrefdpkindleredirect_encodingutf8btkr1 target_blankispanlost good gamespaniaspan depending definition understanding doesnt disease varies wildly literature says dont know looks like dont know dont know unique features separate behavioural impulse disordersspanp pspanobviously people problems playing video games read stories south korean teenagers wetting getting gaming chair people spana relnoopener hrefhttpswwwncbinlmnihgovpmcarticlespmc6560378 target_blankspandeveloping blood clotsspanaspan rare anecdotes dont tell wider problem people develop problematic relationships form enjoyable human activity exercise sex spana relnoopener hrefhttpsenwikipediaorgwikitanning_dependence target_blankspantanningspanaspanspanp pspanthe question unique gaming causes problems dr spana relnoopener hrefhttpstwittercomshuhbillskee target_blankspanandy przybylskispanaspan psychologist oxford internet institute worked gaming addiction past argues far know isnt carried spana relnoopener hrefhttpspeerjcomarticles3838p1 target_blankspana study 2017spanaspan looked people classified addicted gaming time checked months later gaming addiction comparable tobacco gambling alcohol addiction youd expect people bespanp pspanbut spana relnoopener hrefhttpswwwbuzzfeedcomtomchiversthisstudysaysvideogameaddictionisactuallysuperrare target_blankspanas turned outspanaspan 6000 people recruited met diagnostic criteria gaming disorder beginning end study stayed addicted months dr netta weinstein author study told time question diagnosis stable suggests internet gaming probably isnt addiction like smoking alcoholspanp pspanprzybylski surprised decided classify igd separate illness spana relnoopener hrefhttpstwittercomshuhbillskeestatus1448304296794247171 target_blankspanasking whospanaspan evidence recently received email said challenging impossible document communicate channels rationale justification decisionspanp pspanbut obviously spanispancanspanispan prove provide strong convincing evidence existence illnesses straightforwardly point evidence theres reason covid denialists considered crackpots cranks pretty straightforward develop diagnostic tests presence virus tell presence virus correlates strongly particular set negative health outcomesspanp diva hrefhttpsunherdcom202111thegreatclimatechangefallacyrefinnara hrefhttpsunherdcom202111thegreatclimatechangefallacyrefinnarimg srchttpsunherdcomwpcontentuploads202111gettyimages1350600662300x183jpgadiva hrefhttpsunherdcom202111thegreatclimatechangefallacyrefinnarspanmore authorspanaa hrefhttpsunherdcom202111thegreatclimatechangefallacyrefinnarh5the great climate change fallacyh5apa hrefhttpsunherdcom202111thegreatclimatechangefallacyrefinnarspanbyspan tom chiversapdivadiv pspanwith psychiatric conditions course picture messier cant swab depression ask series questions observe behaviour established criteria test twice week apart spana relnoopener hrefhttpswatermarksilverchaircomkqv087pdftokenaqecahi208be49ooan9kkhw_ercy7dm3zl_9cf3qfkac485ysgaaasgwgglebgkqhkig9w0bbwagggk1miicsqibadccaqogcsqgsib3dqehataebglghkgbzqmeas4weqqmgkulvj20bl8hiwfgageqgiice1nvvg70kgypyjq7atettdhhrurzqrn7egk4m_mmooxo0kzcyuwseagnknzomeja9yz9zjcx6tlrf3ln4nrp8n18bnkbonqgbshkamp7pcdbowrqzww10xc74gghzbedqht4of_r83h8onwuy_xmzkg4ubegoyyvhxq0sczxuuhfbtxzi5xuvqf3pvnduvhgb6tvv3fvily0jwmo5tpvgwonb2rbbsgu7_8gaautgefw2gzxux8rezs17zq0oak6f6fektuv5tnc6hd_l7mtyw7twvpuupkt5xvnomi9nsgthsdqwukftmuuwpuksjkvdg73mwxehxknka07qqwbtw_dpvj7qg9tn_n0rktg4tzcd8fjy7ndjr8nun9aivehwnwzvis9nopegglnki1hzaw8fmbfdkt8rjlu7khf5hotffxjzih5zs5c5wogjkbf60jot4wwovziuelbdc4l0fhwdvmkdcatdp95vpucb2hr2vv9haeqizfub9asmk4kl5vngf3hfxulhnumzmhgbtmwraduzqt7cimnslu46gfnctxautdxctztagitatmlp_avs902lt1itmxl1tzjs7tpr8oaddeshzbz2xbyljy1plmca3nzlvyqqtjnslhuqvwuliu4jzocunrrrkpusxr5hs5deoou24ngr4lv5ktsng6d7f3vucphy1tuyfqqubqbhxy2e6ktrwuye686yvhc0xjrgckzfq9bohgieqx5mvrua6llqoeo_xwwkpq8uhumavqdvv6gl6ous6dhorywboqu_dygnibeameqqik1s4ncryg9rhyml_ygistdj target_blankspanusually answerspanaspanspanp pspanbut gaming disorder weve seen doesnt case creating new diagnostic category big deal gives clinicians licence treat disorder importantly tells people parents gaming disorder real thing emotive topic says etchells suddenly games addictive people play scary thing know parents scared concerned throwing explanation caveating feel irresponsible worries decision pathologise normal healthy behaviour like playing video games work destressspanp pspanthe question didnt need american psychiatric association spana relnoopener hrefhttpswwwpsychiatryorgpatientsfamiliesinternetgaming target_blankspanhasnt added itspanaspan diagnostic statistical manual mental disorders royal college psychiatrists hasnt formally recognised itspanp pspanone possible answer pressured spana relnoopener hrefhttpswwwresearchgatenetprofilegeoffreyreed target_blankspanprofessor geoffrey reedspanaspan medical psychologist columbia university senior project officer whos icd11 spana relnoopener hrefhttpstwittercomcjferguson1111status1461100257442418697photo1 target_blankspantold psychologist emailspanaspan 2016 enormous pressure especially asian countries include igdspanp pspanive asked professor reed declined comment short notice prof reed gets ill include response herespanp pspanthere huge concern video gaming east asian countries japan spana relnoopener hrefhttpswwwwiredcoukarticlehikikomorisouthkoreacovid target_blankspansouth koreaspanaspan years worries spanema relnoopener hrefhttpswwwncbinlmnihgovpmcarticlespmc4912003 target_blankspanhikikomorispanaemspan young adults shut society living parents homes leaving eating delivery food watching netflix browsing internet playing games phenomenon spana relnoopener hrefhttpswwwfrontiersinorgarticles103389fpsyt201900512full target_blankspanwidely reportedspanaspan china hong kong singapore countries huge consumers producers video games notably spectator esports people quick blame video games conditionspanp pspanand led widespread reaction looks suspiciously like moral panic south korea spana relnoopener hrefhttpsenwikipediaorgwikishutdown_law target_blankspanbanned under16s spanaspanfrom playing internet games hours midnight 6am 2011 improve childrens sleep decision spana relnoopener hrefhttpswwwengadgetcomsouthkoreagamingshutdownlawend163212494htmlguccounter1guce_referrerahr0chm6ly9lbi53awtpcgvkaweub3jnlwguce_referrer_sigaqaaan3g3gh32ld6u123_gm2itr3zq3h3gsgma5f3mb1lnem7qoilxccpmjxanetb83pgehcquss2iyavcad2sobwawrpmwn2pm8x6_xru9drszscbhirorc8sipogo6egn387oqsya0fuxbsqmwyqqy1dwx6hdw4uf8dhvpdedz2xbm target_blankspanonly overturnedspanaspan august etchells says research showed ban counterproductive increased childrens time internet meaningful effect increasing sleep china recently enacted spana relnoopener hrefhttpswwwengadgetcom20191107chinagamingaddictionregulationshtml target_blankspanan stringent lawspanaspan banning under18s internet games 10pm 8amspanp pspansocieties entitled ban want course concern theyre hiding science extreme example people pathologising things find distasteful says dr stuart ritchie psychologist kings college london people find video games distasteful dont like idea kids shooting ask quality evidence przybylski agrees people want create rules create rules youre saying based evidence science notesspanp diva hrefhttpsunherdcom202110doesgrandtheftautosavelivesrefinnara hrefhttpsunherdcom202110doesgrandtheftautosavelivesrefinnarimg srchttpsunherdcomwpcontentuploads202110https___d1e00ek4ebabmscloudfrontnet_production_28993ca1a36c4382a18e4e9f8bcfa1bb300x168jpgadiva hrefhttpsunherdcom202110doesgrandtheftautosavelivesrefinnarspansuggested readingspanaa hrefhttpsunherdcom202110doesgrandtheftautosavelivesrefinnarh5does grand theft auto save livesh5apa hrefhttpsunherdcom202110doesgrandtheftautosavelivesrefinnarspanbyspan stuart ritchieapdivadiv pspanwere talking complex generational issues trying explain looking simple factor thats case says etchells simple causal link points given billions users youd expect enormous effects weird ambiguous trends messy dataspanp pspanthe trouble przybylski says mental health provision poorly resourced expensive teenager diagnosed mental health condition uk says age teenager youre seen psychiatrist video game addiction hand shiny exciting sounds cheap like theres switch turn consolespanp pspanbut comes cost thing emhikikomoriem real problem china countries causal link shown video games makes sense create global diagnosis highly regionspecific problem frightens gamers parents unnecessarily gives cover old quack charlatan wants promise treat gaming addiction expensive clinic despite clear diagnostic criteria agreed treatmentspanp pspanmost theres reputational risk putting credibility line says przybylski supposed neutral scientific body seen making scientific decisions political reasons years spana relnoopener hrefhttpswwwtheatlanticcompoliticsarchive202004worldhealthorganizationblamepandemiccoronavirus609820 target_blankspanfaced criticismspanaspan cosying china covid praising chinese government transparency setting new standard outbreak response spana relnoopener hrefhttpswwwwashingtonpostcomworld20200204chinesedoctorhascoronavirus target_blankspancensured doctorsspanaspan trying spread word disease transpires gaming disorder icd11 result political pressure china credibility underminedspanp pspanthe academic community dropped ball gaming disorder says etchells brave stop stock work exists coherent concept difficult strong opinions need says cant come disease classifications built politicsspanp hrefhttpsunherdcom202111whatschinagotagainstgamingappcommentsview 3 commentsa |
61a00faa5da8e816c4b36e7e | UK public debt stands at almost 100 per cent of GDP. History shows how to respond | psteins law named after the eminent american economic a hrefhttpsenwikipediaorgwikiherbert_steinherbert steina holds that if something cant go on forever it will stop the law holds for the government accounts at some point the tendency for the stock of public debt to grow faster than the economy will have to stop there are limits on the share of tax revenues that can be devoted to debt service without crowding out socially valued and economically valuable projects a hrefhttpswwwvoxcomfutureperfect201941618251646modernmonetarytheorynewmomentexplainedmodern monetary theoristsa dispute this but other economists do notp
pchancellor rishi sunaks october 2021 autumn budget is as far as i can see the first major statement by a government official since the pandemic which details plans for slowing the growth of public debt and stabilising the debtgdp ratio on its basis the a hrefhttpsobrukoffice for budget responsibilitya sees public sector net debt as a share of uk gdp falling from 982 per cent to 978 per cent in the next two fiscal years this is a modest adjustment compared to the aftermath of the global financial crisis when there were equivalent tax increases but also severe cuts in discretionary spending evidently the lessons of a hrefhttpswwweconomistcomfinanceandeconomics20210130whoisatriskfromprematureausteritypremature austeritya have been learnedp
pthe obr then sees the debt ratio falling to 88 per cent of gdp in 20262027 assuming the economy continues to expand the argument for reducing the ratio is that this must be done in order to enhance the governments capacity to meet the next emergency this may be another financial crisis or novel coronavirus it could be a geopolitical event or climaterelated disaster no one can say but prudent governments budget for contingenciesp
pand not for the first time is the government weighing how it should do so it is instructive when considering options for the uk today to look to history only then can we draw conclusions about the speed and extent of debt reduction that can realistically be achievedp
ptwo centuries ago britain emerged from the french and napoleonic wars with a debttogdp ratio of 200 per cent twice current levels on the eve of world war i that ratio had been reduced to less than 30 per cent that contemporaries saw another conflict coming had concentrated minds the extent of the franchise was still limited even after the reform acts of 1832 1867 and 1884 making for strong creditor representation in the house of commons the long 19supthsup century was a period of peace by earlier standards not having to engage in large amounts of military spending the government was able to run primary budget surpluses revenues minus spending net of interest payments excepting only during the boer warp
pobviously this is not an experience that can be replicated todays political environment creates intense pressure to devote revenues to objectives other than debt retirement the government can aspire to fiscal restraint but not with the same singlemindednessp
pthe uk then emerged from world war i with another massive debt approaching 200 per cent of gdp in 1923 agreeing on tax increases and spending reductions was more difficult in this era of universal franchise the treasury argued against deficits the colwyn committee set up in 1924 by then chancellor winston churchill made a forceful case for debt reduction backed by these arguments the government delivered primary surpluses from 1923 to 1929p
pbut it reduced the debt ratio only to a limited extent interest rates were high reflecting doubts about the governments commitment to debt consolidation they were higher than the growth rate of the economy causing the denominator of the debtgdp ratio to lag behind the numerator alarmingly this emisem an experience that can be replicated productivity growth in the uk has disappointed for a decade failing to solve this problem will make stabilising the debt ratio wellnigh impossiblep
pafter world war ii in contrast the stars were aligned for debt consolidation between 1945 and 1973 a debt burden of more than 250 per cent of gdp was reduced to less than 50 per cent helped along by a backlog of unexploited investment opportunities and a favorable external environment growth was rapid even in what was now the sick man of europep
pmoreover interest rates were below growth rates unlike before strict regulation compelled banks to invest in government bonds pushing prices up and yields down capital controls bottled up savings benefiting the market in giltsp
blockquote classwpblockquotepbetween 1945 and 1973 a debt burden of more than 250 per cent of gdp was reduced to less than 50 per centpblockquote
ptodays environment is different capital controls are not coming back brexit or not their views informed by the global financial crisis regulators see forcefeeding government bonds to the banks as creating a a hrefhttpswwwaeaweborgarticlesid101257aerp20161107diabolic loopa in which bank and government balance sheets destabilise one another some see the bank of england as capping bond yields by purchasing an everincreasing share of public debt but sooner or later this will threaten inflation at that point a hrefhttpsglobaloupcomacademicproductindefenseofpublicdebt9780197577899ccuslangenin my viewa an independent central bank and powerful creditors lobby will push backp
pcritically in the quarter century following world war ii government was able to run primary budget surpluses while at the same time expanding the welfare state although social spending rose from 5 per cent of gdp in 1938 to nearly 85 per cent in 1974 a hrefhttpswwweelgarcomshopusdgovernmentversusthemarket9781852780319htmlsurpluses were maintaineda some criticise the postwar expansion of programmes to alleviate poverty as a hrefhttpsonlinelibrarywileycomdoiabs101111ecaf12489insufficiently ambitiousa but this is what happens when it is necessary to use one instrument the budget to pursue two targets poverty alleviation and debt reduction more positively this experience points to the possibility that debt consolidation can be consistent with support for the national health service with the need for public spending on tackling climate change and with levelling up the northp
phow were these imperatives reconciled after world war ii first rapid economic growth made for buoyant revenues there were no major economic dislocations like those of the 1920s and 1930s to throw revenue growth off coursep
psecond there was a willingness and ability to levy taxes on the wealthy and on corporations willingness given the arguments for social solidarity inherited from the war ability since controls limited the scope for relocating to lowertax jurisdictions those limits didnt prevent the rolling stones from moving to france but they did permit the maintenance of higher tax rates on corporate profits which were taxed at the same rate as ordinary income until 1965p
pit is beyond the capacity of the uk today to replicate the miraculous reductions in the debt ratio following the french wars and world war ii a century of budget surpluses like those of the victorians is beyond our political grasp statutory limits on interest rates like those after world war ii are not on the cards inevitably debt consolidation will be more difficult and haltingp
pbut what the uk must do is figure out how to grow the economy enhancing its debtbearing capacity and augmenting government receipts it can use taxes on corporations and the wealthy to increase revenues the recent g20 agreement on a 15 per cent minimum corporate tax is a first step it can devote those resources to prudently expanding social programmes while also running primary budget surpluses this may not be the best imaginable debtmanagement strategy but it is the best available strategyp
pthe post a relnofollow hrefhttpswwwprospectmagazinecoukeconomicsandfinanceukpublicdebtstandsatalmost100percentofgdphistoryshowshowtoresponduk public debt stands at almost 100 per cent of gdp history shows how to responda appeared first on a relnofollow hrefhttpswwwprospectmagazinecoukprospect magazineap | psteins law named eminent american economic hrefhttpsenwikipediaorgwikiherbert_steinherbert steina holds cant forever stop law holds government accounts point tendency stock public debt grow faster economy stop limits share tax revenues devoted debt service crowding socially valued economically valuable projects hrefhttpswwwvoxcomfutureperfect201941618251646modernmonetarytheorynewmomentexplainedmodern monetary theoristsa dispute economists notp pchancellor rishi sunaks october 2021 autumn budget far major statement government official pandemic details plans slowing growth public debt stabilising debtgdp ratio basis hrefhttpsobrukoffice budget responsibilitya sees public sector net debt share uk gdp falling 982 cent 978 cent fiscal years modest adjustment compared aftermath global financial crisis equivalent tax increases severe cuts discretionary spending evidently lessons hrefhttpswwweconomistcomfinanceandeconomics20210130whoisatriskfromprematureausteritypremature austeritya learnedp pthe obr sees debt ratio falling 88 cent gdp 20262027 assuming economy continues expand argument reducing ratio order enhance governments capacity meet emergency financial crisis novel coronavirus geopolitical event climaterelated disaster prudent governments budget contingenciesp pand time government weighing instructive considering options uk today look history draw conclusions speed extent debt reduction realistically achievedp ptwo centuries ago britain emerged french napoleonic wars debttogdp ratio 200 cent twice current levels eve world war ratio reduced 30 cent contemporaries saw conflict coming concentrated minds extent franchise limited reform acts 1832 1867 1884 making strong creditor representation house commons long 19supthsup century period peace earlier standards having engage large amounts military spending government able run primary budget surpluses revenues minus spending net interest payments excepting boer warp pobviously experience replicated todays political environment creates intense pressure devote revenues objectives debt retirement government aspire fiscal restraint singlemindednessp pthe uk emerged world war massive debt approaching 200 cent gdp 1923 agreeing tax increases spending reductions difficult era universal franchise treasury argued deficits colwyn committee set 1924 chancellor winston churchill forceful case debt reduction backed arguments government delivered primary surpluses 1923 1929p pbut reduced debt ratio limited extent interest rates high reflecting doubts governments commitment debt consolidation higher growth rate economy causing denominator debtgdp ratio lag numerator alarmingly emisem experience replicated productivity growth uk disappointed decade failing solve problem stabilising debt ratio wellnigh impossiblep pafter world war ii contrast stars aligned debt consolidation 1945 1973 debt burden 250 cent gdp reduced 50 cent helped backlog unexploited investment opportunities favorable external environment growth rapid sick man europep pmoreover interest rates growth rates unlike strict regulation compelled banks invest government bonds pushing prices yields capital controls bottled savings benefiting market giltsp blockquote classwpblockquotepbetween 1945 1973 debt burden 250 cent gdp reduced 50 centpblockquote ptodays environment different capital controls coming brexit views informed global financial crisis regulators forcefeeding government bonds banks creating hrefhttpswwwaeaweborgarticlesid101257aerp20161107diabolic loopa bank government balance sheets destabilise bank england capping bond yields purchasing everincreasing share public debt sooner later threaten inflation point hrefhttpsglobaloupcomacademicproductindefenseofpublicdebt9780197577899ccuslangenin viewa independent central bank powerful creditors lobby push backp pcritically quarter century following world war ii government able run primary budget surpluses time expanding welfare state social spending rose 5 cent gdp 1938 nearly 85 cent 1974 hrefhttpswwweelgarcomshopusdgovernmentversusthemarket9781852780319htmlsurpluses maintaineda criticise postwar expansion programmes alleviate poverty hrefhttpsonlinelibrarywileycomdoiabs101111ecaf12489insufficiently ambitiousa happens necessary use instrument budget pursue targets poverty alleviation debt reduction positively experience points possibility debt consolidation consistent support national health service need public spending tackling climate change levelling northp phow imperatives reconciled world war ii rapid economic growth buoyant revenues major economic dislocations like 1920s 1930s throw revenue growth coursep psecond willingness ability levy taxes wealthy corporations willingness given arguments social solidarity inherited war ability controls limited scope relocating lowertax jurisdictions limits didnt prevent rolling stones moving france permit maintenance higher tax rates corporate profits taxed rate ordinary income 1965p pit capacity uk today replicate miraculous reductions debt ratio following french wars world war ii century budget surpluses like victorians political grasp statutory limits interest rates like world war ii cards inevitably debt consolidation difficult haltingp pbut uk figure grow economy enhancing debtbearing capacity augmenting government receipts use taxes corporations wealthy increase revenues recent g20 agreement 15 cent minimum corporate tax step devote resources prudently expanding social programmes running primary budget surpluses best imaginable debtmanagement strategy best available strategyp pthe post relnofollow hrefhttpswwwprospectmagazinecoukeconomicsandfinanceukpublicdebtstandsatalmost100percentofgdphistoryshowshowtoresponduk public debt stands 100 cent gdp history shows responda appeared relnofollow hrefhttpswwwprospectmagazinecoukprospect magazineap |
61a00fd85da8e816c4b36e82 | What should I ask Russ Roberts? | pi will be doing a podcast with him specifically focusing on his decision to emigrate to israel here are a relnoopener hrefhttpstwittercomecontalkerstatus1453246831295672324s20 target_blankthe suggestions that russ solicited from twittera we will release the episode both on econtalk and on cwtp
pso what should i ask him keep in mind this is the conversation with russ i want to havep
pthe post a relnofollow hrefhttpmarginalrevolutioncommarginalrevolution202111whatshouldiaskrussroberts2htmlwhat should i ask russ robertsa appeared first on a relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap | pi podcast specifically focusing decision emigrate israel relnoopener hrefhttpstwittercomecontalkerstatus1453246831295672324s20 target_blankthe suggestions russ solicited twittera release episode econtalk cwtp pso ask mind conversation russ want havep pthe post relnofollow hrefhttpmarginalrevolutioncommarginalrevolution202111whatshouldiaskrussroberts2htmlwhat ask russ robertsa appeared relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap |
61a00fe95da8e816c4b36e84 | Model this Apple pricing decision | blockquotepa hrefhttpswwwwsjcommarketdataquotesaaplapple ahas one new product thats already so backordered it wont arrive in time for christmas its a relnoopener hrefhttpswwwapplecomshopproductmm6f3amapolishingcloth target_blanka polishing clotha priced at 19p
punveiled in october after apple showed off its new line of gadgets the soft light gray square is made of nonabrasive material and embossed with apples logo during tests the rag worked like other microfiber cloths that list for less than half that price sowhy 19pblockquote
div
blockquotepas it happens apples pricing strategy rarely allows accessories to fall below that threshold the 63inch swatch of fabric sits beside 17 other applebranded items on the companys websitea mlange of charging cables dongles and adapterseach priced at 19 some such as the wired earbuds and charging adapter were once included with new iphonesp
pthose 19 apple itemstogether with the apple watch airpods and other small gadgetsare part of the companys growing wearables home and accessories category which had more than 8 billion in revenue in the quarter that ended in octoberpblockquote
palmost every apple price ends in the number 9 would it matter if we all carried around 30 bills there is further discussion in a relnoopener hrefhttpswwwwsjcomarticleswhy19isapplesfavoritepriceforaccessories11637686800modsearchresults_pos1page1 target_blankthis galvin brown wsj pieceap
pvia the excellent a relnoopener hrefhttpstwittercomsamirvarma target_blanksamir varmaap
div
pthe post a relnofollow hrefhttpmarginalrevolutioncommarginalrevolution202111modelthisapplepricingdecisionhtmlmodel this apple pricing decisiona appeared first on a relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap | blockquotepa hrefhttpswwwwsjcommarketdataquotesaaplapple ahas new product thats backordered wont arrive time christmas relnoopener hrefhttpswwwapplecomshopproductmm6f3amapolishingcloth target_blanka polishing clotha priced 19p punveiled october apple showed new line gadgets soft light gray square nonabrasive material embossed apples logo tests rag worked like microfiber cloths list half price sowhy 19pblockquote div blockquotepas happens apples pricing strategy rarely allows accessories fall threshold 63inch swatch fabric sits 17 applebranded items companys websitea mlange charging cables dongles adapterseach priced 19 wired earbuds charging adapter included new iphonesp pthose 19 apple itemstogether apple watch airpods small gadgetsare companys growing wearables home accessories category 8 billion revenue quarter ended octoberpblockquote palmost apple price ends number 9 matter carried 30 bills discussion relnoopener hrefhttpswwwwsjcomarticleswhy19isapplesfavoritepriceforaccessories11637686800modsearchresults_pos1page1 target_blankthis galvin brown wsj pieceap pvia excellent relnoopener hrefhttpstwittercomsamirvarma target_blanksamir varmaap div pthe post relnofollow hrefhttpmarginalrevolutioncommarginalrevolution202111modelthisapplepricingdecisionhtmlmodel apple pricing decisiona appeared relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap |
61a010255da8e816c4b36e8c | Giving thanks for the magic of the marketplace, the invisible hand of strangers, and no turkey czars | pa hrefhttpwwwaeiorgwpcontentuploads201911turkeyjpgx91208img alt width900 srchttpwwwaeiorgwpcontentuploads201911turkey1024x682jpgx91208 classwpimage1008547208 height599ap
pthis thanksgiving post has been an annual tradition at strongcdstrong and i feature a slightly revised version again this yearp
plike in previous years most of you probably didnt call your local supermarket ahead of time and order a thanksgiving turkey this year why not because you automatically assumed that a turkey would be there when you showed up and it probably was there when you appeared unannounced at your local grocery store and selected your thanksgiving bird this week we got two frozen butterball turkeys on monday at costco for 099 per pound what a bargainp
pthe reason your thanksgiving turkey like ours was waiting for you without an advance order because of the economic concepts of spontaneous order selfinterest and the invisible hand of the free market turkeys appeared in your local grocery stores primarily because of the selfinterest greed of thousands of turkey farmers truck drivers and supermarket owners and employees who are complete strangers to you and your family but all of those strangers throughout the turkey supply chain cooperated on your behalf and were led by the invisible hand to make sure your family had a turkey or two on the table to celebrate thanksgiving this thursday the invisible hand that was responsible for your holiday turkey is just one of millions of everyday examples of the strongmiracle of the marketplacestrong where strongindividually selfish decisions emmustem lead to collectively efficient outcomesstrong as economist a relnoopener noreferrer hrefhttpwwwwalkerdpeoplecofcedureadingstradeiowacarcroppdf target_blanksteven e landsburg observedap
pin a 2003 boston globe article titled a relnoopener noreferrer hrefhttpwwwjeffjacobycom8393givingthanksfortheinvisiblehand target_blankgiving thanks for the invisible handa syndicated columnist a relnoopener noreferrer hrefhttpwwwjeffjacobycom target_blankjeff jacobya offered a strongwonderful tribute to the miracle of the invisible handstrong that makes affordable turkeys available so efficiently every year at thanksgiving through the power of spontaneous order and without the need for any central planning or turkey czarsp
blockquote
pisnt there something wondrous something almost inexplicable in the way your thanksgiving weekend is made possible by the skill and labor of vast numbers of total strangersp
pto bring that turkey to the dining room table required the efforts of thousands of people the poultry farmers who raised the birds of course but also the feed distributors who supplied their nourishment and the truckers who brought it to the farm not to mention the architect who designed the hatchery the workmen who built it and the technicians who keep it running the bird had to be slaughtered and defeathered and inspected and transported and unloaded and wrapped and priced and displayed the people who accomplished those tasks were supported in turn by armies of other people accomplishing other tasks from refining the gasoline that fueled the trucks to manufacturing the plastic in which the meat was packagedp
pthe activities of countless farflung men and women over the course of many months had to be intricately choreographed and precisely timed so that when you showed up to buy a fresh thanksgiving turkey there would be one or more likely a few dozen waiting the level of coordination that was required to pull it off is mindboggling but what is even more mindboggling is this strongno one coordinated itstrongp
pno turkey czar sat in a command post somewhere consulting a master plan and issuing orders no one forced people to cooperate for your benefit and yet they did cooperate when you arrived at the supermarket your turkey was there you didnt have to do anything but show up to buy it if that isnt a miracle what should we call itp
padam smith called it the invisible hand the mysterious power that leads innumerable people each working for his own gain to promote ends that benefit many out of the seeming chaos of millions of uncoordinated private transactions emerges the spontaneous order of the market free human beings freely interact and the result is an array of goods and services more immense than the human mind can comprehend no dictator no bureaucracy no supercomputer plans it in advance indeed the more an economy emisem planned the more it is plagued by shortages dislocation and failurep
pit is commonplace to speak of seeing gods signature in the intricacy of a spiders web or the animation of a beehive but they pale in comparison to the kaleidoscopic energy and productivity of the free market if it is a blessing from heaven when seeds are transformed into grain how much more of a blessing is it when our private voluntary exchanges are transformed without our ever intending it into prosperity innovation and growthp
blockquote
pstrongbottom linestrong as you celebrate thanksgiving tomorrow with your family and friends remember to express some thanks and gratitude to the thousands of invisible strangers who wont be there in person but who were led by the invisible hand of the market over the last several months to become your thanksgiving benefactors and make sure your affordable holiday feast was possible once againp
pill end the post with a great related a relnoopener noreferrer hrefhttpwwwaeiorgpublicationquotationofthedayonthemagicofthemarketplace target_blankquote from president ronald reagana who said in 1981p
blockquote
pthe societies that have achieved the most spectacular broadbased progress are neither the most tightly controlled nor the biggest in size nor the wealthiest in natural resources no emwhat unites them all is their willingness to believe in the magic of the marketplaceemp
blockquote
pon thanksgiving day we should all remember to be thankful for the miracle and magic of the marketplace and the blessings of spontaneous order and the invisible hand that are directly responsible for the economic prosperity and abundance that we enjoy not just on a single holiday once a year but every day of the year living in a market economyp
pstrongrelatedstrong see recent strongcdstrong post a relnoopener noreferrer hrefhttpswwwaeiorgcarpediemdespiteconcernsaboutinflationtherealcostandtimecostofthanksgivingdinnerthisyearisamongthemostaffordableinhistory target_blankdespite concerns about inflation the real cost and time cost of thanksgiving dinner this year is among the most affordable in historya weve also heard numerous media reports recently about the most expensive thanksgiving dinner in history which are inaccurate misrepresentations of economic reality of course the cost of a thanksgiving dinner is almost always higher every year measured in nominal current dollars but to correctly measure the real cost of a turkey dinner over time is to adjust for inflation and compare the annual cost in constant inflation adjusted dollars or even better we should compute the cost of a thanksgiving dinner measured in the amount of time in hours the average american needs to work to earn enough income to pay for the menu items in a traditional turkey dinner by either measure the cost of a thanksgiving this year is among the most affordable in us history p
pembon appetitemp
p p
pthe post a relnofollow hrefhttpswwwaeiorgcarpediemgivingthanksforthemagicofthemarketplacetheinvisiblehandofstrangersandnoturkeyczars3giving thanks for the magic of the marketplace the invisible hand of strangers and no turkey czarsa appeared first on a relnofollow hrefhttpswwwaeiorgamerican enterprise institute aeiap | pa hrefhttpwwwaeiorgwpcontentuploads201911turkeyjpgx91208img alt width900 srchttpwwwaeiorgwpcontentuploads201911turkey1024x682jpgx91208 classwpimage1008547208 height599ap pthis thanksgiving post annual tradition strongcdstrong feature slightly revised version yearp plike previous years probably didnt local supermarket ahead time order thanksgiving turkey year automatically assumed turkey showed probably appeared unannounced local grocery store selected thanksgiving bird week got frozen butterball turkeys monday costco 099 pound bargainp pthe reason thanksgiving turkey like waiting advance order economic concepts spontaneous order selfinterest invisible hand free market turkeys appeared local grocery stores primarily selfinterest greed thousands turkey farmers truck drivers supermarket owners employees complete strangers family strangers turkey supply chain cooperated behalf led invisible hand sure family turkey table celebrate thanksgiving thursday invisible hand responsible holiday turkey millions everyday examples strongmiracle marketplacestrong strongindividually selfish decisions emmustem lead collectively efficient outcomesstrong economist relnoopener noreferrer hrefhttpwwwwalkerdpeoplecofcedureadingstradeiowacarcroppdf target_blanksteven e landsburg observedap pin 2003 boston globe article titled relnoopener noreferrer hrefhttpwwwjeffjacobycom8393givingthanksfortheinvisiblehand target_blankgiving thanks invisible handa syndicated columnist relnoopener noreferrer hrefhttpwwwjeffjacobycom target_blankjeff jacobya offered strongwonderful tribute miracle invisible handstrong makes affordable turkeys available efficiently year thanksgiving power spontaneous order need central planning turkey czarsp blockquote pisnt wondrous inexplicable way thanksgiving weekend possible skill labor vast numbers total strangersp pto bring turkey dining room table required efforts thousands people poultry farmers raised birds course feed distributors supplied nourishment truckers brought farm mention architect designed hatchery workmen built technicians running bird slaughtered defeathered inspected transported unloaded wrapped priced displayed people accomplished tasks supported turn armies people accomplishing tasks refining gasoline fueled trucks manufacturing plastic meat packagedp pthe activities countless farflung men women course months intricately choreographed precisely timed showed buy fresh thanksgiving turkey likely dozen waiting level coordination required pull mindboggling mindboggling strongno coordinated itstrongp pno turkey czar sat command post consulting master plan issuing orders forced people cooperate benefit cooperate arrived supermarket turkey didnt buy isnt miracle itp padam smith called invisible hand mysterious power leads innumerable people working gain promote ends benefit chaos millions uncoordinated private transactions emerges spontaneous order market free human beings freely interact result array goods services immense human mind comprehend dictator bureaucracy supercomputer plans advance economy emisem planned plagued shortages dislocation failurep pit commonplace speak seeing gods signature intricacy spiders web animation beehive pale comparison kaleidoscopic energy productivity free market blessing heaven seeds transformed grain blessing private voluntary exchanges transformed intending prosperity innovation growthp blockquote pstrongbottom linestrong celebrate thanksgiving tomorrow family friends remember express thanks gratitude thousands invisible strangers wont person led invisible hand market months thanksgiving benefactors sure affordable holiday feast possible againp pill end post great related relnoopener noreferrer hrefhttpwwwaeiorgpublicationquotationofthedayonthemagicofthemarketplace target_blankquote president ronald reagana said 1981p blockquote pthe societies achieved spectacular broadbased progress tightly controlled biggest size wealthiest natural resources emwhat unites willingness believe magic marketplaceemp blockquote pon thanksgiving day remember thankful miracle magic marketplace blessings spontaneous order invisible hand directly responsible economic prosperity abundance enjoy single holiday year day year living market economyp pstrongrelatedstrong recent strongcdstrong post relnoopener noreferrer hrefhttpswwwaeiorgcarpediemdespiteconcernsaboutinflationtherealcostandtimecostofthanksgivingdinnerthisyearisamongthemostaffordableinhistory target_blankdespite concerns inflation real cost time cost thanksgiving dinner year affordable historya weve heard numerous media reports recently expensive thanksgiving dinner history inaccurate misrepresentations economic reality course cost thanksgiving dinner higher year measured nominal current dollars correctly measure real cost turkey dinner time adjust inflation compare annual cost constant inflation adjusted dollars better compute cost thanksgiving dinner measured time hours average american needs work earn income pay menu items traditional turkey dinner measure cost thanksgiving year affordable history p pembon appetitemp p p pthe post relnofollow hrefhttpswwwaeiorgcarpediemgivingthanksforthemagicofthemarketplacetheinvisiblehandofstrangersandnoturkeyczars3giving thanks magic marketplace invisible hand strangers turkey czarsa appeared relnofollow hrefhttpswwwaeiorgamerican enterprise institute aeiap |
61a0103b5da8e816c4b36e90 | Paedophilia is not progressive | pnow that safe spaces and universal acceptance have become the norm it is fashionable to tolerate all kinds of proclivities and inclinations in the name of diversity but until recently we respected the nebulous line that faintly dissects the parameters of what we consider to be good and evil not so today where there is a growing campaign to destigmatise everything even if doing so requires us to unpick the moral fabric of our societyp
phow else are we to explain the two most disturbing causes trumpeted by modern progressives of paedophilia and of polygamy to some extent they cant be compared polygamy remains legal in a number of countries from south africa and malaysia to iran and morocco paedophilia on the other hand has long been considered beyond the pale and is effectively banned across the world most countries have an age of consent and those that dont such as sudan and afghanistan require a couple to be married before sex is legally allowedp
divdiv
pand yet in america of all places activists are now campaigning for the destigmatisation of paedophilic desires to remain horrified is bigoted we need to feel empathy for the suffering that paedophiles face what makes this movement even more disturbing is that its advocates are not confined to some progressive fringe even those whose jobs it is to emendem child sexual abuse now support itp
ponly last week elizabeth letourneau director of the moore center for the prevention of child sexual abuse at john hopkinss bloomberg school of public health a relnoopener hrefhttpstwittercomeletournstatus1462065950732304386 target_blanktweeteda many adults with sexual attraction to children want help to control it hate the feeling dont want to act on it helping them prevents childsexualabuse stigmatizing the conversation puts kids at risk preventionp
diva hrefhttpsunherdcom202111americaneducationneedsarevolutionrefinnara hrefhttpsunherdcom202111americaneducationneedsarevolutionrefinnarimg srchttpsunherdcomwpcontentuploads202111gettyimages133873985scalede16365673007841300x169jpgadiva hrefhttpsunherdcom202111americaneducationneedsarevolutionrefinnarspanmore from this authorspanaa hrefhttpsunherdcom202111americaneducationneedsarevolutionrefinnarh5american education needs a revolutionh5apa hrefhttpsunherdcom202111americaneducationneedsarevolutionrefinnarspanbyspan ayaan hirsi aliapdivadiv
pshe was responding to the debate sparked at old dominion university earlier this month after word spread around campus that one of its professors allyn walker had a relnoopener hrefhttpswwwucpressedubook9780520306363alongdarkshadow target_blankreleased a booka over the summer titled ema long dark shadow minorattracted people and their pursuit of dignityem the book according to its blurb offers a crucial account of the lived experiences of this hidden population in reality all it offers is a disconcerting defence of paedophiliap
pwalker whose preferred pronouns are theythem is concerned for the wellbeing of minorattracted people or maps the new preferred term for individuals attracted to children when asked about the use of maps in a a relnoopener hrefhttpswwwyoutubecomwatchvf1bax5uqevs target_blankrecent interviewa walker responded i think it is important to use terminology for groups that members of that group want others to use for them it is less stigmatising than other words like paedophile in other words lets not hurt the paedophiles feelingsp
pthroughout the interview walker deploys terms taken straight from the social justice playbook as if paedophilia were just another sexual preference in need of its own pride activists talk of lowering stigma of a minority that is atrisk and universally maligned but for walker at least this is more than a fashionable cause walker genuinely believes that paedophiles are maligned as far back as 2017 in a phd thesis titled a relnoopener hrefhttpsacademicworkscunyeducgiviewcontentcgiarticle3317contextgc_etds target_blankemunderstanding resilience strategies among minorattracted individualsema walker argued that paedophiles should be permitted to view child pornography as a harm reduction technique providing easy access to a wide variety of engrossing and highquality child pornography could walker wrote serve as a substitute for involvement with actual victimsp
palthough ema long dark shadowem was published in june old dominion did not place walker on leave until november 16supthsup after students began to protest a a relnoopener hrefhttpswwwchangeorgpolddominionuniversityfacultystaffandstudentsremovedrallynwalkermapspedophiliaactivistfromolddominionuniversitystaff target_blankpetitiona was launched making clear that paedophilia should not be considered a sexual preference and walker should be fired it has received more than 14000 signaturesp
pyet despite such overwhelming condemnation from the student body the a relnoopener hrefhttpsoduedunews202111old_dominion_universyzv7byb1n2 target_blankuniversitys statementa regarding the situation was short vague and inadequately critical of walkers views for walker however the universitys action a hrefhttpsthehillcomhomenewsstatewatch582139virginiaprofessorwhostudiedadultswhoaresexuallyattractedtoreflecteda the gravity of the threats to me and other people on campus walkers critics disapproval was part of a a relnoopener hrefhttpsthehillcomhomenewsstatewatch582139virginiaprofessorwhostudiedadultswhoaresexuallyattractedto target_blankcoordinated efforta against the lgbtq community and academic freedomp
pi am a firm defender of academic freedom and i believe the problem of paedophilia needs to be studied but that does not mean that we can ignore the danger destigmatising paedophilia poses to children we should not be normalising the idea that it is tolerable to fantasise about sex with children a university and a university press should not be pushing this kind of harmful materialp
diva hrefhttpsunherdcom202110progressivesareagifttoislamismrefinnara hrefhttpsunherdcom202110progressivesareagifttoislamismrefinnarimg srchttpsunherdcomwpcontentuploads202110gettyimages110507504scalede16354403259431300x172jpgadiva hrefhttpsunherdcom202110progressivesareagifttoislamismrefinnarspanmore from this authorspanaa hrefhttpsunherdcom202110progressivesareagifttoislamismrefinnarh5progressives are a gift to islamismh5apa hrefhttpsunherdcom202110progressivesareagifttoislamismrefinnarspanbyspan ayaan hirsi aliapdivadiv
pand yet this dangerous tendency to tolerate every and any proclivity no matter how wicked has become widespread along with paedophilia polygamy a practice which should have ended centuries ago is making a comeback as an acceptable form of relationship last year utah enacted a relnoopener hrefhttpsleutahgov2020billsstaticsb0102html target_blanksenate bill 102a which lowers the penalty for polygamy from a felony to an offence a relnoopener hrefhttpswwwnytimescom20200513usutahbigamylawhtml target_blankon par with a traffic summonsa as long as the new spouse consents to the marriage even pop culture is embracing the trend just this week millennial influencer a hrefhttpswwwinstagramcomtheskinnyconfidentialhlenlauryn bossticka posted her thoughts on polygamy to her 1 million instagram followers i am in to freedom of choice i dont waste my energy worried about what peoples relationship choices are everyones different if not hurting anyone amp it works for you go for itp
pbut polygamy emis emharmful to women in particular but also to a relnoopener hrefhttpswwwpoliticocommagazinestory201507polygamynationalsecurityputin120234 target_blanksociety in generala earlier this year i interviewed dr a relnoopener hrefhttpsayaanhirsialicompodcastsdanseligson target_blankdan seligsona on my podcast about its harms and dangers he explained that polygamy actually breeds poverty in societies it turns the human female into a commodity destroys trust in society and produces unhappiness in families growing up in somalia i have seen this all firsthand my father had four wives not one of them was happy not one of them thought their union was empoweringp
pand yet proponents of polygamy in the us today model their movement on the successful and legitimate campaign for samesex marriage pretending it is a similar form of liberation two practising polygamists a relnoopener hrefhttpswwwnewyorkercommagazine20210322howpolyamoristsandpolygamistsarechallengingfamilynorms target_blanksummed up thisa tactic in a peculiarly supportive recent emnew yorkerem profile i wish people would be as accepting with us as we try to be of everyone elsep
phere is where the slippery slope becomes a terrifying cliff face ingeniously minorattracted people and polygamists are seeking the protection of the progressive umbrella they want recognition as maligned minorities who have been marginalised and overlooked by society they want the freedom to love whomever they want regardless of a persons age or number of other partners and it is working the social justice movement is heeding their callsp
pat the core of what we are seeing today is an assault on western civilisation in the west we have a general moral framework we share a broad understanding of right and wrong but our norms and values are under attack we have abdicated our responsibility to make moral judgements and evil has started to seep inp
diva hrefhttpsunherdcom202108whyischildmarriagelegalinthewestrefinnara hrefhttpsunherdcom202108whyischildmarriagelegalinthewestrefinnarimg srchttpsunherdcomwpcontentuploads202108gettyimages105073533scalede1628701134268300x169jpgadiva hrefhttpsunherdcom202108whyischildmarriagelegalinthewestrefinnarspanmore from this authorspanaa hrefhttpsunherdcom202108whyischildmarriagelegalinthewestrefinnarh5why is child marriage legal in the westh5apa hrefhttpsunherdcom202108whyischildmarriagelegalinthewestrefinnarspanbyspan ayaan hirsi aliapdivadiv
pthere will be some who claim that i am overreacting that those arguing in favour of destigmatising paedophilia and polygamy are small groups who live in the dark corners of twitter and will never have any real staying power but the first steps have been taken the path ahead is clear as activists like allyn walker insinuate themselves into the social justice fold the ranks of their warped campaigns will swellp
pi have been a vocal advocate for women children homosexuals apostates and religious minorities for the past two decades i believe in giving the voiceless a voice i have also been a freespeech fundamentalist but there must be a red line no matter the context there will never be anything progressive about paedophilia or polygamyp
a hrefhttpsunherdcom202111paedophiliaisnotprogressiveappcommentsview 38 commentsa | pnow safe spaces universal acceptance norm fashionable tolerate kinds proclivities inclinations diversity recently respected nebulous line faintly dissects parameters consider good evil today growing campaign destigmatise requires unpick moral fabric societyp phow explain disturbing causes trumpeted modern progressives paedophilia polygamy extent cant compared polygamy remains legal number countries south africa malaysia iran morocco paedophilia hand long considered pale effectively banned world countries age consent dont sudan afghanistan require couple married sex legally allowedp divdiv pand america places activists campaigning destigmatisation paedophilic desires remain horrified bigoted need feel empathy suffering paedophiles face makes movement disturbing advocates confined progressive fringe jobs emendem child sexual abuse support itp ponly week elizabeth letourneau director moore center prevention child sexual abuse john hopkinss bloomberg school public health relnoopener hrefhttpstwittercomeletournstatus1462065950732304386 target_blanktweeteda adults sexual attraction children want help control hate feeling dont want act helping prevents childsexualabuse stigmatizing conversation puts kids risk preventionp diva hrefhttpsunherdcom202111americaneducationneedsarevolutionrefinnara hrefhttpsunherdcom202111americaneducationneedsarevolutionrefinnarimg srchttpsunherdcomwpcontentuploads202111gettyimages133873985scalede16365673007841300x169jpgadiva hrefhttpsunherdcom202111americaneducationneedsarevolutionrefinnarspanmore authorspanaa hrefhttpsunherdcom202111americaneducationneedsarevolutionrefinnarh5american education needs revolutionh5apa hrefhttpsunherdcom202111americaneducationneedsarevolutionrefinnarspanbyspan ayaan hirsi aliapdivadiv pshe responding debate sparked old dominion university earlier month word spread campus professors allyn walker relnoopener hrefhttpswwwucpressedubook9780520306363alongdarkshadow target_blankreleased booka summer titled ema long dark shadow minorattracted people pursuit dignityem book according blurb offers crucial account lived experiences hidden population reality offers disconcerting defence paedophiliap pwalker preferred pronouns theythem concerned wellbeing minorattracted people maps new preferred term individuals attracted children asked use maps relnoopener hrefhttpswwwyoutubecomwatchvf1bax5uqevs target_blankrecent interviewa walker responded think important use terminology groups members group want use stigmatising words like paedophile words lets hurt paedophiles feelingsp pthroughout interview walker deploys terms taken straight social justice playbook paedophilia sexual preference need pride activists talk lowering stigma minority atrisk universally maligned walker fashionable cause walker genuinely believes paedophiles maligned far 2017 phd thesis titled relnoopener hrefhttpsacademicworkscunyeducgiviewcontentcgiarticle3317contextgc_etds target_blankemunderstanding resilience strategies minorattracted individualsema walker argued paedophiles permitted view child pornography harm reduction technique providing easy access wide variety engrossing highquality child pornography walker wrote serve substitute involvement actual victimsp palthough ema long dark shadowem published june old dominion place walker leave november 16supthsup students began protest relnoopener hrefhttpswwwchangeorgpolddominionuniversityfacultystaffandstudentsremovedrallynwalkermapspedophiliaactivistfromolddominionuniversitystaff target_blankpetitiona launched making clear paedophilia considered sexual preference walker fired received 14000 signaturesp pyet despite overwhelming condemnation student body relnoopener hrefhttpsoduedunews202111old_dominion_universyzv7byb1n2 target_blankuniversitys statementa situation short vague inadequately critical walkers views walker universitys action hrefhttpsthehillcomhomenewsstatewatch582139virginiaprofessorwhostudiedadultswhoaresexuallyattractedtoreflecteda gravity threats people campus walkers critics disapproval relnoopener hrefhttpsthehillcomhomenewsstatewatch582139virginiaprofessorwhostudiedadultswhoaresexuallyattractedto target_blankcoordinated efforta lgbtq community academic freedomp pi firm defender academic freedom believe problem paedophilia needs studied mean ignore danger destigmatising paedophilia poses children normalising idea tolerable fantasise sex children university university press pushing kind harmful materialp diva hrefhttpsunherdcom202110progressivesareagifttoislamismrefinnara hrefhttpsunherdcom202110progressivesareagifttoislamismrefinnarimg srchttpsunherdcomwpcontentuploads202110gettyimages110507504scalede16354403259431300x172jpgadiva hrefhttpsunherdcom202110progressivesareagifttoislamismrefinnarspanmore authorspanaa hrefhttpsunherdcom202110progressivesareagifttoislamismrefinnarh5progressives gift islamismh5apa hrefhttpsunherdcom202110progressivesareagifttoislamismrefinnarspanbyspan ayaan hirsi aliapdivadiv pand dangerous tendency tolerate proclivity matter wicked widespread paedophilia polygamy practice ended centuries ago making comeback acceptable form relationship year utah enacted relnoopener hrefhttpsleutahgov2020billsstaticsb0102html target_blanksenate bill 102a lowers penalty polygamy felony offence relnoopener hrefhttpswwwnytimescom20200513usutahbigamylawhtml target_blankon par traffic summonsa long new spouse consents marriage pop culture embracing trend week millennial influencer hrefhttpswwwinstagramcomtheskinnyconfidentialhlenlauryn bossticka posted thoughts polygamy 1 million instagram followers freedom choice dont waste energy worried peoples relationship choices everyones different hurting amp works itp pbut polygamy emis emharmful women particular relnoopener hrefhttpswwwpoliticocommagazinestory201507polygamynationalsecurityputin120234 target_blanksociety generala earlier year interviewed dr relnoopener hrefhttpsayaanhirsialicompodcastsdanseligson target_blankdan seligsona podcast harms dangers explained polygamy actually breeds poverty societies turns human female commodity destroys trust society produces unhappiness families growing somalia seen firsthand father wives happy thought union empoweringp pand proponents polygamy today model movement successful legitimate campaign samesex marriage pretending similar form liberation practising polygamists relnoopener hrefhttpswwwnewyorkercommagazine20210322howpolyamoristsandpolygamistsarechallengingfamilynorms target_blanksummed thisa tactic peculiarly supportive recent emnew yorkerem profile wish people accepting try elsep phere slippery slope terrifying cliff face ingeniously minorattracted people polygamists seeking protection progressive umbrella want recognition maligned minorities marginalised overlooked society want freedom love whomever want regardless persons age number partners working social justice movement heeding callsp pat core seeing today assault western civilisation west general moral framework share broad understanding right wrong norms values attack abdicated responsibility moral judgements evil started seep inp diva hrefhttpsunherdcom202108whyischildmarriagelegalinthewestrefinnara hrefhttpsunherdcom202108whyischildmarriagelegalinthewestrefinnarimg srchttpsunherdcomwpcontentuploads202108gettyimages105073533scalede1628701134268300x169jpgadiva hrefhttpsunherdcom202108whyischildmarriagelegalinthewestrefinnarspanmore authorspanaa hrefhttpsunherdcom202108whyischildmarriagelegalinthewestrefinnarh5why child marriage legal westh5apa hrefhttpsunherdcom202108whyischildmarriagelegalinthewestrefinnarspanbyspan ayaan hirsi aliapdivadiv pthere claim overreacting arguing favour destigmatising paedophilia polygamy small groups live dark corners twitter real staying power steps taken path ahead clear activists like allyn walker insinuate social justice fold ranks warped campaigns swellp pi vocal advocate women children homosexuals apostates religious minorities past decades believe giving voiceless voice freespeech fundamentalist red line matter context progressive paedophilia polygamyp hrefhttpsunherdcom202111paedophiliaisnotprogressiveappcommentsview 38 commentsa |
61a0103d5da8e816c4b36e92 | Does depression exist? | pits not as strange a question as it might sound does depression exist i dont mean to imply that those with depression should just pull themselves together of course depression emsymptomsem exist and are sometimes liferuining and of course those symptoms often overlap with each other which certainly implies that theres a common cause but is there a thing we can point to in someones brain or some identifiable part of their psychology thats called depressionp
pin their understandable desire to get on with trials that might help people who are suffering many researchers have sidestepped the question of what depression actually emisem instead theyve simply agreed on a definition and stuck to it the a relnoopener hrefhttpsenwikipediaorgwikibeck_depression_inventory target_blankbeck depression inventorya is a questionnaire routinely used to diagnose and define depression if youve ever spoken to your gp about feeling low you might have come across it its named after aaron beck one of the most important figures in the history of psychiatry who a relnoopener hrefhttpswwwtheguardiancomsociety2021nov03aaronbeckobituary target_blankdied aged 100a on november 1st this year he came up with 21 questions that cover guilt feelings of failure weight loss insomnia and suicidal thoughts among other common depressive complaintsp
divdiv
pthe problem is that the medical profession and psychiatry researchers might be relying a little too much on that list of symptoms indeed in an odd unintentional circular move they might have actually emturnedem lists of symptoms into the very definition of depression an a relnoopener hrefhttpsajppsychiatryonlineorgdoi101176appiajp201615121509 target_blankessaya by the eminent psychiatrist kenneth kendler argues that this is a fundamental mistake the number of boxes a patient ticks on the list of symptoms that get you a diagnosis isnt the same as depression nor is their beck depression inventory score even if psychiatrists and researchers often act like it is the inventory is very often used as the criterion for improvement in studies of treatment if you achieve a 50 drop in symptoms as measured on his questionnaire you count as having been positively affected by the treatment but these criteria are a decent index of emmanyem of the common symptoms not emallem of them we know anxiety commonly comes alongside depression kendler notes but its not on the standard a relnoopener hrefhttpswwwncbinlmnihgovbooksnbk519712tablech3t5 target_blankdiagnostic lista if we confuse the disease itself with a usefulbutlimited list of its manifestations well find it harder to truly understand patients experiencesp
psome researchers have gone a step further should we stop using the concept of depression entirely a relnoopener hrefhttpswwwncbinlmnihgovpmcarticlespmc4397113 target_blankone studya of thousands of depression patients found over 1000 unique combinations of symptoms that all still count as depression maybe its time argue a relnoopener hrefhttpsbmcmedicinebiomedcentralcomarticles101186s1291601503254 target_blanksomea to focus on understanding subtypes or even just specific symptoms rather than the monolithic entity of depression itselfp
diva hrefhttpsunherdcom202111whatschinagotagainstgamingrefinnara hrefhttpsunherdcom202111whatschinagotagainstgamingrefinnarimg srchttpsunherdcomwpcontentuploads2021112gettyimages1194779570scaled1300x185jpgadiva hrefhttpsunherdcom202111whatschinagotagainstgamingrefinnarspansuggested readingspanaa hrefhttpsunherdcom202111whatschinagotagainstgamingrefinnarh5is the who inventing diseasesh5apa hrefhttpsunherdcom202111whatschinagotagainstgamingrefinnarspanbyspan tom chiversapdivadiv
pin some senses and perhaps ironically this accords with becks philosophy he was known for being sceptical of focusing on the ultimate root causes of mental illness which brings us to the other major contribution for which he is remembered cognitive behavioural therapy beginning in the 1960s beck a relnoopener hrefhttpswwwnytimescom20211101healthdraarontbeckdeadhtml target_blankreacted againsta the most popular form of therapy at the time which was based on freuds a relnoopener hrefhttpsunherdcom202110psychoanalysisdoesntwork target_blankpsychoanalytic theoriesa of the mind beck who himself was originally trained to administer psychoanalytic therapy began to doubt that depression symptoms were always caused by childhood traumas and unconscious repression some of the freudian theories emwereem rather farfetched as tony soprano says to his psychoanalytic therapist after she suggests for the umpteenth time that he might be harbouring some oedipal desires i dont wanna fuck my mother i dont give a shit what you say youre never gonna convince mep
pinstead beck suggested a much more proximal reason for the disorder depression patients and those with other disorders are suffering from thought distortions for example they might emcatastrophiseem blowing minor unfortunate occurrences in life out of all proportion they might emovergeneraliseem thinking that a fallout with one friend means that theyre hated by everyone they know as well as focusing his depression inventory on these kinds of thought patterns beck argued that therapy should target them and train patients out of them rather than looking for some underlying explanation for all their symptomsp
pbeck won the argument although psychodynamic therapy still exists cbt has now become the most popular and by far the most studied type of psychotherapy a relnoopener hrefhttpswwwtheguardiancomsociety2021nov23nhstogivetherapyfordepressionbeforemedicationundernewguidelines target_blanknew nhs guidelines announced this weeka recommend group cbt rather than antidepressants as the first line of treatment for mild depression but even before then it was among the first ports of call its application goes well beyond depression the language of cbt with all its ideas about catastrophising and perfectionism and selfblame is now as scott alexander has memorably argued a relnoopener hrefhttpsslatestarcodexcom20150716cbtinthewatersupply target_blankin the water supplya but popular and culturally influential doesnt necessarily mean good what do the studies say about whether it worksp
diva hrefhttpsunherdcom202110psychoanalysisdoesntworkrefinnara hrefhttpsunherdcom202110psychoanalysisdoesntworkrefinnarimg srchttpsunherdcomwpcontentuploads2021102screenshot20211017at61444pm300x228jpgadiva hrefhttpsunherdcom202110psychoanalysisdoesntworkrefinnarspansuggested readingspanaa hrefhttpsunherdcom202110psychoanalysisdoesntworkrefinnarh5psychoanalysis doesnt workh5apa hrefhttpsunherdcom202110psychoanalysisdoesntworkrefinnarspanbyspan tomiwa owoladeapdivadiv
pdespite the sheer volume of research the evidence is actually quite poor the a relnoopener hrefhttpsonlinelibrarywileycomdoifull101002wps20860 target_blankmetaanalysesa reviews of all the studies that have looked at a particular question do conclude that cbt works compared to doing nothing a common control group to which the therapy is compared is made up of people who are on a waiting list for treatment but its worth remembering that positive studies are more likely to be published than ones concluding that the experiment in question doesnt work and the overall literature on psychotherapy does a relnoopener hrefhttpswwwcambridgeorgcoreservicesaopcambridgecorecontentview71d73cade32c0d3d996dabea3fcdbf57s0033291718001873apdfcumulative_effect_of_reporting_and_citation_biases_on_the_apparent_efficacy_of_treatments_the_case_of_depressionpdf target_blankshow signsa of this kind of biasp
pso even if the studies are right that cbt is beneficial and in my view they most likely are the emextentem of the benefit might be somewhat exaggerated those a relnoopener hrefhttpsonlinelibrarywileycomdoifull101002wps20860 target_blankmetaanalysesa compare cbt to other common forms of psychotherapy including the psychoanalytic kind these days usually called psychodynamic therapy the general picture is this the effects of cbt are essentially the same as any other kind of psychotherapy they all reduce depression symptoms and they all still seem to work up to a year later this particular kind of metaanalysis has to assume all the trials are comparable though and thats often quite a big assumptionp
pits a very similar story for drugs the metaanalyses show that a relnoopener hrefhttpspubmedncbinlmnihgov29477251 target_blankessentially alla forms of antidepressant work better than placebo but these effects are likely a bit overblown by all the dodgy practices in the scientific literature and the evidence for one antidepressant being substantially better than another is to use the kind of language one often sees in the review studies limited which means researchers only have the vaguest cluep
diva hrefhttpsunherdcom202108nevertrustascientistrefinnara hrefhttpsunherdcom202108nevertrustascientistrefinnarimg srchttpsunherdcomwpcontentuploads202108gettyimajges541801716e16299095969111300x161jpgadiva hrefhttpsunherdcom202108nevertrustascientistrefinnarspanmore from this authorspanaa hrefhttpsunherdcom202108nevertrustascientistrefinnarh5never trust a scientisth5apa hrefhttpsunherdcom202108nevertrustascientistrefinnarspanbyspan stuart ritchieapdivadiv
palthough this is good news in one sense its worrying even depressing in another there is evidently a gaping hole in our evidence base on treating depression if essentially all the major therapy types work to the same degree despite being based on entirely different often opposing principles its pretty difficult to pin down exactly emwhyem they work what exactly are the therapists doing in their sessions that makes the treatment effective can we really say that beck was correct about cbt being the best treatment if other forms of therapy which take an entirely different approach can do the same jobp
pmaybe it doesnt matter whether therapists stick to becks plausible cognitive theories or freuds absurd psychosexual ones maybe just having a regular interaction with a smart sympathetic wellorganised person who focuses on your problems is what helps that wouldnt explain though why the analyses showed that some forms of selfdirected therapy can also make a difference either way all this begs the question how can we make our therapies better if we dont know the active ingredients but then how can we establish the active ingredients if we dont even know what were treatingp
p p
pemyou can call samaritans for free on 116 123 email them at a relnoopener noreferrer hrefmailtojosamaritansorg datastringifylinkmailtojosamaritansorg target_blank datasktooltip_parentjosamaritansorga or visit a relnoopener noreferrer hrefhttpwwwsamaritansorg datastringifylinkhttpwwwsamaritansorg target_blank datasktooltip_parentwwwsamaritansorga to find your nearest branchemp
a hrefhttpsunherdcom202111doesdepressionexistappcommentsview 5 commentsa | pits strange question sound depression exist dont mean imply depression pull course depression emsymptomsem exist liferuining course symptoms overlap certainly implies theres common cause thing point someones brain identifiable psychology thats called depressionp pin understandable desire trials help people suffering researchers sidestepped question depression actually emisem instead theyve simply agreed definition stuck relnoopener hrefhttpsenwikipediaorgwikibeck_depression_inventory target_blankbeck depression inventorya questionnaire routinely diagnose define depression youve spoken gp feeling low come named aaron beck important figures history psychiatry relnoopener hrefhttpswwwtheguardiancomsociety2021nov03aaronbeckobituary target_blankdied aged 100a november 1st year came 21 questions cover guilt feelings failure weight loss insomnia suicidal thoughts common depressive complaintsp divdiv pthe problem medical profession psychiatry researchers relying little list symptoms odd unintentional circular actually emturnedem lists symptoms definition depression relnoopener hrefhttpsajppsychiatryonlineorgdoi101176appiajp201615121509 target_blankessaya eminent psychiatrist kenneth kendler argues fundamental mistake number boxes patient ticks list symptoms diagnosis isnt depression beck depression inventory score psychiatrists researchers act like inventory criterion improvement studies treatment achieve 50 drop symptoms measured questionnaire count having positively affected treatment criteria decent index emmanyem common symptoms emallem know anxiety commonly comes alongside depression kendler notes standard relnoopener hrefhttpswwwncbinlmnihgovbooksnbk519712tablech3t5 target_blankdiagnostic lista confuse disease usefulbutlimited list manifestations find harder truly understand patients experiencesp psome researchers gone step stop concept depression entirely relnoopener hrefhttpswwwncbinlmnihgovpmcarticlespmc4397113 target_blankone studya thousands depression patients found 1000 unique combinations symptoms count depression maybe time argue relnoopener hrefhttpsbmcmedicinebiomedcentralcomarticles101186s1291601503254 target_blanksomea focus understanding subtypes specific symptoms monolithic entity depression itselfp diva hrefhttpsunherdcom202111whatschinagotagainstgamingrefinnara hrefhttpsunherdcom202111whatschinagotagainstgamingrefinnarimg srchttpsunherdcomwpcontentuploads2021112gettyimages1194779570scaled1300x185jpgadiva hrefhttpsunherdcom202111whatschinagotagainstgamingrefinnarspansuggested readingspanaa hrefhttpsunherdcom202111whatschinagotagainstgamingrefinnarh5is inventing diseasesh5apa hrefhttpsunherdcom202111whatschinagotagainstgamingrefinnarspanbyspan tom chiversapdivadiv pin senses ironically accords becks philosophy known sceptical focusing ultimate root causes mental illness brings major contribution remembered cognitive behavioural therapy beginning 1960s beck relnoopener hrefhttpswwwnytimescom20211101healthdraarontbeckdeadhtml target_blankreacted againsta popular form therapy time based freuds relnoopener hrefhttpsunherdcom202110psychoanalysisdoesntwork target_blankpsychoanalytic theoriesa mind beck originally trained administer psychoanalytic therapy began doubt depression symptoms caused childhood traumas unconscious repression freudian theories emwereem farfetched tony soprano says psychoanalytic therapist suggests umpteenth time harbouring oedipal desires dont wanna fuck mother dont shit youre gonna convince mep pinstead beck suggested proximal reason disorder depression patients disorders suffering thought distortions example emcatastrophiseem blowing minor unfortunate occurrences life proportion emovergeneraliseem thinking fallout friend means theyre hated know focusing depression inventory kinds thought patterns beck argued therapy target train patients looking underlying explanation symptomsp pbeck won argument psychodynamic therapy exists cbt popular far studied type psychotherapy relnoopener hrefhttpswwwtheguardiancomsociety2021nov23nhstogivetherapyfordepressionbeforemedicationundernewguidelines target_blanknew nhs guidelines announced weeka recommend group cbt antidepressants line treatment mild depression ports application goes depression language cbt ideas catastrophising perfectionism selfblame scott alexander memorably argued relnoopener hrefhttpsslatestarcodexcom20150716cbtinthewatersupply target_blankin water supplya popular culturally influential doesnt necessarily mean good studies worksp diva hrefhttpsunherdcom202110psychoanalysisdoesntworkrefinnara hrefhttpsunherdcom202110psychoanalysisdoesntworkrefinnarimg srchttpsunherdcomwpcontentuploads2021102screenshot20211017at61444pm300x228jpgadiva hrefhttpsunherdcom202110psychoanalysisdoesntworkrefinnarspansuggested readingspanaa hrefhttpsunherdcom202110psychoanalysisdoesntworkrefinnarh5psychoanalysis doesnt workh5apa hrefhttpsunherdcom202110psychoanalysisdoesntworkrefinnarspanbyspan tomiwa owoladeapdivadiv pdespite sheer volume research evidence actually poor relnoopener hrefhttpsonlinelibrarywileycomdoifull101002wps20860 target_blankmetaanalysesa reviews studies looked particular question conclude cbt works compared common control group therapy compared people waiting list treatment worth remembering positive studies likely published ones concluding experiment question doesnt work overall literature psychotherapy relnoopener hrefhttpswwwcambridgeorgcoreservicesaopcambridgecorecontentview71d73cade32c0d3d996dabea3fcdbf57s0033291718001873apdfcumulative_effect_of_reporting_and_citation_biases_on_the_apparent_efficacy_of_treatments_the_case_of_depressionpdf target_blankshow signsa kind biasp pso studies right cbt beneficial view likely emextentem benefit somewhat exaggerated relnoopener hrefhttpsonlinelibrarywileycomdoifull101002wps20860 target_blankmetaanalysesa compare cbt common forms psychotherapy including psychoanalytic kind days usually called psychodynamic therapy general picture effects cbt essentially kind psychotherapy reduce depression symptoms work year later particular kind metaanalysis assume trials comparable thats big assumptionp pits similar story drugs metaanalyses relnoopener hrefhttpspubmedncbinlmnihgov29477251 target_blankessentially alla forms antidepressant work better placebo effects likely bit overblown dodgy practices scientific literature evidence antidepressant substantially better use kind language sees review studies limited means researchers vaguest cluep diva hrefhttpsunherdcom202108nevertrustascientistrefinnara hrefhttpsunherdcom202108nevertrustascientistrefinnarimg srchttpsunherdcomwpcontentuploads202108gettyimajges541801716e16299095969111300x161jpgadiva hrefhttpsunherdcom202108nevertrustascientistrefinnarspanmore authorspanaa hrefhttpsunherdcom202108nevertrustascientistrefinnarh5never trust scientisth5apa hrefhttpsunherdcom202108nevertrustascientistrefinnarspanbyspan stuart ritchieapdivadiv palthough good news sense worrying depressing evidently gaping hole evidence base treating depression essentially major therapy types work degree despite based entirely different opposing principles pretty difficult pin exactly emwhyem work exactly therapists sessions makes treatment effective beck correct cbt best treatment forms therapy entirely different approach jobp pmaybe doesnt matter therapists stick becks plausible cognitive theories freuds absurd psychosexual ones maybe having regular interaction smart sympathetic wellorganised person focuses problems helps wouldnt explain analyses showed forms selfdirected therapy difference way begs question therapies better dont know active ingredients establish active ingredients dont know treatingp pp pemyou samaritans free 116 123 email ata relnoopener noreferrer hrefmailtojosamaritansorg datastringifylinkmailtojosamaritansorg target_blank datasktooltip_parentjosamaritansorga visita relnoopener noreferrer hrefhttpwwwsamaritansorg datastringifylinkhttpwwwsamaritansorg target_blank datasktooltip_parentwwwsamaritansorgato find nearest branchemp hrefhttpsunherdcom202111doesdepressionexistappcommentsview 5 commentsa |
61a1604a00f863f8bf61def6 | Scapegoating the Private School Boy | img altscapegoating the private school boy srchttpss3amazonawscomprodstaticcontentquillettecom202111schoolboypngpppthe private school boy is an object of endless horror and fascination every few years the media outrage cycle will crest towards another scandala leaked video of a sexist chant allegations of sexual misconduct or orgiastic excessand the discourse machine will dissect the sexual mores of elite teenagers with a libidinal investment that speaks to its own lost youth a prurient moral panic is fomented by the likes of the emsydney morning heraldem which a hrefhttpswwwsmhcomaunationalsexschoolkidsandwhereitallgoeswrong20210312p57a48htmlreports in graphic detaila how young women are raped while comatose at parties they wake up naked sometimes with penises in their mouths or with their underpants soaked in blood after having been groped penetrated then discarded like a used condom private schools have a toxic masculinity problem we are reminded over rolling footage of gangly pixelated boys in uniform sickeningly unaware of their class privilegepfigurea hrefhttpswwwsmhcomaunationalsexschoolkidsandwhereitallgoeswrong20210312p57a48htmldivdivsex schoolkids and where it all goes wrongdivdivprivilege porn parentfree parties an alcoholfuelled climate in which being nice to girls is considered uncool a wave of sexual assault allegations involving students from some of our top private schools underlines the need to foster a healthier brand of manhood warning graphic contentdivdivimg altscapegoating the private school boy srchttpswwwsmhcomauappletouchiconssmhpngspanthe sydney morning heraldspanspandavid leser natassia chrysanthosspandivdivdivimg altscapegoating the private school boy srchttpsstaticffxioimageszoom_132442cmultiply_075542cratio_17777782cwidth_10592cx_02cy_54t_crop_customq_862cf_jpgt_smh_no_label_social_wml_textpt20sans_41_bold_italic20from202cg_south_west2cy_842cx_2882cco_rgb0a1633l_textpt20sans_41_bold20may202cg_south_west2cy_842cx_3752cco_rgb0a1633l_textabriltitlingboldttf_83202021202cg_south_west2cy_152cx_2742cco_rgb0a1633eb18ba990728bafd3e5f82002803244b43805009divafigurepin 2016 police investigated an a hrefhttpswwwtheagecomaunationalvictoriabrightongrammarexpelsstudentswhocreatedvileinstagramaccount20160720gq9oxjhtmlinstagram page created by studentsa of brighton grammar called young sluts in 2019 st kevins college in toorak a hrefhttpswwwtheguardiancomaustralianews2019oct22stkevinscollegeapologisesoverstudentssexistchantonmelbournetrammade international headlinesa after a viral video emerged of students chanting that they wished that all the ladies were holes in the road a few weeks ago james robinson a hrefhttpswwwdailymailcouknewsarticle10163323formerstkevinscollegestudentburnsblazercampuswakeaflstarjordangoeysarresthtmlphotographed his burning blazera in the middle of st kevins school oval in protest against the bubble where privileged men can rehearse oppression without consequences pfigurea hrefhttpswwwabcnetauradiomelbourneprogramsdrivejamesrobinsonstkevinsprotest13617316divdivst kevins exstudent says burning blazer protest symbolised regenerationdivdivjames robinson said the protest on his former schools grounds represented his hope a new kind of st kevins can rise from the ashesdivdivspanabc radiospanspanrafael epsteinspandivdivdivimg altscapegoating the private school boy srchttpswwwabcnetaucmrimage1361732016x9largejpgv2divafigurepwhat appears at first to be edgy and transgressive has all the trappings of a politically correct viral newsitemto be applauded shared and retweeted in the age of meme warfare in response to robinsons work many private school alumni came forward with their own stories of trauma and victimisation this is a telling indication of the internal expectations of the professional managerial classbe both hypercritical of the privilege from which you came and offer stories of triumph over the social inequalities you conquered as a means of legitimising your successes and failures this is a function of a hrefhttpswwwtabletmagcomsectionsartslettersarticlesmeritblakesmithwhat blake smith callsa the new woke meritocracy and its inner contradictionsppi am a private school graduate whose migrant parents worked in hazardous waste removal and on automobile assembly lines to afford the exorbitant school fees i harboured a great deal of animosity towards the private school boy for his bravado and selfassurance those of us who did not come from dynastic wealth felt as though we were observing australias liberal elites in order to carefully study and appropriate their cadence and intonations from that perspective the private school boy seemed to represent a kind of narcissism empar excellenceem as a teenager i wanted to be him go out with him and possess the capacity to publicly reject and humiliate him but with maddening nonchalance the private school boy appeared to already have everything he could possibly needhis desire functioned only in service to himself like a hermetically sealed circular selfobsession i felt psychically impoverished by my own lack of cultural capital in contrast to an archetype i had created from a composite image of real and imagined characteristics in my head im therefore sympathetic to james robinsons protest and confess that part of me felt a revengeofthenerdsstyle vindication when i first saw his photographs but then it occurred to me that those imagesand the responses they elicitedwere also a kind of competitive narcissism and psychic projectionppren girards theory of conflictual mimesis proposes that our desires arise from the desires of othersill have what hes having mimetic rivalry stems from an everexpanding locus of interpersonal conflict before reaching a feverpitch of chaotic selfexpression that threatens to destroy everything in its wake it is at this point that the violence of allagainstall within a community is transformed into the violence of allagainstone in the form of a surrogate victim who can be blamed for the communitys misfortune and ritualistically purged to restore social cohesion and harmony the history of humanity according to girard can be explained by the scapegoat mechanism and its ritualised reenactment in all forms of religion similarly according to peter turchin an overproduction of elites graduating from private schools and universities into a diminishing job market causes social unrest that threatens to destabilise the entire community and because we are unable to satisfactorily blame the complex mechanisms of neoliberalism the private school boy is our pornaddled homophobic misogynistic instantiation of the patriarchy and a convenient receptacle for our inchoate rage and frustration ppfreud observed his grandson playing a game in which he would repeatedly throw a cotton reel out of his cot he theorised that the baby with his limited agency enjoyed this game because it gave him a sense of mastery over his own situation and allowed him to playexact a kind of revenge over his own powerlessness the powerlessness we feel in the face of privateschool educated elites who run the country who own property portfolios from which we rent and who continue to consolidate their generational wealth can be ritualistically purged from time to time through mass outrage generated by the misbehaviour of the private school boy because he represents a miniaturised version of the shadowy cabal he will someday join he is neutered of any actual power and authority so he can safely be sacrificed now and then as a representative of capitalism or the patriarchy without rocking the boat or upsetting the prevailing order of thingsppthis is neither an attempt to dismiss the real pain and suffering experienced within the private system nor is it an apologia for private school boys because this is not about the private school boy it is about the stories we tell ourselves when attempting to legitimate our own power the reason robinsons photographs and the yearly investigative news reports fall short is because they pantomime protest and the pursuit of truth and justice while really just rehashing what has already been established as the status quo the mainstream media has lambasted the behaviour of the mythical private school boy for the past decade or soeither about a particular individual or about the culture of toxic masculinity in general and each time a scandal erupts it provides those within the private school orbit with an opportunity to portray themselves as exemplary symbols of perseverance and humanity while the principals and coordinators of these institutions grovel and promise to do betterppthe moral panic surrounding private school boys is a symptom of cultural impoverishment and our inability to think through what education is for and who it should serve the private school in turn has continually found ways to justify its own existence and if the current attitudes of the ruling elites are any indication the tide is turning towards nebulous forms of power that are difficult to detect let alone critique because they are hidden behind the emnoblesse obligeem of traditional land acknowledgments and antiracist sensitivity training its no secret that a private school education offers little more than an opportunity to develop the affectations of the rich so when the media class performs its annual horror show about the debauched activities of their sons and daughters they are really just helping to manufacture cosmetic reforms that will bring these institutions into line with the overton window of liberal tolerance and progressivism the goal of course is that the private school boy may continue to pursue a path of unbridled ambitionalbeit as a newly reeducated feminist allyppwith each new pr crisis comes a variation on the theme of how these boys are being institutionally groomed to believe that they will be tomorrows leader that they shall inherit the earth and that the women they accost are merely the spoils of a victory won by virtue of their birth they are alphamalesinwaiting and rampant misogyny and heteronormativity are baked into the systems crust this we are told is a conspiracy that requires urgent redress despite the fact that it is largely a reflection of their immediate material reality ppi respectfully counter that the opposite may also be true that the private school attempts to instil in its students a sense of outwardfacing tolerance and integritynot because they are virtues to be upheld in and of themselvesbut because they effectively couch our mercenary class interests behind a thin veneer of likability seen in this context the violent outbursts the sexual aggravations and the lewd comportment of the private school boy is not a function of his design it is simply the cognitive dissonance of a child who is told with a wink that yes he will inherit the earth but its best not to act like itp | img altscapegoating private school boy srchttpss3amazonawscomprodstaticcontentquillettecom202111schoolboypngpppthe private school boy object endless horror fascination years media outrage cycle crest scandala leaked video sexist chant allegations sexual misconduct orgiastic excessand discourse machine dissect sexual mores elite teenagers libidinal investment speaks lost youth prurient moral panic fomented likes emsydney morning heraldem hrefhttpswwwsmhcomaunationalsexschoolkidsandwhereitallgoeswrong20210312p57a48htmlreports graphic detaila young women raped comatose parties wake naked penises mouths underpants soaked blood having groped penetrated discarded like condom private schools toxic masculinity problem reminded rolling footage gangly pixelated boys uniform sickeningly unaware class privilegepfigurea hrefhttpswwwsmhcomaunationalsexschoolkidsandwhereitallgoeswrong20210312p57a48htmldivdivsex schoolkids goes wrongdivdivprivilege porn parentfree parties alcoholfuelled climate nice girls considered uncool wave sexual assault allegations involving students private schools underlines need foster healthier brand manhood warning graphic contentdivdivimg altscapegoating private school boy srchttpswwwsmhcomauappletouchiconssmhpngspanthe sydney morning heraldspanspandavid leser natassia chrysanthosspandivdivdivimg altscapegoating private school boy srchttpsstaticffxioimageszoom_132442cmultiply_075542cratio_17777782cwidth_10592cx_02cy_54t_crop_customq_862cf_jpgt_smh_no_label_social_wml_textpt20sans_41_bold_italic20from202cg_south_west2cy_842cx_2882cco_rgb0a1633l_textpt20sans_41_bold20may202cg_south_west2cy_842cx_3752cco_rgb0a1633l_textabriltitlingboldttf_83202021202cg_south_west2cy_152cx_2742cco_rgb0a1633eb18ba990728bafd3e5f82002803244b43805009divafigurepin 2016 police investigated hrefhttpswwwtheagecomaunationalvictoriabrightongrammarexpelsstudentswhocreatedvileinstagramaccount20160720gq9oxjhtmlinstagram page created studentsa brighton grammar called young sluts 2019 st kevins college toorak hrefhttpswwwtheguardiancomaustralianews2019oct22stkevinscollegeapologisesoverstudentssexistchantonmelbournetrammade international headlinesa viral video emerged students chanting wished ladies holes road weeks ago james robinson hrefhttpswwwdailymailcouknewsarticle10163323formerstkevinscollegestudentburnsblazercampuswakeaflstarjordangoeysarresthtmlphotographed burning blazera middle st kevins school oval protest bubble privileged men rehearse oppression consequences pfigurea hrefhttpswwwabcnetauradiomelbourneprogramsdrivejamesrobinsonstkevinsprotest13617316divdivst kevins exstudent says burning blazer protest symbolised regenerationdivdivjames robinson said protest schools grounds represented hope new kind st kevins rise ashesdivdivspanabc radiospanspanrafael epsteinspandivdivdivimg altscapegoating private school boy srchttpswwwabcnetaucmrimage1361732016x9largejpgv2divafigurepwhat appears edgy transgressive trappings politically correct viral newsitemto applauded shared retweeted age meme warfare response robinsons work private school alumni came forward stories trauma victimisation telling indication internal expectations professional managerial classbe hypercritical privilege came offer stories triumph social inequalities conquered means legitimising successes failures function hrefhttpswwwtabletmagcomsectionsartslettersarticlesmeritblakesmithwhat blake smith callsa new woke meritocracy inner contradictionsppi private school graduate migrant parents worked hazardous waste removal automobile assembly lines afford exorbitant school fees harboured great deal animosity private school boy bravado selfassurance come dynastic wealth felt observing australias liberal elites order carefully study appropriate cadence intonations perspective private school boy represent kind narcissism empar excellenceem teenager wanted possess capacity publicly reject humiliate maddening nonchalance private school boy appeared possibly needhis desire functioned service like hermetically sealed circular selfobsession felt psychically impoverished lack cultural capital contrast archetype created composite image real imagined characteristics head im sympathetic james robinsons protest confess felt revengeofthenerdsstyle vindication saw photographs occurred imagesand responses elicitedwere kind competitive narcissism psychic projectionppren girards theory conflictual mimesis proposes desires arise desires othersill hes having mimetic rivalry stems everexpanding locus interpersonal conflict reaching feverpitch chaotic selfexpression threatens destroy wake point violence allagainstall community transformed violence allagainstone form surrogate victim blamed communitys misfortune ritualistically purged restore social cohesion harmony history humanity according girard explained scapegoat mechanism ritualised reenactment forms religion similarly according peter turchin overproduction elites graduating private schools universities diminishing job market causes social unrest threatens destabilise entire community unable satisfactorily blame complex mechanisms neoliberalism private school boy pornaddled homophobic misogynistic instantiation patriarchy convenient receptacle inchoate rage frustration ppfreud observed grandson playing game repeatedly throw cotton reel cot theorised baby limited agency enjoyed game gave sense mastery situation allowed playexact kind revenge powerlessness powerlessness feel face privateschool educated elites run country property portfolios rent continue consolidate generational wealth ritualistically purged time time mass outrage generated misbehaviour private school boy represents miniaturised version shadowy cabal someday join neutered actual power authority safely sacrificed representative capitalism patriarchy rocking boat upsetting prevailing order thingsppthis attempt dismiss real pain suffering experienced private system apologia private school boys private school boy stories tell attempting legitimate power reason robinsons photographs yearly investigative news reports fall short pantomime protest pursuit truth justice rehashing established status quo mainstream media lambasted behaviour mythical private school boy past decade soeither particular individual culture toxic masculinity general time scandal erupts provides private school orbit opportunity portray exemplary symbols perseverance humanity principals coordinators institutions grovel promise betterppthe moral panic surrounding private school boys symptom cultural impoverishment inability think education serve private school turn continually found ways justify existence current attitudes ruling elites indication tide turning nebulous forms power difficult detect let critique hidden emnoblesse obligeem traditional land acknowledgments antiracist sensitivity training secret private school education offers little opportunity develop affectations rich media class performs annual horror debauched activities sons daughters helping manufacture cosmetic reforms bring institutions line overton window liberal tolerance progressivism goal course private school boy continue pursue path unbridled ambitionalbeit newly reeducated feminist allyppwith new pr crisis comes variation theme boys institutionally groomed believe tomorrows leader shall inherit earth women accost merely spoils victory won virtue birth alphamalesinwaiting rampant misogyny heteronormativity baked systems crust told conspiracy requires urgent redress despite fact largely reflection immediate material reality ppi respectfully counter opposite true private school attempts instil students sense outwardfacing tolerance integritynot virtues upheld themselvesbut effectively couch mercenary class interests thin veneer likability seen context violent outbursts sexual aggravations lewd comportment private school boy function design simply cognitive dissonance child told wink yes inherit earth best act like itp |
61a1608d00f863f8bf61df04 | India fact of the day | blockquotepindias most recent a relnoopener hrefhttprchiipsorgnfhsindexshtml target_blanknational family health surveya which is conducted every five years by the health ministry was released wednesday and showed the total fertility rate tfr across india dropping to 20 in 20192021 compared with 22 in 20152016 a country with a tfr of 21 known as the replacement rate would maintain a stable population over time a lower tfr means the population would decrease in the absence of other factors such as immigrationp
pin cities across india as in other countries women are opting for fewer children the urban fertility rate is 16pblockquote
pand the bias against baby girls is diminishing here is a relnoopener hrefhttpswwwwashingtonpostcomworld20211125indiabirthratereplacementpopulation target_blankthe full storya via naveenp
pthe post a relnofollow hrefhttpmarginalrevolutioncommarginalrevolution202111indiafactoftheday7htmlindia fact of the daya appeared first on a relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap | blockquotepindias recenta relnoopener hrefhttprchiipsorgnfhsindexshtml target_blanknational family health surveya conducted years health ministry released wednesday showed total fertility rate tfr india dropping 20 20192021 compared 22 20152016 country tfr 21 known replacement rate maintain stable population time lower tfr means population decrease absence factors immigrationp pin cities india countries women opting fewer children urban fertility rate 16pblockquote pand bias baby girls diminishing relnoopener hrefhttpswwwwashingtonpostcomworld20211125indiabirthratereplacementpopulation target_blankthe storya naveenp pthe post relnofollow hrefhttpmarginalrevolutioncommarginalrevolution202111indiafactoftheday7htmlindia fact daya appeared relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap |
61a1615b00f863f8bf61df18 | How we uncancelled Jordan Peterson | pthe post a relnofollow hrefhttpswwwspikedonlinecom20211126howweuncancelledjordanpetersonhow we uncancelled jordan petersona appeared first on a relnofollow hrefhttpswwwspikedonlinecomspikedap | pthe post relnofollow hrefhttpswwwspikedonlinecom20211126howweuncancelledjordanpetersonhow uncancelled jordan petersona appeared relnofollow hrefhttpswwwspikedonlinecomspikedap |
61a1618000f863f8bf61df1a | The Covid pandemic is not taking the very best of turns | pthis was emailed to me but i am not doing a double indentin any case i fear the person might be rightp
pthe prevailing sentiment is that the covid pandemic is close to over the vaccines are of course miraculous but we are inoti currently on a good trajectoryp
ul
liit is a hrefhttpstwittercomerictopolstatus1446262783910158336increasingly cleara that two shots plus a booster of our current vaccines are the least one needs to have effective mediumterm protection almost nowhere least of all the us is on track to reach this kind of coverage the messaging in the us remains mistaken where the cdc to this day a hrefhttpswwwcdcgovcoronavirus2019ncovvaccinesboostershothtmlrecommendsa boosters only for those aged 50 and older more broadly the institutional a hrefhttpstwittercomerictopolstatus1441163583929290763confusiona around boosters shows that the adults are not yet in chargeli
lieven though delta arose in the spring we are still vaccinating and boosting people with the original wuhan strain this is insane and probably meaningfully less effective and yet nobody is up in arms about itli
lisevere outbreaks are manifestly possible even in exceptionally vaccinated populations especially when booster uptake is low see a hrefhttpstwittercomerictopolstatus1446851724078051335singaporea a hrefhttpstwittercomsusanastubbsstatus1461981784267276292gibraltara a hrefhttpstwittercomianmscstatus1462874136649158660irelanda one should assume that almost every part of the us will see significant waves before covid ends whatever that turns out to mean note that just 60 of the us population is vaccinated today with two dosesli
lithere is early suggestive a hrefhttpswwwmedrxivorgcontent1011012021100721264626v1fullpdfevidencea from israel that boosters may waneli
liwaning aside its clear that breakthrough infections in boosted individuals are not uncommon while the vast majority of those infections are not severe this does mean that there will still be plenty of mutagenesisli
liits a hrefhttpswwwmedrxivorgcontent1011012021110821266035v1uncleara that longitudinal crossimmunity is strong getting covid a hrefhttpsjamanetworkcomjournalsjamafullarticle2785919guestaccesskeyd6d49995b0f44849bcb51a486171137autm_sourcefor_the_mediautm_mediumreferralutm_campaignftm_linksutm_contenttflutm_term110121is not enougha to confer longterm protection we probably cant just get this over with even if we are willing to tolerate a large number of onetime deathsli
lithe currentlybreaking news about a relnoopener hrefhttpsmarginalrevolutioncommarginalrevolution202111nuavariantofrealconcernhtml target_blankthe south african nu straina shows that arguments about how the spike protein is running out of mutation search space are almost certainly wrongli
liwhile the fog of war is thick right now the early data on nu suggests that it may be a big deal even if its not however it has been obvious since we got the vaccines that vaccine escape is a concern you can debate whether the probability of a vaccine escaping variant is 20 or 80 but in any case we need effective contingency plans in place if we fail to respond effectively to nu that will be a considerably greater institutional failure than anything that happened at the outset of the pandemic weve had almost two years since the first covid case and one year from the vaccine approvals to prepare so i ask what is the plan for the vaccineescaping variantli
ul
pon current trends it looks like we will probably need one of two things to effectively end the pandemic 1 very effective covid therapeutics paxlovid molnupiravir and fluvoxamine all being candidates but my guess is that none is a silver bullet or 2 pancoronavirus vaccines with broader protection than what is currently availablep
pit isnt over yetp
pps has any us health body recommended the clinical use of fluvoxamine an alreadyapproved drug or has the fda given any guidance as to when it might approve paxlovid if not can they outline their reasoning 1600 americans died of covid on nov 24p
pthe post a relnofollow hrefhttpmarginalrevolutioncommarginalrevolution202111thecovidpandemicisnottakingtheverybestofturnshtmlthe covid pandemic is not taking the very best of turnsa appeared first on a relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap | pthis emailed double indentin case fear person rightp pthe prevailing sentiment covid pandemic close vaccines course miraculous inoti currently good trajectoryp ul liit hrefhttpstwittercomerictopolstatus1446262783910158336increasingly cleara shots plus booster current vaccines needs effective mediumterm protection track reach kind coverage messaging remains mistaken cdc day hrefhttpswwwcdcgovcoronavirus2019ncovvaccinesboostershothtmlrecommendsa boosters aged 50 older broadly institutional hrefhttpstwittercomerictopolstatus1441163583929290763confusiona boosters shows adults chargeli lieven delta arose spring vaccinating boosting people original wuhan strain insane probably meaningfully effective arms itli lisevere outbreaks manifestly possible exceptionally vaccinated populations especially booster uptake low hrefhttpstwittercomerictopolstatus1446851724078051335singaporea hrefhttpstwittercomsusanastubbsstatus1461981784267276292gibraltara hrefhttpstwittercomianmscstatus1462874136649158660irelanda assume significant waves covid ends turns mean note 60 population vaccinated today dosesli lithere early suggestive hrefhttpswwwmedrxivorgcontent1011012021100721264626v1fullpdfevidencea israel boosters waneli liwaning aside clear breakthrough infections boosted individuals uncommon vast majority infections severe mean plenty mutagenesisli liits hrefhttpswwwmedrxivorgcontent1011012021110821266035v1uncleara longitudinal crossimmunity strong getting covid hrefhttpsjamanetworkcomjournalsjamafullarticle2785919guestaccesskeyd6d49995b0f44849bcb51a486171137autm_sourcefor_the_mediautm_mediumreferralutm_campaignftm_linksutm_contenttflutm_term110121is enougha confer longterm protection probably cant willing tolerate large number onetime deathsli lithe currentlybreaking news relnoopener hrefhttpsmarginalrevolutioncommarginalrevolution202111nuavariantofrealconcernhtml target_blankthe south african nu straina shows arguments spike protein running mutation search space certainly wrongli liwhile fog war thick right early data nu suggests big deal obvious got vaccines vaccine escape concern debate probability vaccine escaping variant 20 80 case need effective contingency plans place fail respond effectively nu considerably greater institutional failure happened outset pandemic weve years covid case year vaccine approvals prepare ask plan vaccineescaping variantli ul pon current trends looks like probably need things effectively end pandemic 1 effective covid therapeutics paxlovid molnupiravir fluvoxamine candidates guess silver bullet 2 pancoronavirus vaccines broader protection currently availablep pit isnt yetp pps health body recommended clinical use fluvoxamine alreadyapproved drug fda given guidance approve paxlovid outline reasoning 1600 americans died covid nov 24p pthe post relnofollow hrefhttpmarginalrevolutioncommarginalrevolution202111thecovidpandemicisnottakingtheverybestofturnshtmlthe covid pandemic taking best turnsa appeared relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap |
61a161a200f863f8bf61df20 | Nu, a variant of real concern | phere is a relnoopener hrefhttpstwittercomerictopolstatus1463975943257481216 target_blankthe eric topol threada do read it here is a relnoopener hrefhttpstwittercomjburnmurdochstatus1463956686075580421 target_blankthe scary grapha based on preliminary data here is a relnoopener hrefhttpstwittercomjbloom_labstatus1464005676842184705 target_blankbloom laba here is a relnoopener hrefhttpswwwthetimescoukarticlethenucovidvariantwhyarescientistsconcerned3ngsctt0zutm_sourcetwitterutm_campaignnuutm_mediumbranded_social target_blanka laypersons take from the times of londonap
blockquote
pbwhen was the variant first discoveredbbr
south african authorities raised the alarm at 2pm on tuesday of this week when they found samples with a significant number of worrying mutationsp
pthe samples dated from tests taken on november 14 and 16 on wednesday even as scientists were analysing the genome other samples were found in botswana and china originating from travellers from south africap
pbwhy were scientists initially concerned by this variantbbr
the spike protein is the tool a virus uses to enter cells and the part of it our vaccines are trained to spot this variant had 32 mutations in the spike meaning it would look different to our immune system and behave differently when attacking a body as a virologist at imperialspan college put it it was a horrific spike profilespanp
pspanbwhy has worry increased over the course of the weekbbr
when geneticists and virologists looked at the mutations they realised there was a high likelihood they could increase its transmissibility or help it evade immunity but these concerns were still theoretical however today south african scientists spotted a quirk in the testing regimen pcr tests look for three genes in the a hrefhttpswwwthetimescoukarticlecoronavirus3g6vmvrptcoronavirusa and amplify them if however the virus was this variant they were only able to amplify twospanp
pin the province of gauteng where the proportion of tests coming back positive has rocketed to one in three they found the proportion in which only two genes were amplified has also rocketedp
pbwhat does this meanbbr
there are three options it is still possible though unlikely this is chance with the variants apparently increased spread relating to an unusual cluster if it does have a genuine advantage then it is either better able to spread or better able to infect people who have prior immunity either from vaccination or infection or it is bothp
blockquote
pthis might come to nothing but it is definitely a matter of concern one more general point is that even if nu is a nonevent it seems to show that the space for possible emsignificantem mutations is largely than we had thoughtp
pthe post a relnofollow hrefhttpmarginalrevolutioncommarginalrevolution202111nuavariantofrealconcernhtmlnu a variant of real concerna appeared first on a relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap | phere relnoopener hrefhttpstwittercomerictopolstatus1463975943257481216 target_blankthe eric topol threada read relnoopener hrefhttpstwittercomjburnmurdochstatus1463956686075580421 target_blankthe scary grapha based preliminary data relnoopener hrefhttpstwittercomjbloom_labstatus1464005676842184705 target_blankbloom laba relnoopener hrefhttpswwwthetimescoukarticlethenucovidvariantwhyarescientistsconcerned3ngsctt0zutm_sourcetwitterutm_campaignnuutm_mediumbranded_social target_blanka laypersons times londonap blockquote pbwhen variant discoveredbbr south african authorities raised alarm 2pm tuesday week found samples significant number worrying mutationsp pthe samples dated tests taken november 14 16 wednesday scientists analysing genome samples found botswana china originating travellers south africap pbwhy scientists initially concerned variantbbr spike protein tool virus uses enter cells vaccines trained spot variant 32 mutations spike meaning look different immune system behave differently attacking body virologist imperialspan college horrific spike profilespanp pspanbwhy worry increased course weekbbr geneticists virologists looked mutations realised high likelihood increase transmissibility help evade immunity concerns theoretical today south african scientists spotted quirk testing regimen pcr tests look genes hrefhttpswwwthetimescoukarticlecoronavirus3g6vmvrptcoronavirusa amplify virus variant able amplify twospanp pin province gauteng proportion tests coming positive rocketed found proportion genes amplified rocketedp pbwhat meanbbr options possible unlikely chance variants apparently increased spread relating unusual cluster genuine advantage better able spread better able infect people prior immunity vaccination infection bothp blockquote pthis come definitely matter concern general point nu nonevent space possible emsignificantem mutations largely thoughtp pthe post relnofollow hrefhttpmarginalrevolutioncommarginalrevolution202111nuavariantofrealconcernhtmlnu variant real concerna appeared relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap |
61a2b1f59b209e23967195a9 | Here’s What We Know About the COVID-19 Omicron Strain So Far | pyes a new variant has emerged on friday the who designated a fourth possibly more transmissible variant of concernb11529 or omicronafter a steep increase in covid19 infections in south africap
phealth officials have detected the variant in belgium britain botswana hong kong israel and the united kingdom as of friday there have been no cases of omicron detected in the united states according to the cdc but as a a hrefhttpswwwwhitehousegovbriefingroomstatementsreleases20211126statementbypresidentjoebidenontheomicroncovid19variantprecautionary measurea the biden administration joined several other nations in issuing new travel restrictions from south africa and seven other countries on saturday new york a hrefhttpsthehillcomhomenewsstatewatch583233nygovernordeclaresstateofemergencytoprepareforomicrondeclared a state of emergencya over the variant since the news of omicron broke the stock market has taken a a hrefhttpswwwwsjcomarticlesglobalstockmarketsdowupdate1126202111637901748modtrending_now_news_2notable hitap
pthe news is worrisome but as top infectious disease official dr anthony fauci and other scientists have cautioned theres plenty we dont know about omicronincluding if it spreads more readily if it causes a more severe covid infection or if our vaccines will continue to be effective against itp
pin the meantime here are a few things we emdoem know about itp
h3omicron has a large number of mutations and its spreading rapidly in south africah3
pas sarscov2 replicates it makes mistakes as i a hrefhttpswwwmotherjonescompolitics202102americaisignoringthecovidvariantsatitsownperilwrote earlier this yeara these mistakes are called mutations most of the time mutations dont help the virus but over many many replications in millions of hosts some mutations may give the virus a competitive edge over its predecessors it starts to compete with the standard strain john swartzberg a clinical professor emeritus specializing in infectious diseases and vaccinology at uc berkeleys school of public health a hrefhttpswwwmotherjonescompolitics202102americaisignoringthecovidvariantsatitsownperiltold mea and thats the one that would be of concern over many failures the virus can evolve into a more fit version of itselfp
pthat may be whats happened with omicron it has a lot of mutationsmore than 30 in the spike protein the emwashington postem a hrefhttpswwwwashingtonpostcomhealth20211126faqnewvariantomicronreportsa that is bad news because it could mean the virus is better at getting around our bodys defenses this is the most concerning variant weve seen since delta eric topol director of the scripps research translational institute told the emwashington postem on fridayp
pits unclear how exactly the mutations affect the virus but their existence and the rise in cases in south africawhere about a hrefhttpswwwwashingtonpostcomhealth20211126faqnewvariantomicron35 percenta of people are fully vaccinatedhave worried scientists we have seen a lot of variants pop up over the last five six months and most of them have not amounted to much this looks different ashish jha dean of the brown university school of public health a hrefhttpswwwcnncom20211126healthomicronvariantwhatweknowindexhtmltold cnna its acting differently it looks like its much more contagious than even the delta variant he added this one has become dominant very quickly in south africa in the regions where its been found within a matter of days to weeks as opposed to months now the number of cases in south africa is quite low so it can be for other reasons as well not just because its more transmissible but the speed with which it has taken off is really unlike anything weve seen beforep
h3you can expect to see data on omicron and the vaccines soonh3
paccording to jha the possibility that our vaccines will be rendered useless by omicron is low i think thats exceedingly unlikely he a hrefhttpswwwcnncom20211126healthomicronvariantwhatweknowindexhtmltold cnna the question is is there a tiny hit to vaccine efficacy or is there a large hit i think well get some preliminary data probably in the next few daysp
pfauci said it is unknown if people immunized against covid19 will be protected against omicron right now youre talking about sort of like a red flag that this might be an issue but we dont know fauci said in an interview with cnn once you test it youll know for sure whether or not it does or does not evade the antibodies that we makep
h3vaccine makers are working to test and develop vaccines against variants including omicronh3
pvaccine makers are on the omicron case the emwall street journal emreports germanys biontech se which developed one of the most commonly used covid19 vaccines with pfizerspan incspan said it would take about two weeks to establish whether the new variant renders its shot less effective p
pin the event that vaccineescape variant emerges pfizer and biontech expect to be able to develop and produce a tailormade vaccine against that variant in approximately 100 days subject to regulatory approval a pfizer spokesperson added a hrefhttpswwwwashingtonpostcomhealth20211126faqnewvariantomicronin a statementap
pmoderna a hrefhttpsinvestorsmodernatxcomnewsreleasesnewsreleasedetailsmodernaannouncesstrategyaddressomicronb11529sarscov2announceda on friday that it plans to rapidly advance an omicronspecific booster in addition to boosters for other variants of concern in the past the company said its taken 60 to 90 days to advance a vaccine candidate to clinical testingp | pyes new variant emerged friday designated fourth possibly transmissible variant concernb11529 omicronafter steep increase covid19 infections south africap phealth officials detected variant belgium britain botswana hong kong israel united kingdom friday cases omicron detected united states according cdc hrefhttpswwwwhitehousegovbriefingroomstatementsreleases20211126statementbypresidentjoebidenontheomicroncovid19variantprecautionary measurea biden administration joined nationsin issuing new travel restrictions south africa seven countries saturday new york hrefhttpsthehillcomhomenewsstatewatch583233nygovernordeclaresstateofemergencytoprepareforomicrondeclared state emergencya variant news omicron broke stock market taken hrefhttpswwwwsjcomarticlesglobalstockmarketsdowupdate1126202111637901748modtrending_now_news_2notable hitap pthe news worrisome infectious disease official dr anthony fauci scientists cautioned theres plenty dont know omicronincluding spreads readily causes severe covid infection vaccines continue effective itp pin meantime things emdoem know itp h3omicron large number mutations spreading rapidly south africah3 pas sarscov2 replicates makes mistakes hrefhttpswwwmotherjonescompolitics202102americaisignoringthecovidvariantsatitsownperilwrote earlier yeara mistakes called mutations time mutations dont help virus replications millions hosts mutations virus competitive edge predecessors starts compete standard strain john swartzberg clinical professor emeritus specializing infectious diseases vaccinology uc berkeleys school public health hrefhttpswwwmotherjonescompolitics202102americaisignoringthecovidvariantsatitsownperiltold mea thats concern failures virus evolve fit version itselfp pthat whats happened omicron lot mutationsmore 30 spike protein emwashington postem hrefhttpswwwwashingtonpostcomhealth20211126faqnewvariantomicronreportsathat bad news mean virus better getting bodys defensesthis concerning variant weve seen delta eric topol director scripps research translational institute told emwashington postem fridayp pits unclear exactly mutations affect virus existence rise cases south africawhere hrefhttpswwwwashingtonpostcomhealth20211126faqnewvariantomicron35 percenta people fully vaccinatedhave worried scientistswe seen lot variants pop months amounted looks different ashish jha dean brown university school public health hrefhttpswwwcnncom20211126healthomicronvariantwhatweknowindexhtmltold cnna acting differently looks like contagious delta variant added dominant quickly south africa regions found matter days weeks opposed months number cases south africa low reasons transmissible speed taken unlike weve seen beforep h3you expect data omicron vaccines soonh3 paccording jha possibility vaccines rendered useless omicron low think thats exceedingly unlikely hrefhttpswwwcnncom20211126healthomicronvariantwhatweknowindexhtmltold cnna question tiny hit vaccine efficacy large hit think preliminary data probably daysp pfauci said unknown people immunized covid19 protected omicron right youre talking sort like red flag issue dont know fauci said interview cnn test youll know sure evade antibodies makep h3vaccine makers working test develop vaccines variants including omicronh3 pvaccine makers omicron case emwall street journal emreports germanysbiontechse developed commonly covid19 vaccines withpfizerspanincspan said weeks establish new variant renders shot effectivep pin event vaccineescape variant emerges pfizer biontech expect able develop produce tailormade vaccine variant approximately 100 days subject regulatory approval pfizer spokesperson added hrefhttpswwwwashingtonpostcomhealth20211126faqnewvariantomicronin statementap pmoderna hrefhttpsinvestorsmodernatxcomnewsreleasesnewsreleasedetailsmodernaannouncesstrategyaddressomicronb11529sarscov2announceda friday plans rapidly advance omicronspecific booster addition boosters variants concern past company said taken 60 90 days advance vaccine candidate clinical testingp |
61a2b22c9b209e23967195b3 | Kyle Rittenhouse and the American identity crisis | pthere was no reason for the world ever to hear the name kyle rittenhouse except that in the summer of 2020 this country was staring over a precipice the covid lockdowns effectively ended after the killing of george floyd by a minnesotan policeman suddenly mass gatherings in the name of blm were a publichealth duty and because it was an election year neither democrats nor republicans seemed to know how to react to protests that soon degenerated into serious disorderp
pfor a country that is only one bad police interaction away from meltdown it was inevitable that something would happen again sure enough in august a man called jacob blake was shot by police in kenosha wisconsin there was a warrant out for blakes arrest and he was shot after fighting with police wielding a knife and having already been tasered though blake was not killed blm and other protest movements immediately had another martyr to hold up as evidence of systemic racism in america and once again the peaceful movements turned very violent indeed for two nights businesses were looted and burned to the ground fiery but mostly peaceful protests was how cnn captioned events as its correspondent reported from in front of the firesp
pthe police and national guard proved wholly ineffective at stopping this looting and rittenhouse whose father lives in kenosha decided with a friend that they should go out and try to protect local businesses they had spent part of the day cleaning graffiti off buildings and as the evening came in rittenhouse offered to help the owner of an as yet unburnedout car lot protect his business after being threatened and then chased by a mob seventeenyearold rittenhouse ended up shooting three men killing two of them and as with everything else in america the country promptly divided over whether kyle was a hero or a villainp
pthe countrys leftwing media immediately announced that rittenhouse was one of these fabled white supremacists we hear so much about but so little from and that he had deliberately targeted innocent blm protesters the same media said he had crossed state lines with his weapon meaning that media and politicians who have no problem with thousands of people illegally entering the nations southern border had to pretend to have serious concerns about people moving around inside the country there were other problems to get over one was that rittenhouses victims were all white and it would be an odd sort of white supremacist who went to kenosha to target white people the leftwing media also had to pretend that kenosha was at peace during the period in question and that there was no justification whatsoever for rittenhouse or anyone else to take on the role that law enforcement abandoned during that periodp
psupporters of rittenhouse had a couple of problems of their own one was that it was not clear why a seventeenyearold from antioch illinois needed to end up in kenosha shooting two men dead when details of the dead men came out there was better material to work with one of them was a convicted child rapist and neither of rittenhouses victims was in any way sympathetic in fact they were both manifestly violent including on the night in question and most likely insane still it is not as though rittenhouse knew that one of his victims was a convicted child rapistp
pfor two weeks the trial itself beamed from screens in bars and restaurants across the country it was clear from very early on that rittenhouse fired that night in selfdefense and in justified fear of his life the prosecution for their part wished to claim he was the cause of the fire rather than a firefighter as the jurys deliberations went on past their first day it seemed again as though the security of a nation rested on the shoulders of men and women trying to reach a verdict based on the evidence put before them and not on the fears of what might flow from that verdict there was talk of potential unrest if the verdict went the wrong way in fact the notguilty verdicts were both predictable for anyone watching the trial and clearly insufficient to start another bout of unrest in american citiesp
pfor america today is a country where the identities of people matter more than anything else if rittenhouse had shot three black men then his acquittal may have led to riots the british former paper known as the emindependentem got around this problem by claiming in an online headline that rittenhouse had shot three black men with rifle other media were happy to mislead their consumers in similar ways and in its way it is perfectp
div
a hrefhttpsspectatorworldcomsubscribethedcdiaryimg alt srchttpsspectatorworldcomwpcontentuploads202110emailnewslettermobpng classwpimage29949a div
pfor in such cases anybody can be whatever you want them to be convicted pedophiles armed with guns stalking around kenosha threatening to shoot people can be turned into peaceful protesters white men can be made black fires that burn on camera for all to see can be erased from the collective memory a thug can be turned into a martyr and a naive young man can be turned into a stormtrooper of white supremacyp
pas the rittenhouse case was going on i happened to take a brief swing through ferguson missouri ferguson was the scene of the shooting of michael brown in 2014 when blm protesters claimed brown had his hands in the air and shouted hands up dont shoot as he was shot it later transpired this was untrue brown had been robbing a store and lunged for the arresting officers gun when confronted but the lie went around the world and the crowds came out in ferguson the town they burned has stayed burned by the way with huge lots sitting like missing teeth in the areas the rioters moved through the american media and political activists move on but the places riddled by the lies they leave behind do notp
pemthis article was originally published in ema hrefhttpswwwspectatorcoukarticleafeastforgeeksthemakingofincarnationbytommccarthyreviewedthe spectatoraems uk magazine a hrefhttpsspectatorworldcomsubscribenowsubscribe to the world edition hereaemp
pthe post a relnofollow hrefhttpsspectatorworldcomtopickylerittenhouseamericanidentitycrisisblacklivesmatterkyle rittenhouse and the american identity crisisa appeared first on a relnofollow hrefhttpsspectatorworldcomthe spectator worldap | pthere reason world hear kyle rittenhouse summer 2020 country staring precipice covid lockdowns effectively ended killing george floyd minnesotan policeman suddenly mass gatherings blm publichealth duty election year democrats republicans know react protests soon degenerated disorderp pfor country bad police interaction away meltdown inevitable happen sure august man called jacob blake shot police kenosha wisconsin warrant blakes arrest shot fighting police wielding knife having tasered blake killed blm protest movements immediately martyr hold evidence systemic racism america peaceful movements turned violent nights businesses looted burned ground fiery peaceful protests cnn captioned events correspondent reported firesp pthe police national guard proved wholly ineffective stopping looting rittenhouse father lives kenosha decided friend try protect local businesses spent day cleaning graffiti buildings evening came rittenhouse offered help owner unburnedout car lot protect business threatened chased mob seventeenyearold rittenhouse ended shooting men killing america country promptly divided kyle hero villainp pthe countrys leftwing media immediately announced rittenhouse fabled white supremacists hear little deliberately targeted innocent blm protesters media said crossed state lines weapon meaning media politicians problem thousands people illegally entering nations southern border pretend concerns people moving inside country problems rittenhouses victims white odd sort white supremacist went kenosha target white people leftwing media pretend kenosha peace period question justification whatsoever rittenhouse role law enforcement abandoned periodp psupporters rittenhouse couple problems clear seventeenyearold antioch illinois needed end kenosha shooting men dead details dead men came better material work convicted child rapist rittenhouses victims way sympathetic fact manifestly violent including night question likely insane rittenhouse knew victims convicted child rapistp pfor weeks trial beamed screens bars restaurants country clear early rittenhouse fired night selfdefense justified fear life prosecution wished claim cause fire firefighter jurys deliberations went past day security nation rested shoulders men women trying reach verdict based evidence fears flow verdict talk potential unrest verdict went wrong way fact notguilty verdicts predictable watching trial clearly insufficient start bout unrest american citiesp pfor america today country identities people matter rittenhouse shot black men acquittal led riots british paper known emindependentem got problem claiming online headline rittenhouse shot black men rifle media happy mislead consumers similar ways way perfectp div hrefhttpsspectatorworldcomsubscribethedcdiaryimg alt srchttpsspectatorworldcomwpcontentuploads202110emailnewslettermobpng classwpimage29949a div pfor cases anybody want convicted pedophiles armed guns stalking kenosha threatening shoot people turned peaceful protesters white men black fires burn camera erased collective memory thug turned martyr naive young man turned stormtrooper white supremacyp pas rittenhouse case going happened brief swing ferguson missouri ferguson scene shooting michael brown 2014 blm protesters claimed brown hands air shouted hands dont shoot shot later transpired untrue brown robbing store lunged arresting officers gun confronted lie went world crowds came ferguson town burned stayed burned way huge lots sitting like missing teeth areas rioters moved american media political activists places riddled lies leave notp pemthis article originally published inema hrefhttpswwwspectatorcoukarticleafeastforgeeksthemakingofincarnationbytommccarthyreviewedthe spectatoraemsuk magazinea hrefhttpsspectatorworldcomsubscribenowsubscribe world edition hereaemp pthe post relnofollow hrefhttpsspectatorworldcomtopickylerittenhouseamericanidentitycrisisblacklivesmatterkyle rittenhouse american identity crisisa appeared relnofollow hrefhttpsspectatorworldcomthe spectator worldap |
61a2b2319b209e23967195b5 | Simple advice for watching and understanding on-line chess | pyes a relnoopener hrefhttpswwwchessbombcomarena2021fideworldchesschampionship02carlsen_magnusnepomniachtchi_ian target_blankthe computer evaluationsa are extremely useful but they are measuring the quality of the position emwhen two computers are playingem yet most of the games you care about tend to be two humans playing each other and those humans do not play like computers the computer might say the game is even and maybe it is with perfect play but one side can be much harder easier to play than the other so i suggest this trick go to a relnoopener hrefhttpanalysissessenet target_blankanalysissesseneta which covers top games only scan down the vertical list of all possible moves and consider the distribution of outcomes if the top move is great for white but all the others are not robustness is low especially if the top move for white is not superobvious such as recapturing a queen etc if all the sequences look very good for white black you will know that for humans the position probably is somewhat better for white than the single computer evaluation number will indicate robustness against human error will be presentp
pfor the carlsen match here is a relnoopener hrefhttpswwwtwitchtvchesslangde target_blanka good twitch streama currently with caruana as commentatorp
pthe post a relnofollow hrefhttpmarginalrevolutioncommarginalrevolution202111simpleadviceforwatchingandunderstandingonlinechesshtmlsimple advice for watching and understanding online chessa appeared first on a relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap | pyes relnoopener hrefhttpswwwchessbombcomarena2021fideworldchesschampionship02carlsen_magnusnepomniachtchi_ian target_blankthe computer evaluationsa extremely useful measuring quality position emwhen computers playingem games care tend humans playing humans play like computers computer game maybe perfect play harder easier play suggest trick relnoopener hrefhttpanalysissessenet target_blankanalysissesseneta covers games scan vertical list possible moves consider distribution outcomes great white robustness low especially white superobvious recapturing queen etc sequences look good white black know humans position probably somewhat better white single computer evaluation number indicate robustness human error presentp pfor carlsen match relnoopener hrefhttpswwwtwitchtvchesslangde target_blanka good twitch streama currently caruana commentatorp pthe post relnofollow hrefhttpmarginalrevolutioncommarginalrevolution202111simpleadviceforwatchingandunderstandingonlinechesshtmlsimple advice watching understanding online chessa appeared relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap |
61a2b2439b209e23967195b9 | Air Pollution Reduces Health and Wealth | pgreat piece by a hrefhttpslrbcoukthepaperv43n23davidwallacewellstenmillionayeardavid wallacewells on air pollutionap
blockquotephere is just a partial list of the things short of death rates we know are affected by air pollution spangdpspan with a 10 per cent increase in pollution reducing output by almost a full percentage point according to an spanoecdspan report last year cognitive performance with a study showing that cutting chinese pollution to the standards required in the spanusspan would improve the average students ranking in verbal tests by 26 per cent and in maths by 13 per cent in los angeles after 700 air purifiers were installed in schools student performance improved almost as much as it would if class sizes were reduced by a third heart disease is more common in polluted air as are many types of cancer and acute and chronic respiratory diseases like asthma and strokes the incidence of alzheimers can triple in emchokedem beth gardiner cites a study which found early markers of alzheimers in 40 per cent of autopsies conducted on those in highpollution areas and in none of those outside them rates of other sorts of dementia increase too as does parkinsons air pollution has also been linked to mental illness of all kinds with a recent paper in the embritish journal of psychiatryem showing that even small increases in local pollution raise the need for treatment by a third and for hospitalisation by a fifth and to worse memory attention and vocabulary as well as spanadhdspan and autism spectrum disorders pollution has been shown to damage the development of neurons in the brain and proximity to a coal plant can deform a babys spandnaspan in the womb it even accelerates the degeneration of the eyesightp
pa high pollution level in the year a baby is born has been shown to result in reduced earnings and labour force participation at the age of thirty the relationship of pollution to premature births and low birth weight is so strong that the introduction of the automatic toll system ezpass in american cities reduced both problems in areas close to toll plazas by 108 per cent and 118 per cent respectively by cutting down on the exhaust expelled when cars have to queue extremely premature births another study found were 80 per cent more likely when mothers lived in areas of heavy traffic women breathing exhaust fumes during pregnancy gave birth to children with higher rates of paediatric leukaemia kidney cancer eye tumours and malignancies in the ovaries and testes infant death rates increased in line with pollution levels as did heart malformations and those breathing dirtier air in childhood exhibited significantly higher rates of selfharm in adulthood with an increase of just five micrograms of small particulates a day associated in 14 million people in denmark with a 42 per cent rise in violence towards oneself depression in teenagers quadruples suicide becomes more common toop
pstock market returns are lower on days with higher air pollution a study found this year surgical outcomes are worse crime goes up with increased particulate concentrations especially violent crime a 10 per cent reduction in pollution researchers at colorado state university found could reduce the cost of crime in the spanusspan by 14 billion a year when theres more smog in the air chess players make more mistakes and bigger ones politicians speak more simplistically and baseball umpires make more bad callspblockquote
pas mr readers will know tyler and i have been saying a hrefhttpsmarginalrevolutioncomspollutionair pollution is an underrated problema for some time heres my video on the topicp
piframe allowfullscreentrue srchttpswwwyoutubecomembedjlhxytbsqzyversion3rel1showsearch0showinfo1iv_load_policy1fs1hlenusautohide2wmodetransparent width640 height360iframep
pthe post a relnofollow hrefhttpmarginalrevolutioncommarginalrevolution202111pollutionkillsandmorehtmlair pollution reduces health and wealtha appeared first on a relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap | pgreat piece hrefhttpslrbcoukthepaperv43n23davidwallacewellstenmillionayeardavid wallacewells air pollutionap blockquotephere partial list things short death rates know affected air pollutionspangdpspan 10 cent increase pollution reducing output percentage point according anspanoecdspanreport year cognitive performance study showing cutting chinese pollution standards required thespanusspanwould improve average students ranking verbal tests 26 cent maths 13 cent los angeles 700 air purifiers installed schools student performance improved class sizes reduced heart disease common polluted air types cancer acute chronic respiratory diseases like asthma strokes incidence alzheimers triple inemchokedem beth gardiner cites study found early markers alzheimers 40 cent autopsies conducted highpollution areas outside rates sorts dementia increase parkinsons air pollution linked mental illness kinds recent paper theembritish journal psychiatryemshowing small increases local pollution raise need treatment hospitalisation fifth worse memory attention vocabulary asspanadhdspanand autism spectrum disorders pollution shown damage development neurons brain proximity coal plant deform babysspandnaspanin womb accelerates degeneration eyesightp pa high pollution level year baby born shown result reduced earnings labour force participation age thirty relationship pollution premature births low birth weight strong introduction automatic toll system ezpass american cities reduced problems areas close toll plazas 108 cent 118 cent respectively cutting exhaust expelled cars queue extremely premature births study found 80 cent likely mothers lived areas heavy traffic women breathing exhaust fumes pregnancy gave birth children higher rates paediatric leukaemia kidney cancer eye tumours malignancies ovaries testes infant death rates increased line pollution levels heart malformations breathing dirtier air childhood exhibited significantly higher rates selfharm adulthood increase micrograms small particulates day associated 14 million people denmark 42 cent rise violence oneself depression teenagers quadruples suicide common toop pstock market returns lower days higher air pollution study found year surgical outcomes worse crime goes increased particulate concentrations especially violent crime 10 cent reduction pollution researchers colorado state university found reduce cost crime thespanusspanby 14 billion year theres smog air chess players mistakes bigger ones politicians speak simplistically baseball umpires bad callspblockquote pas mr readers know tyler saying hrefhttpsmarginalrevolutioncomspollutionair pollution underrated problema time heres video topicp piframe allowfullscreentrue srchttpswwwyoutubecomembedjlhxytbsqzyversion3rel1showsearch0showinfo1iv_load_policy1fs1hlenusautohide2wmodetransparent width640 height360iframep pthe post relnofollow hrefhttpmarginalrevolutioncommarginalrevolution202111pollutionkillsandmorehtmlair pollution reduces health wealtha appeared relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap |
61a2b2899b209e23967195bb | *Get Back*, I | peverything that gets done runs through paul as adam minter a relnoopener hrefhttpstwittercomadamminterstatus1464016940125417475 target_blankput ita excellent a relnoopener hrefhttpstwittercomadamminterstatus1464005650262814735 target_blankthreada more generallyp
blockquotepnothing would get done if paul werent there but its a fine line because hes irritating also ringo in my opinion has deep deep reservoirs of patience i dont know how he go through some of those dayspblockquote
pin this prepping for a no overdubs pure live performance setting the studio doesnt matter and control over studio production was how paul exerted an increasing authority over the beatles lets work on this more together de facto meant lets give me paul greater influence over the proceedings yet without his studio expertise as a williamsonian trump card paul has to be more of a pain in the ass to induce effort and focus from the othersp
pim scared of me being the boss and i kind of have been for a couple of years or something like that is what paul says emiem know its right and emyouem know its right comes shortly thereafter a relnoopener hrefhttpsmarginalrevolutioncommarginalrevolution202107straussianbeatlescofounderswecantworkitouthtml target_blankremember thisap
pwhatever it is that will please you i will do it responds george john in turn mutters something about maybe they should improvise the whole thingp
pgeorge martin is rendered irrelevant due to the studio production being omitted and mostly he stands around and looks like a guy who used to do ads for bad british cars in the 1960sp
ptwo highlights are paul singing a mock version of gimme some truth and john singing a mock version of maxwells silver hammer doesnt the film show it was actually george who broke up the beatles or a relnoopener hrefhttpswwwbeatlesbiblecom19680822ringostarrquitsthebeatles target_blankringo in 1968a doesnt the person who leaves first split up the relationshipp
pwhat is quiet yoko thinking the whole timep
pand from dave buechep
ul
liits surprising to see them digging around for material youd think they would have had a lineup of songs before they started the projectli
litwickenham [the studio] seems like a drag you can tell they dont love it either its big and cavernous and a few colored lights doesnt change thatli
litheres a certain sad nostalgia in them playing all the old standards they learned in germany and liverpool like they know this the end and theyre sort of reliving the beginning one last timeli
lipaul is clearly more invested than the others george seems like hes trying to just learn the songs do his bit same with ringo john seems like hes a good sport but other than dont let me down he seems to be going through the motionsli
liits fun seeing them cover dylan and other contemporariesli
ul
pthe reviews are all oh this shows the beatles loved working together until the very end thats a pretty superficial read of the material to me emget backem is much more about how the main value adders control small groups in a somewhat tyrannical and mostly efficient manner and why this isnt always stable mancur olson remains underratedp
pall things must pass just wasnt that good a song and it would have been worse as a beatles songp
phere is a relnoopener hrefhttpswwwtheguardiancomcommentisfree2021nov26getbackpastbeatlespresentfabfourcmpshare_iosapp_other target_blanka very good jonathan freedland reviewap
pthe post a relnofollow hrefhttpmarginalrevolutioncommarginalrevolution202111getbackihtmlget back ia appeared first on a relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap | peverything gets runs paul adam minter relnoopener hrefhttpstwittercomadamminterstatus1464016940125417475 target_blankput ita excellent relnoopener hrefhttpstwittercomadamminterstatus1464005650262814735 target_blankthreada generallyp blockquotepnothing paul werent fine line hes irritating ringo opinion deep deep reservoirs patience dont know dayspblockquote pin prepping overdubs pure live performance setting studio doesnt matter control studio production paul exerted increasing authority beatles lets work de facto meant lets paul greater influence proceedings studio expertise williamsonian trump card paul pain ass induce effort focus othersp pim scared boss kind couple years like paul says emiem know right emyouem know right comes shortly relnoopener hrefhttpsmarginalrevolutioncommarginalrevolution202107straussianbeatlescofounderswecantworkitouthtml target_blankremember thisap pwhatever responds george john turn mutters maybe improvise thingp pgeorge martin rendered irrelevant studio production omitted stands looks like guy ads bad british cars 1960sp ptwo highlights paul singing mock version gimme truth john singing mock version maxwells silver hammer doesnt film actually george broke beatles relnoopener hrefhttpswwwbeatlesbiblecom19680822ringostarrquitsthebeatles target_blankringo 1968a doesnt person leaves split relationshipp pwhat quiet yoko thinking timep pand dave buechep ul liits surprising digging material youd think lineup songs started projectli litwickenham [the studio] like drag tell dont love big cavernous colored lights doesnt change thatli litheres certain sad nostalgia playing old standards learned germany liverpool like know end theyre sort reliving beginningone timeli lipaul clearly invested george like hes trying learn songs bit ringo john like hes good sport dont let going motionsli liits fun seeing cover dylan contemporariesli ul pthe reviews oh shows beatles loved working end thats pretty superficial read material emget backem main value adders control small groups somewhat tyrannical efficient manner isnt stable mancur olson remains underratedp pall things pass wasnt good song worse beatles songp phere relnoopener hrefhttpswwwtheguardiancomcommentisfree2021nov26getbackpastbeatlespresentfabfourcmpshare_iosapp_other target_blanka good jonathan freedland reviewap pthe post relnofollow hrefhttpmarginalrevolutioncommarginalrevolution202111getbackihtmlget ia appeared relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap |
61a2b2ac9b209e23967195bf | The liberal case for gun ownership | pat the beginning of the pandemic i was out hunting for supplies running through scenarios and planning for contingencies i found myself at a local gun shop where a line of edgy patrons stretched out the door and down the block its not the kind of place my high school self would have imagined my middleaged self would frequent i am after all an american liberal and american liberals as a rule believe that our founders fresh from a war they won with muzzleloaded weapons left us in a terrible mess with respect to modern gunsp
pdecades ago i changed my position on the issue of gun control even though i still believe liberals are correct about the unfortunate predicament created by our founders i now hold that we must tolerate privately held guns and all that comes with them that may sound like a paradox but once you understand the tensions internal to the mind of an armed american liberal you will understand something fundamental about the american experimentp
divdiv
pportland where i live is an absurdly progressive city on the compulsively liberal pacific coast but that isnt the whole story washington oregon and california the three leftcoast states vote as a democratic block but thats not because we lack for conservatives we have lots of them they are just consistently outnumbered and outvotedp
pi should probably explain here that although i believe that liberals are right about the unacceptable cost of our second amendment rights conservatives are closer to correct as i see it about the governing of our cities a fact that becomes glaringly obvious if you visit los angeles seattle or san francisco and compare it to any major city in conservative texas american liberals dont seem to understand that their values cannot simply be implemented locally thats partly why im armed like a conservative despite my liberal values but i digressp
diva hrefhttpsunherdcom202111whyanarchyhascometoamericarefinnara hrefhttpsunherdcom202111whyanarchyhascometoamericarefinnarimg srchttpsunherdcomwpcontentuploads2021112gettyimages1236667539300x200jpgadiva hrefhttpsunherdcom202111whyanarchyhascometoamericarefinnarspansuggested readingspanaa hrefhttpsunherdcom202111whyanarchyhascometoamericarefinnarh5why anarchy has come to americah5apa hrefhttpsunherdcom202111whyanarchyhascometoamericarefinnarspanbyspan mary harringtonapdivadiv
pthat day at the gun shop most of the people i stood in line with were conservatives who felt like they could use a bit more firepower and i couldnt fault them so did i apparently i imagine they sized me up and read me as a liberal im pretty sure i look like one but i felt welcome or at least as welcome as one can in an environment where there is a run on guns and ammop
pand there was indeed a run as there always is when the population is on edge when americans worry they buy guns some of that is irrational as the guns they bought in previous panics are likely to last a good long time some of it is people arming themselves for the first time and some of it is intuitive the result of a somewhat vague reassessment of the level of needp
pthe gun shop was visibly strange in those early pandemic days it looked like it had been stripped the wall behind the counter that would normally display perhaps 100 different models of handgun had maybe 20 guns no one really wanted but would eventually be reluctantly purchased by some johnnycomelately but it was the state of the ammo that was most striking in the major calibers there wasnt any a pattern that everyone in the shop knew was repeated all over town and indeed across the entire country ammunition manufacturers couldnt keep up when a crate of ammo was occasionally delivered to the shop it was target ammo not ideal for selfdefence and it was rationed to one box per family per week welcome to americap
pin the gun shop no one was troubled by novices or even liberals explanations were patient its a surprisingly courteous agreeable and highly technical culture no one knows more than gun enthusiasts about the hazards that come with firearms and such people take a very dim view of those who treat guns casuallyp
pi suspect the notable courtesy was at least partly the natural result of the level of armament the staff were surely all armed so too i would guess were the clientele it is legal in oregon to have a concealed handgun given the proper easily obtained permit in such an environment heightened tensions are quickly noted and deescalation is an everpresent priority it is in some sense the opposite of twitter where no one is armed and people are routinely terrible to each otherp
pthere was one woman behind the counter who had the unenviable task of running background checks for every firearm purchased in most cases that meant she had to disappoint customers and tell them it would be days or weeks before they will be able to collect their weapons she had been ringing up and disappointing people nonstop emfor weeksem as i neared the front of the line i heard her say to the room i dont get it do they think theyre going to shoot a virusp
pits not the virus theyre worried about i offered its their neighbours if the food runs outp
pthere was a general murmur of agreement and i was glad to have brought something useful to the party but looking back i dont think my explanation was complete in fact im sure it wasntp
diva hrefhttpsunherdcom202111kylerittenhousecouldtearamericaapartrefinnara hrefhttpsunherdcom202111kylerittenhousecouldtearamericaapartrefinnarimg srchttpsunherdcomwpcontentuploads2021113gettyimages1236479492scalede1637581856311300x172jpgadiva hrefhttpsunherdcom202111kylerittenhousecouldtearamericaapartrefinnarspansuggested readingspanaa hrefhttpsunherdcom202111kylerittenhousecouldtearamericaapartrefinnarh5kyle rittenhouse could still tear america aparth5apa hrefhttpsunherdcom202111kylerittenhousecouldtearamericaapartrefinnarspanbyspan park macdougaldapdivadiv
pmost of those stocking up on guns and ammo belong to a culture and like every other culture it has its beliefs suppositions and fears that culture believes that tyranny may descend on us even here in the freedomloving united states of america and that privately held guns are the key to fending it off im not a member of this culture but i believe they may well be right about thisp
pin a country where politicians are increasingly prone to withdraw or standdown the police to curry favour with confused constituents it is easy to see how things can quickly escalate as they did in kenosha wisconsin the night kyle rittenhouse shot three men in selfdefence at a riot to be clear i do not believe rittenhouse then 17yearsold should have been there with his ar15 but i also dont believe the streets of american cities should ever be ceded to violent ideological bullies a now familiar pattern that set the stage for rittenhouses actionsp
pto understand why private guns may be decisive in a fight against tyranny lets take a moment to revisit what is assuredly the most inscrutable section of the united states constitution the second amendment a well regulated militia being necessary to the security of a free state the right of the people to keep and bear arms shall not be infringedp
pits almost like a deliberate nonsequitur in fact after decades of pondering the question im now fairly convinced that that is exactly what the founders gave us an intentionally vague pronouncement designed to force the question into the future to ensure it would be repeatedly reevaluated to keep up with changing weaponry and circumstances near as i can tell its a place holder for a principle they could not tailor in advancep
pthey clearly didnt want to give the legislature or the courts complete latitude they tied our hands our representatives are not allowed to disarm the public even if a majority desires it and the founders gave us a strong hint about why something about the need to protect a free state from you know stuff but they didnt tell us how much firepower citizens should be allowed to have and thank goodness they didnt because muzzleloaded weapons are no better a model of modern weapons than a movabletype printing press is for an algorithmically personalised infinite scrollp
pthe second amendment contains two conundrums one novel and one original the modern trouble is relatively straightforward what does it mean not to infringe on the right to bear arms in the 18supthsup century that was far simpler because although guns have always been a force multiplier for an individual the factor by which an individuals force was multiplied was so much lower back then within reason a person could be trusted to buy the guns they wanted to ownp
diva hrefhttpsunherdcom202104howanarchistscapturedportlandrefinnara hrefhttpsunherdcom202104howanarchistscapturedportlandrefinnarimg srchttpsunherdcomwpcontentuploads202104gettyimages12323540361300x200jpgadiva hrefhttpsunherdcom202104howanarchistscapturedportlandrefinnarspanmore from this authorspanaa hrefhttpsunherdcom202104howanarchistscapturedportlandrefinnarh5how anarchists captured portlandh5apa hrefhttpsunherdcom202104howanarchistscapturedportlandrefinnarspanbyspan bret weinsteinapdivadiv
pon first glance the original puzzle also seems uncomplicated the state is going to need a fighting force if it is to remain free but the longer one stares the stranger this pronouncement seems what militia regulations and state were they even referring to is it a reference to the army no the army already existed and could have been referenced if that was their intent having arisen first as the continental army that fought and won the revolution after it was formed in 1775 later to be refounded as the united states army in 1784 seven years prior to the 1791 ratification of the bill of rights with its wellregulated militia riddle embedded in its second amendment so if it wasnt the army protecting the free state they meant to invoke then it must really have been the people but against whom and what is a wellregulated militia and where is it going to come from and in what way is it to be regulated other than wellp
pas a young man i regarded the second amendment as the founders biggest blunder as we head into 2022 my position has flipped i now believe history may well come to regard it as the most farsighted thing the founders did not in spite of its vagueness but because of it its like a mysterious passage from a sacred text that forces living people to interpret it in a modern context the founders believed the people needed to be able to defend their free state with deadly force whether that refers to a geographical state or a state of being or bothp
pits not that i dont see the terrible carnage which comes from ubiquitous guns i do see it and i detest it just like every other decent american i know that a single deranged or careless person can rob us of anyone at any time no american is exempt not our families nor our leaders it is a terrifying realisation with modern weapons an individual can kill dozens it has happened many times and it will happen againp
pi find none of this remotely acceptable as a human or an american remember i said at the beginning that i believe that the emliberals are basically right about the staggering cost of ubiquitous gunsem further i dont believe the net effect of ubiquitous guns during an average year or decade or century is a reduction in harm its a complex picture but many western nations have managed crime as well or better than the us without the population being armed on long timescales however i suspect this trend reverses a nations descent into tyranny can kill millions and it can drag continents or the world as a whole into warp
pthe terrifying carnage that derives from the right to bear arms must in the end be compared to the cost of not having that right not only for the individual but for the republic and its neighbours at a minimum if you imagine that tyranny cannot happen in america due to some safeguard built into our system or by virtue of some immunity residing in the population itself then perhaps there is nothing left to discussp
diva hrefhttpsunherdcom202105thedayamericanjusticediedrefinnara hrefhttpsunherdcom202105thedayamericanjusticediedrefinnarimg srchttpsunherdcomwpcontentuploads202105gettyimages1215994935e16218067986431300x156jpgadiva hrefhttpsunherdcom202105thedayamericanjusticediedrefinnarspanmore from this authorspanaa hrefhttpsunherdcom202105thedayamericanjusticediedrefinnarh5the day american justice diedh5apa hrefhttpsunherdcom202105thedayamericanjusticediedrefinnarspanbyspan bret weinsteinapdivadiv
pfor my part i dont believe it in fact i believe i know better both as a scholar and as someone who was falsely accused of racism and hunted in my own neighbourhood with the police a relnoopener hrefhttpswwwyoutubecomwatchvfh2wewgcsmk target_blankwithdrawna in a foolish attempt to appease the mob and i suspect that if we put the question to a vote the fraction of the citizenry who believes tyranny could happen here is rising rapidly even if we dont necessarily agree on its most likely source of course the fact that tyranny may happen anywhere is not sufficient counterweight to the unacceptable cost of ubiquitous modern firearms to imagine that cost is outweighed one must also believe that an armed population is in a position to fend off tyrantsp
pthis i admit is by no means clear many will correctly point out that no matter how many semiautomatic weapons are in private hands it will never be a match for the firepower of the guns including fully automatic guns in the publicly funded arsenals that the argument goes are in danger of finding themselves at the disposal of tyrants when you add to that the incredible range of weapons and weaponsystems for which the public has no answer its a slam dunk in a headtohead conflict between a treasonous tyrantled us military on the one hand and freedomloving americans on the other the military would trounce any number of militias no matter how wellregulatedp
pbut that isnt really a persuasive argument for two reasons first who decided this would be a fair fight how many times will the us military have to find itself stalemated by inferior forces before we incorporate the lesson of asymmetric warfare into our national consciousnessp
pwhen our family lived in olympia washington we frequently saw foxes in our backyard we learned not to worry about our cats because the foxes seemed to simply ignore them here in portland we have coyotes instead of foxes and neighbourhood cats are constantly disappearing does this imply that a wild fox cant beat a housecat while a coyote can as a mammalogist im sure thats not it a fox would almost always win a fight to the death with a domestic cat but a house cat is capable of doing enough damage on the way out to dissuade anything but a desperate fox from trying it an armed populace might not be able to defeat a tyrants army but they could well punish it into retreatp
pthe second reason an armed population might succeed against the militarygonerogue is that it is exceedingly unlikely the ementireem military would accept immoral orders either they would divide over the question and the armed populace would end up fighting alongside the hopefully large portion of the military who remained loyal to the constitution and their fellow citizens or those who would naturally resist immoral orders would have been purged from the uniformed ranks under some pretext that discovers and discharges those with independent minds returning these noncompliant souls home to their wellarmed families and neighbourhoods either way private gun ownership might well prove decisive in a periodic contest between patriots and tyrantsp
pi expect this argument will prove unpopular are we really that near the brink of tyranny in america i dont know i think its plausible enough that it would be irresponsible not to discuss what might happenp
diva hrefhttpsunherdcom202111wouldamericasurviveacivilwarrefinnara hrefhttpsunherdcom202111wouldamericasurviveacivilwarrefinnarimg srchttpsunherdcomwpcontentuploads202111gettyimages6094814501scalede16366526132601300x169jpgadiva hrefhttpsunherdcom202111wouldamericasurviveacivilwarrefinnarspansuggested readingspanaa hrefhttpsunherdcom202111wouldamericasurviveacivilwarrefinnarh5would america survive a civil warh5apa hrefhttpsunherdcom202111wouldamericasurviveacivilwarrefinnarspanbyspan malcom kyeyuneapdivadiv
pi also think it is worth taking a brief look at australia to discern whether it has any lessons for us australia is after all a nation with many similarities to the us it had its own permissive gun ownership laws and culture until the 1996 massacre in port arthur tasmania in which 35 people were killed the alterations in australias gun laws and the gun buyback programme that followed are frequently held up as a possible a relnoopener hrefhttpswwwbbccouknewsworldaustralia35048251 target_blankmodela for american gun reform and they make a strong case that massacres and other gun violence can indeed be greatly reduced by such a programme but at what pricep
pi have to tell you im finding it very difficult to make full sense of events in australia at the moment i see things that a relnoopener hrefhttpstwittercomandrewlawtonstatus1463584468606894092s20 target_blanklooka a a relnoopener hrefhttpstwittercommaajidnawazstatus1463443901675712514s20 target_blanklota like a relnoopener hrefhttpstwittercom4patrick7status1461514103675965450s20 target_blanktyrannya reported from there i have friends people i know personally and trust fleeing australia due to what looks to them and sounds to me like tyranny and i have a relnoopener hrefhttpswwwyoutubecomwatchappdesktoplistpljq2gc5yheug8_vk8ve0odsjloiu4b93vqa0wzd0ipwfeatureyoutube target_blankintervieweda australians who describe absolutely tyrannical encounters they are having with governmental authoritiesp
pbut i also see respected people assuring me the picture we are getting is distorted whatever the truth as the ideals of the liberal west spread like wildfire during the 20supthsup century i fear we americans were lulled into a false sense of complacency as freedom caught on in region after region and appeared to become permanent i dont know if we will ever fully discern our founders intent with respect to the second amendment but i strongly suspect their understanding of freedom freshly won was much more realistic than oursp
pthis is what gun ownership comes down to whether youre a liberal or a conservative if there is a way to protect liberty from spasms of tyranny that does not condemn us to the spectacular cost of regular gun violence id love to know it but if the dynamism of the west the productivity the ingenuity and the quest for fairness can only be protected from tyrants at the point of a gun then so be itp
a hrefhttpsunherdcom202111theliberalcaseforgunownershipappcommentsview 85 commentsa | pat beginning pandemic hunting supplies running scenarios planning contingencies found local gun shop line edgy patrons stretched door block kind place high school self imagined middleaged self frequent american liberal american liberals rule believe founders fresh war won muzzleloaded weapons left terrible mess respect modern gunsp pdecades ago changed position issue gun control believe liberals correct unfortunate predicament created founders hold tolerate privately held guns comes sound like paradox understand tensions internal mind armed american liberal understand fundamental american experimentp divdiv pportland live absurdly progressive city compulsively liberal pacific coast isnt story washington oregon california leftcoast states vote democratic block thats lack conservatives lots consistently outnumbered outvotedp pi probably explain believe liberals right unacceptable cost second amendment rights conservatives closer correct governing cities fact glaringly obvious visit los angeles seattle san francisco compare major city conservative texas american liberals dont understand values simply implemented locally thats partly im armed like conservative despite liberal values digressp diva hrefhttpsunherdcom202111whyanarchyhascometoamericarefinnara hrefhttpsunherdcom202111whyanarchyhascometoamericarefinnarimg srchttpsunherdcomwpcontentuploads2021112gettyimages1236667539300x200jpgadiva hrefhttpsunherdcom202111whyanarchyhascometoamericarefinnarspansuggested readingspanaa hrefhttpsunherdcom202111whyanarchyhascometoamericarefinnarh5why anarchy come americah5apa hrefhttpsunherdcom202111whyanarchyhascometoamericarefinnarspanbyspan mary harringtonapdivadiv pthat day gun shop people stood line conservatives felt like use bit firepower couldnt fault apparently imagine sized read liberal im pretty sure look like felt welcome welcome environment run guns ammop pand run population edge americans worry buy guns irrational guns bought previous panics likely good long time people arming time intuitive result somewhat vague reassessment level needp pthe gun shop visibly strange early pandemic days looked like stripped wall counter normally display 100 different models handgun maybe 20 guns wanted eventually reluctantly purchased johnnycomelately state ammo striking major calibers wasnt pattern shop knew repeated town entire country ammunition manufacturers couldnt crate ammo occasionally delivered shop target ammo ideal selfdefence rationed box family week welcome americap pin gun shop troubled novices liberals explanations patient surprisingly courteous agreeable highly technical culture knows gun enthusiasts hazards come firearms people dim view treat guns casuallyp pi suspect notable courtesy partly natural result level armament staff surely armed guess clientele legal oregon concealed handgun given proper easily obtained permit environment heightened tensions quickly noted deescalation everpresent priority sense opposite twitter armed people routinely terrible otherp pthere woman counter unenviable task running background checks firearm purchased cases meant disappoint customers tell days weeks able collect weapons ringing disappointing people nonstop emfor weeksem neared line heard room dont think theyre going shoot virusp pits virus theyre worried offered neighbours food runs outp pthere general murmur agreement glad brought useful party looking dont think explanation complete fact im sure wasntp diva hrefhttpsunherdcom202111kylerittenhousecouldtearamericaapartrefinnara hrefhttpsunherdcom202111kylerittenhousecouldtearamericaapartrefinnarimg srchttpsunherdcomwpcontentuploads2021113gettyimages1236479492scalede1637581856311300x172jpgadiva hrefhttpsunherdcom202111kylerittenhousecouldtearamericaapartrefinnarspansuggested readingspanaa hrefhttpsunherdcom202111kylerittenhousecouldtearamericaapartrefinnarh5kyle rittenhouse tear america aparth5apa hrefhttpsunherdcom202111kylerittenhousecouldtearamericaapartrefinnarspanbyspan park macdougaldapdivadiv pmost stocking guns ammo belong culture like culture beliefs suppositions fears culture believes tyranny descend freedomloving united states america privately held guns key fending im member culture believe right thisp pin country politicians increasingly prone withdraw standdown police curry favour confused constituents easy things quickly escalate kenosha wisconsin night kyle rittenhouse shot men selfdefence riot clear believe rittenhouse 17yearsold ar15 dont believe streets american cities ceded violent ideological bullies familiar pattern set stage rittenhouses actionsp pto understand private guns decisive fight tyranny lets moment revisit assuredly inscrutable section united states constitution second amendment regulated militia necessary security free state right people bear arms shall infringedp pits like deliberate nonsequitur fact decades pondering question im fairly convinced exactly founders gave intentionally vague pronouncement designed force question future ensure repeatedly reevaluated changing weaponry circumstances near tell place holder principle tailor advancep pthey clearly didnt want legislature courts complete latitude tied hands representatives allowed disarm public majority desires founders gave strong hint need protect free state know stuff didnt tell firepower citizens allowed thank goodness didnt muzzleloaded weapons better model modern weapons movabletype printing press algorithmically personalised infinite scrollp pthe second amendment contains conundrums novel original modern trouble relatively straightforward mean infringe right bear arms 18supthsup century far simpler guns force multiplier individual factor individuals force multiplied lower reason person trusted buy guns wanted ownp diva hrefhttpsunherdcom202104howanarchistscapturedportlandrefinnara hrefhttpsunherdcom202104howanarchistscapturedportlandrefinnarimg srchttpsunherdcomwpcontentuploads202104gettyimages12323540361300x200jpgadiva hrefhttpsunherdcom202104howanarchistscapturedportlandrefinnarspanmore authorspanaa hrefhttpsunherdcom202104howanarchistscapturedportlandrefinnarh5how anarchists captured portlandh5apa hrefhttpsunherdcom202104howanarchistscapturedportlandrefinnarspanbyspan bret weinsteinapdivadiv pon glance original puzzle uncomplicated state going need fighting force remain free longer stares stranger pronouncement militia regulations state referring reference army army existed referenced intent having arisen continental army fought won revolution formed 1775 later refounded united states army 1784 seven years prior 1791 ratification bill rights wellregulated militia riddle embedded second amendment wasnt army protecting free state meant invoke people wellregulated militia going come way regulated wellp pas young man regarded second amendment founders biggest blunder head 2022 position flipped believe history come regard farsighted thing founders spite vagueness like mysterious passage sacred text forces living people interpret modern context founders believed people needed able defend free state deadly force refers geographical state state bothp pits dont terrible carnage comes ubiquitous guns detest like decent american know single deranged careless person rob time american exempt families leaders terrifying realisation modern weapons individual kill dozens happened times happen againp pi find remotely acceptable human american remember said beginning believe emliberals basically right staggering cost ubiquitous gunsem dont believe net effect ubiquitous guns average year decade century reduction harm complex picture western nations managed crime better population armed long timescales suspect trend reverses nations descent tyranny kill millions drag continents world warp pthe terrifying carnage derives right bear arms end compared cost having right individual republic neighbours minimum imagine tyranny happen america safeguard built system virtue immunity residing population left discussp diva hrefhttpsunherdcom202105thedayamericanjusticediedrefinnara hrefhttpsunherdcom202105thedayamericanjusticediedrefinnarimg srchttpsunherdcomwpcontentuploads202105gettyimages1215994935e16218067986431300x156jpgadiva hrefhttpsunherdcom202105thedayamericanjusticediedrefinnarspanmore authorspanaa hrefhttpsunherdcom202105thedayamericanjusticediedrefinnarh5the day american justice diedh5apa hrefhttpsunherdcom202105thedayamericanjusticediedrefinnarspanbyspan bret weinsteinapdivadiv pfor dont believe fact believe know better scholar falsely accused racism hunted neighbourhood police relnoopener hrefhttpswwwyoutubecomwatchvfh2wewgcsmk target_blankwithdrawna foolish attempt appease mob suspect question vote fraction citizenry believes tyranny happen rising rapidly dont necessarily agree likely source course fact tyranny happen sufficient counterweight unacceptable cost ubiquitous modern firearms imagine cost outweighed believe armed population position fend tyrantsp pthis admit means clear correctly point matter semiautomatic weapons private hands match firepower guns including fully automatic guns publicly funded arsenals argument goes danger finding disposal tyrants add incredible range weapons weaponsystems public answer slam dunk headtohead conflict treasonous tyrantled military hand freedomloving americans military trounce number militias matter wellregulatedp pbut isnt persuasive argument reasons decided fair fight times military find stalemated inferior forces incorporate lesson asymmetric warfare national consciousnessp pwhen family lived olympia washington frequently saw foxes backyard learned worry cats foxes simply ignore portland coyotes instead foxes neighbourhood cats constantly disappearing imply wild fox cant beat housecat coyote mammalogist im sure thats fox win fight death domestic cat house cat capable damage way dissuade desperate fox trying armed populace able defeat tyrants army punish retreatp pthe second reason armed population succeed militarygonerogue exceedingly unlikely ementireem military accept immoral orders divide question armed populace end fighting alongside hopefully large portion military remained loyal constitution fellow citizens naturally resist immoral orders purged uniformed ranks pretext discovers discharges independent minds returning noncompliant souls home wellarmed families neighbourhoods way private gun ownership prove decisive periodic contest patriots tyrantsp pi expect argument prove unpopular near brink tyranny america dont know think plausible irresponsible discuss happenp diva hrefhttpsunherdcom202111wouldamericasurviveacivilwarrefinnara hrefhttpsunherdcom202111wouldamericasurviveacivilwarrefinnarimg srchttpsunherdcomwpcontentuploads202111gettyimages6094814501scalede16366526132601300x169jpgadiva hrefhttpsunherdcom202111wouldamericasurviveacivilwarrefinnarspansuggested readingspanaa hrefhttpsunherdcom202111wouldamericasurviveacivilwarrefinnarh5would america survive civil warh5apa hrefhttpsunherdcom202111wouldamericasurviveacivilwarrefinnarspanbyspan malcom kyeyuneapdivadiv pi think worth taking brief look australia discern lessons australia nation similarities permissive gun ownership laws culture 1996 massacre port arthur tasmania 35 people killed alterations australias gun laws gun buyback programme followed frequently held possible relnoopener hrefhttpswwwbbccouknewsworldaustralia35048251 target_blankmodela american gun reform strong case massacres gun violence greatly reduced programme pricep pi tell im finding difficult sense events australia moment things relnoopener hrefhttpstwittercomandrewlawtonstatus1463584468606894092s20 target_blanklooka relnoopener hrefhttpstwittercommaajidnawazstatus1463443901675712514s20 target_blanklota like relnoopener hrefhttpstwittercom4patrick7status1461514103675965450s20 target_blanktyrannya reported friends people know personally trust fleeing australia looks sounds like tyranny relnoopener hrefhttpswwwyoutubecomwatchappdesktoplistpljq2gc5yheug8_vk8ve0odsjloiu4b93vqa0wzd0ipwfeatureyoutube target_blankintervieweda australians describe absolutely tyrannical encounters having governmental authoritiesp pbut respected people assuring picture getting distorted truth ideals liberal west spread like wildfire 20supthsup century fear americans lulled false sense complacency freedom caught region region appeared permanent dont know fully discern founders intent respect second amendment strongly suspect understanding freedom freshly won realistic oursp pthis gun ownership comes youre liberal conservative way protect liberty spasms tyranny condemn spectacular cost regular gun violence id love know dynamism west productivity ingenuity quest fairness protected tyrants point gun itp hrefhttpsunherdcom202111theliberalcaseforgunownershipappcommentsview 85 commentsa |
61a2b2b89b209e23967195c5 | Rittenhouse and Our Broken Democracy | audio controls
source srchttpschrtfmtrackgg6ba9trafficlibsyncomsecurewisdomofcrowdsrittenhouse_and_our_broken_democracymp3
img altrittenhouse and our broken democracy srchttpswisdomofcrowdslivecontentimages202111brokenjpgpyour browser doesnt support html audio a hrefhttpswocpremiums3amazonawscomwocsdbonusfinal_mixdownmp3herea is a link to the filep
audiopin this episode shadi and damir analyze the rittenhouse verdict and question how the medias framing shaped peoples initial reactions the conversation turns to the state of american democracy damir questions whether he has been too glib about the recent moves made by the republican party is our democracy approaching an inflection pointppstrongpart 2strong of our conversation is a hrefhttpswisdomofcrowdslivecovidisnotdeadyetavailable herea for subscribers in the episode we dive into damirs last friday essay quotthe coming stormquot was damir too pessimistic about the state of the post cold war order the us should rethink its foreign policy priorities but what should those new priorities bepp a hrefhttpswisdomofcrowdsliverittenhouseandourbrokendemocracyportalsignup target_blankaphrpemrequired readingempulliquota hrefhttpswwwwashingtonpostcomwpdyncontentarticle20090903ar2009090302858htmlnewspaper corrections run amok with triviaaquot by michael kinsley the washington postliliquota hrefhttpstaibbisubstackcomptherittenhouseverdictisonlyshockingthe rittenhouse verdict is only shocking if you followed the last year of terrible reportingaquot by matt taibbi tk news by matt taibbililiquota hrefhttpswwwtheatlanticcomideasarchive202111rittenhousetrialverdictnotguilty620737the rittenhouse trial could never have been what americans wantedaquot by david a graham the atlanticliliquota hrefhttpswisdomofcrowdslivetherittenhousetrialandthevalueofsilencethe rittenhouse trial and the value of silenceaquot by shadi hamid wisdom of crowdsliulpp | audio controls source srchttpschrtfmtrackgg6ba9trafficlibsyncomsecurewisdomofcrowdsrittenhouse_and_our_broken_democracymp3 img altrittenhouse broken democracy srchttpswisdomofcrowdslivecontentimages202111brokenjpgpyour browser doesnt support html audio hrefhttpswocpremiums3amazonawscomwocsdbonusfinal_mixdownmp3herea link filep audiopin episode shadi damir analyze rittenhouse verdict question medias framing shaped peoples initial reactions conversation turns state american democracy damir questions glib recent moves republican party democracy approaching inflection pointppstrongpart 2strong conversation hrefhttpswisdomofcrowdslivecovidisnotdeadyetavailable herea subscribers episode dive damirs friday essay quotthe coming stormquot damir pessimistic state post cold war order rethink foreign policy priorities new priorities bepp hrefhttpswisdomofcrowdsliverittenhouseandourbrokendemocracyportalsignup target_blankaphrpemrequired readingempulliquota hrefhttpswwwwashingtonpostcomwpdyncontentarticle20090903ar2009090302858htmlnewspaper corrections run amok triviaaquot michael kinsley washington postliliquota hrefhttpstaibbisubstackcomptherittenhouseverdictisonlyshockingthe rittenhouse verdict shocking followed year terrible reportingaquot matt taibbi tk news matt taibbililiquota hrefhttpswwwtheatlanticcomideasarchive202111rittenhousetrialverdictnotguilty620737the rittenhouse trial americans wantedaquot david graham atlanticliliquota hrefhttpswisdomofcrowdslivetherittenhousetrialandthevalueofsilencethe rittenhouse trial value silenceaquot shadi hamid wisdom crowdsliulpp |
61a4033a40661f8f5d9639c2 | Your political views are not your own | blockquotepin a unique sample of 394 adoptive and biological families with offspring more than 30 years old biometric modeling revealed significant evidence for genetic and nongenetic transmission from both parents for the majority of seven politicalattitude phenotypes we found the largest genetic effects for religiousness and social liberalism whereas the largest influence of parental environment was seen for political orientation and egalitarianism together these findings indicate that genes environment and the geneenvironment correlation all contribute significantly to sociopolitical attitudes held in adulthood and the etiology and development of those attitudes may be more important than ever in todays rapidly changing sociopolitical landscapepblockquote
phere is a relnoopener hrefhttpsjournalssagepubcomdoiabs10117709567976211021844 target_blankthe full piecea from emily a willoughby etal via the excellent a relnoopener hrefhttpswwwnationalaffairscomblogdetailfindingsadailyrounduptherightpurchase target_blankkevin lewisap
pthe post a relnofollow hrefhttpmarginalrevolutioncommarginalrevolution202111yourpoliticalviewsarenotyourownhtmlyour political views are not your owna appeared first on a relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap | blockquotepin unique sample 394 adoptive biological families offspring 30 years old biometric modeling revealed significant evidence genetic nongenetic transmission parents majority seven politicalattitude phenotypes found largest genetic effects religiousness social liberalism largest influence parental environment seen political orientation egalitarianism findings indicate genes environment geneenvironment correlation contribute significantly sociopolitical attitudes held adulthood etiology development attitudes important todays rapidly changing sociopolitical landscapepblockquote phere relnoopener hrefhttpsjournalssagepubcomdoiabs10117709567976211021844 target_blankthe piecea emily willoughby etal excellent relnoopener hrefhttpswwwnationalaffairscomblogdetailfindingsadailyrounduptherightpurchase target_blankkevin lewisap pthe post relnofollow hrefhttpmarginalrevolutioncommarginalrevolution202111yourpoliticalviewsarenotyourownhtmlyour political views owna appeared relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap |
61a4037240661f8f5d9639c8 | What is a pessimist? | blockquotepwhat is a pessimistp
pa bad personp
pbut most pessimists are not pessimistspblockquote
pthat is from ludwig hohl a relnoopener hrefhttpswwwamazoncomnotesnonprematurereconciliationmargellosrepublicdp0300220057refsr_1_1keywordsludwighohlqid1637888245qsid14214283993463341sr81sres03002200572c35184158752cb019osyx5q2c35183850702c28251055112c09860050102cb002a7lib62c35182248322c39071426322cb08ys4sqgv2c30340088052cb0797zf37g2cb0000bpy762cb082t42g7v2cb003vfp9am2c2825102555 target_blankthe notes or on nonpremature reconciliationap
pthe post a relnofollow hrefhttpmarginalrevolutioncommarginalrevolution202111whatisapessimisthtmlwhat is a pessimista appeared first on a relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap | blockquotepwhat pessimistp pa bad personp pbut pessimists pessimistspblockquote pthat ludwig hohl relnoopener hrefhttpswwwamazoncomnotesnonprematurereconciliationmargellosrepublicdp0300220057refsr_1_1keywordsludwighohlqid1637888245qsid14214283993463341sr81sres03002200572c35184158752cb019osyx5q2c35183850702c28251055112c09860050102cb002a7lib62c35182248322c39071426322cb08ys4sqgv2c30340088052cb0797zf37g2cb0000bpy762cb082t42g7v2cb003vfp9am2c2825102555 target_blankthe notes nonpremature reconciliationap pthe post relnofollow hrefhttpmarginalrevolutioncommarginalrevolution202111whatisapessimisthtmlwhat pessimista appeared relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap |
61a403fe40661f8f5d9639dc | An update on the mask debate | pi am long since tired of this debate and i see that a lot of people are not joining it in the best of faith i can pass along a few updates namely a relnoopener hrefhttpsmobiletwittercombencowling88status1461617969067282434 target_blankthis studya with some critical commentary attached and here is a relnoopener hrefhttpwwwargminnet20211123maskrctrevisited target_blankmore on the bangladeshi mask rcta with more data transparency it does not seem to be holding up very wellp
pthat said i am not sure that either calculation really matters any good assessment of mask efficacy has to be radically intertemporal in nature and i mean for the entirety of the pandemic not getting infected now may well raise your chance of getting infected later on and that spans for longer than any feasibly designed rct and have you heard about a relnoopener hrefhttpstwittercomerictopolstatus1463900917187563520 target_blankthe new nu varianta it may turn out not to matter but it does remind us that the pandemic is not over yetp
pas a simple first approximation think of the real value of masks as a how many infections are delayed for how long plus improvements in treatment in the meantime plus b how many infections are avoided altogether even a welldesigned rct is going to focus on a version of b but only for a limited period of time the extant studies dont at all consider plus improvements in treatment in the meantime or when some of those protected by masks for say a year or two might nonetheless later catch covid later yet so those rcts no matter what their results are grabbing only one leg of the elephantp
pto make matters more complicated yet a very small efficacy for masks might yes emmightem translate into a much larger final effect due to effective r sometimes being greater than 1 so finding a very small effect for masks doesnt mean masks are only slightly effective as the pandemic is ending you might again emmightem have had one less pandemic cycle than if you hadnt tried masks at all you can think of masks as a kind of lottery ticket on one big gain paying off only when the timing is such that the masks have helped you choke off another covid wave again the rct is not capable of estimating that probability or the magnitude of its effectp
pyet another part of my mental model of masks has evolved to be the following you have two sets of countries countries that manage covid well and countries that dont argue all you want who goes into which bin but that isnt the point right nowp
pnow consider the countries that dont manage covid well they might wish to stretch out their epidemics over time so that better treatments arrive subject to economic constraints of course but the countries that manage covid well probably want the poorlymanaged countries to reach herd immunity sooner rather than later if only to lower the ongoing risk of transmission from a poorlymanaged country to a wellmanaged country and to lower the risk of those countries birthing new variants just as southern africa now seems to have birthed the nu variantp
pso we have two major points of view represented by multiple countries one wanting quicker resolution for the poorly managed countries but the other wanting slower resolution does any study of masks take emthoseem variables into account no nor is it easy to see how it couldp
pto be clear i am not arguing masks dont work nor am i making any claims about how much masks may or may not protect you individually or the people you interact with i am claiming that at the aggregate social level we are quite far from knowing how well masks workp
pi say it is third doses we should be doubling down on not masks to be clear i am fine with wearing masks myself i am used to it and i dislike it but i dont hate it on this issue i am not one of those people translating his or her own snowflakeism into some kind of biased policy viewp
pbut the emerging science on third doses is much stronger and most countries have been dropping the ball on that onep
pthe post a relnofollow hrefhttpmarginalrevolutioncommarginalrevolution202111anupdateonthemaskdebatehtmlan update on the mask debatea appeared first on a relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap | pi long tired debate lot people joining best faith pass updates relnoopener hrefhttpsmobiletwittercombencowling88status1461617969067282434 target_blankthis studya critical commentary attached relnoopener hrefhttpwwwargminnet20211123maskrctrevisited target_blankmore bangladeshi mask rcta data transparency holding wellp pthat said sure calculation matters good assessment mask efficacy radically intertemporal nature mean entirety pandemic getting infected raise chance getting infected later spans longer feasibly designed rct heard relnoopener hrefhttpstwittercomerictopolstatus1463900917187563520 target_blankthe new nu varianta turn matter remind pandemic yetp pas simple approximation think real value masks infections delayed long plus improvements treatment meantime plus b infections avoided altogether welldesigned rct going focus version b limited period time extant studies dont consider plus improvements treatment meantime protected masks year nonetheless later catch covid later rcts matter results grabbing leg elephantp pto matters complicated small efficacy masks yes emmightem translate larger final effect effective r greater 1 finding small effect masks doesnt mean masks slightly effective pandemic ending emmightem pandemic cycle hadnt tried masks think masks kind lottery ticket big gain paying timing masks helped choke covid wave rct capable estimating probability magnitude effectp pyet mental model masks evolved following sets countries countries manage covid countries dont argue want goes bin isnt point right nowp pnow consider countries dont manage covid wish stretch epidemics time better treatments arrive subject economic constraints course countries manage covid probably want poorlymanaged countries reach herd immunity sooner later lower ongoing risk transmission poorlymanaged country wellmanaged country lower risk countries birthing new variants southern africa birthed nu variantp pso major points view represented multiple countries wanting quicker resolution poorly managed countries wanting slower resolution study masks emthoseem variables account easy couldp pto clear arguing masks dont work making claims masks protect individually people interact claiming aggregate social level far knowing masks workp pi doses doubling masks clear fine wearing masks dislike dont hate issue people translating snowflakeism kind biased policy viewp pbut emerging science doses stronger countries dropping ball onep pthe post relnofollow hrefhttpmarginalrevolutioncommarginalrevolution202111anupdateonthemaskdebatehtmlan update mask debatea appeared relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap |
61a554c9df82b6d760075dbc | Why the 14th Amendment Does Not Prohibit Abortion | pon wednesday the supreme court will hear oral argument in a hrefhttpswwwscotusblogcomcasefilescasesdobbsvjacksonwomenshealthorganizationemdobbs v jackson womens health organizationema in which the justices will reconsider the extent to which the constitution protects a womans right to terminate her pregnancyp
pbecause the law in question is incompatible with the quotundue burdenquot standard as articulated in emcaseyem and subsequent cases much of the briefing focuses on whether emroe emand emcasey emwere correct as an original matter and if not the extent to which principles of stare decisis counsel upholding modifying or overturning those decisions i suspect such questions will dominate the oral argument on wednesdayp
psome prolife advocates have more more ambitious aims they argue not only that emroeem was wrong as an original matter but also that a hrefhttpswwwnewsweekcomcaseunconstitutionalityabortionopinion1614532the fourteenth amendment properly interpreted protects unborn life and prohibits abortiona this is the argument made in a hrefhttpswwwsupremecourtgovdocketpdf1919139218519620210729093557582_210169a20amicus20brief20for20efiling20720292021pdfthis amicus briefa filed in emdobbsem on behalf of john finnis and robert george and a hrefhttpswwwfirstthingscomarticle202104abortionisunconstitutionalthis finnis article in emfirst thingsema this was also an argument made by texas in emroeem but not one that has ever attracted even a single justices vote at the supreme courtp
plast month i was asked to debate this question with josh hammer by the university of chicago student chapter of the federalist society and uchicago law students for life it was a a hrefhttpstwittercomuchifedsocstatus1450931154245259267fun event in front of a packed housea the remainder of this post after the break summarizes my argument for why the fourteenth amendment does not prohibit abortionp
pspanspanp
pin order to argue that the 14th amendment prohibits abortion one needs to establish two separate propositions 1 that the unborn are quotpersonsquot within the fourteenth amendment emandem 2 that the failure of a state to prohibit abortion constitutes a denial of either due process or equal protection both are necessary to sustain the argument but in my view the constitutions text structure and history do not support eitherp
plet us start with the text the 14th amendment extends due process and equal protection to all persons privileges and immunities on the other hand are only extended to citizens and only those quotborn or naturalized in the united statesquot are citizens as most originalists believe it is the pori clause that is the source of substantive rights under the 14th amendment an originalist could stop here and conclude that the 14th amendment does not extend any substantive rights to the unbornp
psetting aside the pori question does not help much as there is little in text or history to suggest that the unborn are persons within the meaning of the constitution the term quotpersonquot is used throughout the constitution including elsewhere in the 14th amendment and regularly in ways that can and have always only applied to those already born such as section 2 of the 14th amendment which bases apportionment on quotthe whole number of personsquot and makes reference to an individuals age which has always been counted from birth not conceptionp
psome counter that if quotpersonsquot is a capacious enough term to include corporations then it can include the unborn as well this counter fails on two fronts first corporations are not considered persons for all constitutional purposes and second as a hrefhttpswwwfirstthingscomwebexclusives202104doubtsaboutconstitutionalpersonhooded whelan notes herea the reason for sometimes considering corporations to be persons is because as the supreme court has a hrefhttpssupremejustiacomcasesfederalus125181explaineda corporations quotare merely associations of individuals united for a special purposequot accordingly where denying constitutional rights to a corporation would require denying rights to a collection of individuals those rights are protected but otherwise they are not which is why for instance not all rights protected by the 14th amendment apply to corporationsp
pyet even if one rejects these concerns and concludes that the unborn are persons for purposes of the the due process and equal protection clauses this still does not establish that states have a constitutional obligation to prohibit abortionp
plets start with due process there is zero evidence that this clause was ever understood to prohibit abortion or any other private conduct unlike the 13th amendment the 14th amendment only applies to state action and as the 13th amendment shows the authors of the reconstruction amendments knew how to draft amendments to reach private conduct so privately performed abortions are not constitutional violations further even if one sets aside the state action concern and further assumes that the clause protects substantive rights the due process clause of the 5th amendment was never interpreted or understood to impose any limitations on abortion within the district of columbia or federal territories even though all persons were subject to due process protections as against the federal government since the ratification of the fifth amendmentp
pif due process is a nonstarter is there are an argument that failing to prohibit abortion violates equal protection the argument here would be that protecting born persons from private violence while failing to protect unborn persons violates each states obligation to ensure equal protection of the laws this argument seems more plausible on its face it is not subject to the state action objection nor does the federal governments failure to limit abortion prior to the 14th amendments ratification matter much as the 5th amendment contains no equal protection clause but while the argument here is more plausible it still failsp
peven assuming that the unborn are persons within the equal proteciton clause even as they are not persons for other parts of the 14th amendment there is a conspicuous problem that few states have ever treated abortion as fully equivalent to intentional homicide finnis and george note in their brief that the history of state restrictions on abolition in the 19th century is significantly greater than justice blackmun suggested in emroe emand that point is well taken yet even under their account feticide was often not treated as the equivalent of intentional homicide particularly prior to quickening which was often treated as a misdemeanor if prohibited at all that is states rarely adopted laws to protect the unborn equally with other personsp
pfurther while many states considered and revised their abortion laws in the middle of the 19th century both before and after the drafting and ratification of the 14th amendment there is no evidence that any of these debates or legal enactments were influenced in the slightest by a belief that the 14th amendment or principles of equal protection more generally required treating feticide and homicide as equivalent actions and they cite no evidence that emanyem political figure or commentator thought that state failure to prohibit abortion in the late 19th century constituted a violation of the 14th amendment the propriety of abortion was a highly salient policy question in the postbellum period and yet no one sought to connect this question to the 14th amendment or to argue that the failure to treat feticide as equivalent to homicide was a constitutional violation the absence of a single dog barking in any state is more than conspicuousp
pthe lack of emany em19th century support for this reading of the equal protection clause is even more conspicuous because such a reading would greatly distort our constitutional structure most questions of life and death and the extent to which actions that harm or kill others should be criminalized are questions left to the states most states at this point have adopted the a hrefhttpsenwikipediaorgwikiuniform_determination_of_death_actuniform definition of death acta but this is a choice the constitution vests with the states as is the choice to decide waht sorts of acts constituted permissible killing such as selfdefense and what acts do not within our constitutional system different states can and always have defined the line between life and death what actions constitute homicide when killing may or may not be permissible and so on the liberty to make these choices in line with state preferences was not obviated by enactment of the 14th amendment individual state answers to these questions have often converged but due to the choices of policymakers in each state and not federal dictatep
pnote that the finnisgeorge argument is not simply that section 5 of the 14th amendment gives congress the power to limit or prohibit abortion a question i addressed a hrefhttpswwwwashingtonpostcomnewsvolokhconspiracywp20150511whatgivescongresstheauthoritytoregulateabortionherea rather their argument is that the 14th amendment itself requires states to prohibit abortion to provide the unborn at all stages of development quotequal protection of the lawsquot this argument not only lacks grounding in text history or structure for the reasons i have tried to sketch briefly above it would also require a dramatic degree of federal judicial superintendence of state law and policy making to enforce as they note under their argument quotstate homicide laws would need to forbid elective abortionquot and this requirement would need to be enforced by courts in some fashion finnis and george suggest this could be done easily with little disruption but their cursory argument on this score actually demonstrates the opposite as even the quotcustomary remediesquot they propose require courts to rewrite state laws and mandate their enforcementp
pin emfederalist emno 45 james madison wrote that the reserved powers of the states quotextend to all objects which in the ordinary course of affairs concern the lives liberties and proprieties of the people and the internal order improvement and prosperity of the statequot however much the ratification of the 14th amendment curtailed these powers and rebalanced our federal system it did not make abortion unconstitutional nor did it require states to treat all abortion as homicide no justice has as yet ever held otherwise and no justice who considers himself or herself bound by the original public meaning of the 14th amendment ever shouldp
pthe post a relnofollow hrefhttpsreasoncomvolokh20211129whythe14thamendmentdoesnotprohibitabortionwhy the 14th amendment does not prohibit abortiona appeared first on a relnofollow hrefhttpsreasoncomreasoncomap | pon wednesday supreme court hear oral argument ina hrefhttpswwwscotusblogcomcasefilescasesdobbsvjacksonwomenshealthorganizationemdobbs v jackson womens health organizationema justices reconsider extent constitution protects womans right terminate pregnancyp pbecause law question incompatible quotundue burdenquot standard articulated inemcaseyem subsequent cases briefing focuses whetheremroeemand emcaseyemwere correct original matter extent principles stare decisis counsel upholding modifying overturning decisions suspect questions dominate oral argument wednesdayp psome prolife advocates ambitious aims argue thatemroeem wrong original matter hrefhttpswwwnewsweekcomcaseunconstitutionalityabortionopinion1614532the fourteenth amendment properly interpreted protects unborn life prohibits abortiona argument hrefhttpswwwsupremecourtgovdocketpdf1919139218519620210729093557582_210169a20amicus20brief20for20efiling20720292021pdfthis amicus briefa filed emdobbsem behalf john finnis robert george hrefhttpswwwfirstthingscomarticle202104abortionisunconstitutionalthis finnis article inemfirst thingsema argument texas inemroeem attracted single justices vote supreme courtp plast month asked debate question josh hammer university chicago student chapter federalist society uchicago law students life hrefhttpstwittercomuchifedsocstatus1450931154245259267fun event packed housea remainder post break summarizes argument fourteenth amendment prohibit abortionp pspanspanp pin order argue 14th amendment prohibits abortion needs establish separate propositions 1 unborn quotpersonsquot fourteenth amendment emandem 2 failure state prohibit abortion constitutes denial process equal protection necessary sustain argument view constitutions text structure history support eitherp plet start text 14th amendment extends process equal protection persons privileges immunities hand extended citizens quotborn naturalized united statesquot citizens originalists believe pori clause source substantive rights 14th amendment originalist stop conclude 14th amendment extend substantive rights unbornp psetting aside pori question help little text history suggest unborn persons meaning constitution term quotpersonquot constitution including 14th amendment regularly ways applied born section 2 14th amendment bases apportionment quotthe number personsquot makes reference individuals age counted birth conceptionp psome counter quotpersonsquot capacious term include corporations include unborn counter fails fronts corporations considered persons constitutional purposes second hrefhttpswwwfirstthingscomwebexclusives202104doubtsaboutconstitutionalpersonhooded whelan notes herea reason considering corporations persons supreme court hrefhttpssupremejustiacomcasesfederalus125181explaineda corporations quotare merely associations individuals united special purposequot accordingly denying constitutional rights corporation require denying rights collection individuals rights protected instance rights protected 14th amendment apply corporationsp pyet rejects concerns concludes unborn persons purposes process equal protection clauses establish states constitutional obligation prohibit abortionp plets start process zero evidence clause understood prohibit abortion private conduct unlike 13th amendment 14th amendment applies state action 13th amendment shows authors reconstruction amendments knew draft amendments reach private conduct privately performed abortions constitutional violations sets aside state action concern assumes clause protects substantive rights process clause 5th amendment interpreted understood impose limitations abortion district columbia federal territories persons subject process protections federal government ratification fifth amendmentp pif process nonstarter argument failing prohibit abortion violates equal protection argument protecting born persons private violence failing protect unborn persons violates states obligation ensure equal protection laws argument plausible face subject state action objection federal governments failure limit abortion prior 14th amendments ratification matter 5th amendment contains equal protection clause argument plausible failsp peven assuming unborn persons equal proteciton clause persons parts 14th amendment conspicuous problem states treated abortion fully equivalent intentional homicide finnis george note brief history state restrictions abolition 19th century significantly greater justice blackmun suggested emroe emand point taken account feticide treated equivalent intentional homicide particularly prior quickening treated misdemeanor prohibited states rarely adopted laws protect unborn equally personsp pfurther states considered revised abortion laws middle 19th century drafting ratification 14th amendment evidence debates legal enactments influenced slightest belief 14th amendment principles equal protection generally required treating feticide homicide equivalent actions cite evidence emanyem political figure commentator thought state failure prohibit abortion late 19th century constituted violation 14th amendment propriety abortion highly salient policy question postbellum period sought connect question 14th amendment argue failure treat feticide equivalent homicide constitutional violation absence single dog barking state conspicuousp pthe lack emany em19th century support reading equal protection clause conspicuous reading greatly distort constitutional structure questions life death extent actions harm kill criminalized questions left states states point adopted hrefhttpsenwikipediaorgwikiuniform_determination_of_death_actuniform definition death acta choice constitution vests states choice decide waht sorts acts constituted permissible killing selfdefense acts constitutional system different states defined line life death actions constitute homicide killing permissible liberty choices line state preferences obviated enactment 14th amendment individual state answers questions converged choices policymakers state federal dictatep pnote finnisgeorge argument simply section 5 14th amendment gives congress power limit prohibit abortion question addressed hrefhttpswwwwashingtonpostcomnewsvolokhconspiracywp20150511whatgivescongresstheauthoritytoregulateabortionherea argument 14th amendment requires states prohibit abortion provide unborn stages development quotequal protection lawsquot argument lacks grounding text history structure reasons tried sketch briefly require dramatic degree federal judicial superintendence state law policy making enforce note argument quotstate homicide laws need forbid elective abortionquot requirement need enforced courts fashion finnis george suggest easily little disruption cursory argument score actually demonstrates opposite quotcustomary remediesquot propose require courts rewrite state laws mandate enforcementp pinemfederalist emno 45 james madison wrote reserved powers states quotextend objects ordinary course affairs concern lives liberties proprieties people internal order improvement prosperity statequot ratification 14th amendment curtailed powers rebalanced federal system abortion unconstitutional require states treat abortion homicide justice held justice considers bound original public meaning 14th amendment shouldp pthe post relnofollow hrefhttpsreasoncomvolokh20211129whythe14thamendmentdoesnotprohibitabortionwhy 14th amendment prohibit abortiona appeared relnofollow hrefhttpsreasoncomreasoncomap |
61a554fedf82b6d760075dbe | Monday afternoon links, all graphic edition | div classwpblockimagefigurea hrefhttpswwwaeiorgwpcontentuploads202111asianwomen2021q3apngx91208img alt width658 srchttpswwwaeiorgwpcontentuploads202111asianwomen2021q3apngx91208 classwpimage1008616030 height485afigurediv
p1 strongchart of the day istrong above shows the narrativedestabilizing labor market reality that according to bls data a relnoreferrer noopener hrefhttpswwwblsgovnewsreleasepdfwkyengpdf target_blankherea and a relnoreferrer noopener hrefhttpswwwblsgovwebappslegacycpswktab2htm target_blankherea asian women outearned white men in six of the last nine quarters for the most recent quarter 2021q3 asian women earned 91 and 102 more per week than white men how to explain this gender earnings gap favoring asian women gender discrimination and male privilege are always the goto explanations for any gender earnings gap favoring men so perhaps theres discrimination in the labor market against white men in favor of asian women and when there are whiteblack earnings gaps that favor whites we often hear that white privilege is the reason so perhaps asian privilege is a factor in the labor market especially because its also true that asian men outearn white men p
pstrongrelatedstrong a relnoreferrer noopener hrefhttpswwwdailymailcoukfemailarticle10254031therealreasonwomenearnworkhtml target_blankthe real reason women earn less at work harvard professor says sex discrimination gender bias or a glass ceiling arent to blame its greedy jobs that are impossible to sustain once women have childrenap
div classwpblockimagefigurea hrefhttpswwwaeiorgwpcontentuploads202111peakoilpngx91208img alt width1156 srchttpswwwaeiorgwpcontentuploads202111peakoilpngx91208 classwpimage1008616033 height342afigurediv
p2 strongchart of the day iistrong above shows the declining search interest over time on google for the term a relnoreferrer noopener hrefhttpstrendsgooglecomtrendsexploredateallgeousqpeak20oil target_blankpeak oila remember that misguided obsession in the days before hydraulic fracking and especially horizontal drilling revolutionized us oil production starting about 2009 and reversed a thirtyyear decline in output in only ten years on the way to making the us the worlds no 1 crude oil producer peak what p
div classwpblockimagefigurea hrefhttpswwwaeiorgwpcontentuploads202111m2pngx91208img alt width699 srchttpswwwaeiorgwpcontentuploads202111m2pngx91208 classwpimage1008616049 height466afigurediv
p3 strongchart of the day iiistrong above shows why were experiencing the highest inflation in 30 years and why it might not be transient since 1981 the federal reserve has increased m2 by about 195 trillion if we divide that m2 growth into three periods when 65 trillion of new m2 was created it took 336 months between january 1981 to december 2008 to create the first 65t then 127 months from january 2009 to july 2019 to create the next 65t of new m2 and then only 27 months from august 2019 to october 2021 to create the last colossal eyepopping addition of 6500000000000 in new m2 for another graphic that helps to understand just how much money m2 has been created in less than two years check out this stunning a relnoreferrer noopener hrefhttpsfredstlouisfedorgserieswm2ns target_blankfred charta p
div classwpblockimagefigurea hrefhttpswwwaeiorgwpcontentuploads202111uhaulnovpngx91208img alt width612 srchttpswwwaeiorgwpcontentuploads202111uhaulnovpngx91208 classwpimage1008616060 height208afigurediv
p 4 strongchart of the day iv strongabove displays some marketbased evidence of the californiatotexas exodus that has been taking place in recent years demand is so high for oneway 26foot uhaul trucks and supply is so low from san francisco to dallas relative for the low demand for oneway trucks in the opposite direction that it costs 83 times more for san franciscodallas 7054 than for dallassan francisco only 854 the 854 cost for a 26foot truck from dallas to san francisco in middecember is actually less than the cost of a oneway rental for an a relnoreferrer noopener hrefhttpswwwenterprisecomenreservehtmlcars target_blanksuv from enterprise of 918a the difference in oneway uhaul truck rental rates between a pair of us cities is a great example of market forces supply and demand in action high demand low supply high price and low demand high supply low price p
figure classwpblockimagea hrefhttpswwwaeiorgwpcontentuploads202111cpi1800pngx91208img alt width654 srchttpswwwaeiorgwpcontentuploads202111cpi1800pngx91208 classwpimage1008616074 height478afigure
p5 strongchart of the day vstrong above shows that for more than a century from 1800 to 1913 prices in the us were relatively stable based on a relnoreferrer noopener hrefhttpswwwminneapolisfedorgaboutusmonetarypolicyinflationcalculatorconsumerpriceindex1800 target_blankfederal reserve dataa but since the creation of the federal reserve in 1913 its monetary policies increased the cpi by 275x decreasing the value of the us dollar by more than 96 in the process p
div classwpblockimagefigurea hrefhttpswwwaeiorgwpcontentuploads202111dollar2021ajpgx91208img alt width738 srchttpswwwaeiorgwpcontentuploads202111dollar2021ajpgx91208 classwpimage1008616083 height434afigurediv
p6strong chart of the day vistrong above shows another look at how the value of the us dollar has decreased over time since the creation of the federal reserve in 1913 p
div classwpblockimagefigurea hrefhttpswwwaeiorgwpcontentuploads202111vennkylerittenhousepngx91208img alt width582 srchttpswwwaeiorgwpcontentuploads202111vennkylerittenhousepngx91208 classwpimage1008616086 height229afigurediv
p7 strongvenn diagram of the daystrong above on the inconsistency among some about their concern for state borders vs national borders p
figure classwpblockimageimg alt srchttpswwwaeiorgwpcontentuploads202111oilpricesbjpgx91208 classwpimage1008616092figure
p8 strongchart of the day viistrong above illustrates the signficant difference between how economists view changes in oil prices over time vs how politicians and noneconomists view oil prices p
div classwpblockimagefigurea hrefhttpswwwaeiorgwpcontentuploads202111co22021apngx91208img alt width731 srchttpswwwaeiorgwpcontentuploads202111co22021apngx91208 classwpimage1008616097 height525afigurediv
p9 strongchart of the day viiistrong above displays an important but frequently overlooked downward trend in us co2 emissions that started in 2007 and brought emissions to the lowest level last year since 1983 for that dramatic drop in co2 emissions to a 37year low we can thank hydraulic fracturing and horizontal drilling which facilitated the increasing substitution of clean natural gas for coal as the main fuel source for the nations electric power p
div classwpblockimagefigurea hrefhttpswwwaeiorgwpcontentuploads202111co2topten1apngx91208img alt width709 srchttpswwwaeiorgwpcontentuploads202111co2topten1apngx91208 classwpimage1008616106 height478afigurediv
p10 strongchart of the day ixstrong above is also an important but frequently overlooked energy fact the strongus leads the world in the reduction of co2 over the most recent decade 20102020 strongfor which data are available as above for that greening of america we can thank the revolutionary technologies of fracking and horizontal drilling which have accessed oceans of previously inaccessible natural gas beneath the ground in us states like pennslyvania texas louisiana and alaska ten years ago coal was the fuel source for 42 of americas electricity while natural gas provided only 247 last year natural gas provided 405 of the nations electricity compared to coals share of less than 20 p
pthe post a relnofollow hrefhttpswwwaeiorgcarpediemmondayafternoonlinksallgraphiceditionmonday afternoon links all graphic editiona appeared first on a relnofollow hrefhttpswwwaeiorgamerican enterprise institute aeiap | div classwpblockimagefigurea hrefhttpswwwaeiorgwpcontentuploads202111asianwomen2021q3apngx91208img alt width658 srchttpswwwaeiorgwpcontentuploads202111asianwomen2021q3apngx91208 classwpimage1008616030 height485afigurediv p1 strongchart day istrong shows narrativedestabilizing labor market reality according bls data relnoreferrer noopener hrefhttpswwwblsgovnewsreleasepdfwkyengpdf target_blankherea relnoreferrer noopener hrefhttpswwwblsgovwebappslegacycpswktab2htm target_blankherea asian women outearned white men quarters recent quarter 2021q3 asian women earned 91 102 week white men explain gender earnings gap favoring asian women gender discrimination male privilege goto explanations gender earnings gap favoring men theres discrimination labor market white men favor asian women whiteblack earnings gaps favor whites hear white privilege reason asian privilege factor labor market especially true asian men outearn white men p pstrongrelatedstrong relnoreferrer noopener hrefhttpswwwdailymailcoukfemailarticle10254031therealreasonwomenearnworkhtml target_blankthe real reason women earn work harvard professor says sex discrimination gender bias glass ceiling arent blame greedy jobs impossible sustain women childrenap div classwpblockimagefigurea hrefhttpswwwaeiorgwpcontentuploads202111peakoilpngx91208img alt width1156 srchttpswwwaeiorgwpcontentuploads202111peakoilpngx91208 classwpimage1008616033 height342afigurediv p2 strongchart day iistrong shows declining search interest time google term relnoreferrer noopener hrefhttpstrendsgooglecomtrendsexploredateallgeousqpeak20oil target_blankpeak oila remember misguided obsession days hydraulic fracking especially horizontal drilling revolutionized oil production starting 2009 reversed thirtyyear decline output years way making worlds 1 crude oil producer peak p div classwpblockimagefigurea hrefhttpswwwaeiorgwpcontentuploads202111m2pngx91208img alt width699 srchttpswwwaeiorgwpcontentuploads202111m2pngx91208 classwpimage1008616049 height466afigurediv p3 strongchart day iiistrong shows experiencing highest inflation 30 years transient 1981 federal reserve increased m2 195 trillion divide m2 growth periods 65 trillion new m2 created took 336 months january 1981 december 2008 create 65t 127 months january 2009 july 2019 create 65t new m2 27 months august 2019 october 2021 create colossal eyepopping addition 6500000000000 new m2 graphic helps understand money m2 created years check stunning relnoreferrer noopener hrefhttpsfredstlouisfedorgserieswm2ns target_blankfred charta p div classwpblockimagefigurea hrefhttpswwwaeiorgwpcontentuploads202111uhaulnovpngx91208img alt width612 srchttpswwwaeiorgwpcontentuploads202111uhaulnovpngx91208 classwpimage1008616060 height208afigurediv p 4 strongchart day iv strongabove displays marketbased evidence californiatotexas exodus taking place recent years demand high oneway 26foot uhaul trucks supply low san francisco dallas relative low demand oneway trucks opposite direction costs 83 times san franciscodallas 7054 dallassan francisco 854 854 cost 26foot truck dallas san francisco middecember actually cost oneway rental relnoreferrer noopener hrefhttpswwwenterprisecomenreservehtmlcars target_blanksuv enterprise 918a difference oneway uhaul truck rental rates pair cities great example market forces supply demand action high demand low supply high price low demand high supply low price p figure classwpblockimagea hrefhttpswwwaeiorgwpcontentuploads202111cpi1800pngx91208img alt width654 srchttpswwwaeiorgwpcontentuploads202111cpi1800pngx91208 classwpimage1008616074 height478afigure p5 strongchart day vstrong shows century 1800 1913 prices relatively stable based relnoreferrer noopener hrefhttpswwwminneapolisfedorgaboutusmonetarypolicyinflationcalculatorconsumerpriceindex1800 target_blankfederal reserve dataa creation federal reserve 1913 monetary policies increased cpi 275x decreasing value dollar 96 process p div classwpblockimagefigurea hrefhttpswwwaeiorgwpcontentuploads202111dollar2021ajpgx91208img alt width738 srchttpswwwaeiorgwpcontentuploads202111dollar2021ajpgx91208 classwpimage1008616083 height434afigurediv p6strong chart day vistrong shows look value dollar decreased time creation federal reserve 1913 p div classwpblockimagefigurea hrefhttpswwwaeiorgwpcontentuploads202111vennkylerittenhousepngx91208img alt width582 srchttpswwwaeiorgwpcontentuploads202111vennkylerittenhousepngx91208 classwpimage1008616086 height229afigurediv p7 strongvenn diagram daystrong inconsistency concern state borders vs national borders p figure classwpblockimageimg alt srchttpswwwaeiorgwpcontentuploads202111oilpricesbjpgx91208 classwpimage1008616092figure p8 strongchart day viistrong illustrates signficant difference economists view changes oil prices time vs politicians noneconomists view oil prices p div classwpblockimagefigurea hrefhttpswwwaeiorgwpcontentuploads202111co22021apngx91208img alt width731 srchttpswwwaeiorgwpcontentuploads202111co22021apngx91208 classwpimage1008616097 height525afigurediv p9 strongchart day viiistrong displays important frequently overlooked downward trend co2 emissions started 2007 brought emissions lowest level year 1983 dramatic drop co2 emissions 37year low thank hydraulic fracturing horizontal drilling facilitated increasing substitution clean natural gas coal main fuel source nations electric power p div classwpblockimagefigurea hrefhttpswwwaeiorgwpcontentuploads202111co2topten1apngx91208img alt width709 srchttpswwwaeiorgwpcontentuploads202111co2topten1apngx91208 classwpimage1008616106 height478afigurediv p10 strongchart day ixstrong important frequently overlooked energy fact strongus leads world reduction co2 recent decade 20102020 strongfor data available greening america thank revolutionary technologies fracking horizontal drilling accessed oceans previously inaccessible natural gas beneath ground states like pennslyvania texas louisiana alaska years ago coal fuel source 42 americas electricity natural gas provided 247 year natural gas provided 405 nations electricity compared coals share 20 p pthe post relnofollow hrefhttpswwwaeiorgcarpediemmondayafternoonlinksallgraphiceditionmonday afternoon links graphic editiona appeared relnofollow hrefhttpswwwaeiorgamerican enterprise institute aeiap |
61a5554ddf82b6d760075dc4 | Jack Dorsey's Exit From Twitter Could Worsen Tech Censorship | div
picture
source sizesminwidth 600px 331px 100vw typeimagewebp srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202111polspphotos7788372400x1350jpgwebp 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202111polspphotos7788371200x675jpgwebp 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202111polspphotos778837800x450jpgwebp 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202111polspphotos778837600x338jpgwebp 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202111polspphotos778837331x186jpgwebp 331w
source sizesminwidth 600px 331px 100vw typeimagejpeg srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202111polspphotos7788372400x1350jpg 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202111polspphotos7788371200x675jpg 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202111polspphotos778837800x450jpg 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202111polspphotos778837600x338jpg 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202111polspphotos778837331x186jpg 331w
img width1200 altpolspphotos778837 srchttpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202111polspphotos778837800x450jpg height675
picture
div
pjack dorsey has resigned as ceo of twitter having served in various leadership roles at the company since its inception in 2007p
pquotive decided to leave twitter because i believe the company is ready to move on from its foundersquot he explained in a a hrefhttpswwwcnbccom20211129twitterceojackdorseyisexpectedtostepdownsourcessayhtmlstatementap
pwhile facebook has attracted significantly more attention in recent months due to widespread concernsa hrefhttpsreasoncom20211005facebookwhistlebloweroutagemarkzuckerbergsome of them overblownathat the site spreads hate and misinformation and is making teenagers depressed twitter is the preferred site of the media and political classes the virtual blue birds nest may have significantly fewer users than facebook 300 million versus 2 billion but its importance to policymakers means that it plays a largerthanmerited role in political discussion if a change in leadership leads to significant internal policy changes this could have an outsized effect on the news mediap
panyone who harbors concerns that social media have already grown too intolerant of dissenting opinionstoo inclined to silence viewpoints that depart from liberal orthodoxyshould be worried about dorsey leaving thats because the longserving ceo has occasionally articulated an ideological commitment to the principles of free speech of all the tech industry pioneers who have been a hrefhttpsreasoncom20200730congresswantstoregulatebigtechtheystilldontunderstandithauled before congressa to answer absurd questions he was by far the a hrefhttpswwwpiratewirescompjackbenimblejackbequickmost hostilea to the idea that the government should serve as the internets speech policep
pwhile facebook ceo mark zuckerberg has come out in support of a hrefhttpsreasoncom20210325perhapsfacebooksupportssection230reformbecauseitcouldmakebigtechevenmorepowerfultweaking section 230a a change that could give congress more power over content moderation policies twitter has remained defiantly opposed to increased regulation when i interviewed lauren culbertson twitters head of us public policy for my book a hrefhttpswwwamazoncomexecobidosasin1982159596reasonmagazinea20emtech panicema she warned that chipping away at section 230 could quotentrench incumbentsquot and quotstifle innovation and competitionquot when activists sued twitter demanding that the site remove thenpresident donald trumps account twitter refused citing section 230 trump may now be gone from twitterhaving finally behaved in a way that manifestly violated the sites policiesbut without both the protections of section 230 and dorseys support for free speech the site might have acted much earlier and in much more heavyhanded fashion undoubtedly there are many democratic politicians and progressive media figures who wish that it hadp
ptwitters board has a hrefhttpswwwprnewswirecomnewsreleasesjackdorseystepsdownastwitterceoboardunanimouslyappointsctoparagagrawalassuccessor301432989htmlunanimously approveda parag agrawal the companys current chief technical officer as the new ceo agrawals main project at twitter has been bluesky an initiative designed to create quotan open and decentralized standard for social media that would help better control abusive and misleading information on its platformquot in an a hrefhttpswwwtechnologyreviewcom202011181012066emtechstagetwittersctoonmisinformationinterviewa a year ago agrawal commented that he thought twitter should quotfocus less on thinking about free speechquotp
pquotour role is not to be bound by the first amendment but our role is to serve a healthy public conversation and our moves are reflective of things that we believe lead to a healthier public conversationquot he said quotthe kinds of things that we do about this is focus less on thinking about free speech but thinking about how the times have changedquotp
pagrawal is correct of course that twitter is not bound by the first amendment as a private company it can make whatever moderation decisions it wants but under dorseys leadership twitter has been a place for wideranging conversation on topics of political importance a hrefhttpsreasoncom20201014hunterbidennewyorkpoststorymediafacebookburismaukrainedespite some undeniably questionable moderation decisionsa dorsey has resisted pressure from both democratic and republican lawmakers to bring the company more in line with their views whether agrawal will do the same remains to be seenp
pthe post a relnofollow hrefhttpsreasoncom20211129jackdorseytwitterresignationparagagrawalcensorshipjack dorseys exit from twitter could worsen tech censorshipa appeared first on a relnofollow hrefhttpsreasoncomreasoncomap | div picture source sizesminwidth 600px 331px 100vw typeimagewebp srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202111polspphotos7788372400x1350jpgwebp 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202111polspphotos7788371200x675jpgwebp 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202111polspphotos778837800x450jpgwebp 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202111polspphotos778837600x338jpgwebp 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202111polspphotos778837331x186jpgwebp 331w source sizesminwidth 600px 331px 100vw typeimagejpeg srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202111polspphotos7788372400x1350jpg 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202111polspphotos7788371200x675jpg 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202111polspphotos778837800x450jpg 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202111polspphotos778837600x338jpg 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202111polspphotos778837331x186jpg 331w img width1200 altpolspphotos778837 srchttpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202111polspphotos778837800x450jpg height675 picture div pjack dorsey resigned ceo twitter having served leadership roles company inception 2007p pquotive decided leave twitter believe company ready foundersquot explained hrefhttpswwwcnbccom20211129twitterceojackdorseyisexpectedtostepdownsourcessayhtmlstatementap pwhile facebook attracted significantly attention recent months widespread concernsa hrefhttpsreasoncom20211005facebookwhistlebloweroutagemarkzuckerbergsome overblownathat site spreads hate misinformation making teenagers depressed twitter preferred site media political classes virtual blue birds nest significantly fewer users facebook 300 million versus 2 billion importance policymakers means plays largerthanmerited role political discussion change leadership leads significant internal policy changes outsized effect news mediap panyone harbors concerns social media grown intolerant dissenting opinionstoo inclined silence viewpoints depart liberal orthodoxyshould worried dorsey leaving thats longserving ceo occasionally articulated ideological commitment principles free speech tech industry pioneers hrefhttpsreasoncom20200730congresswantstoregulatebigtechtheystilldontunderstandithauled congressa answer absurd questions far hrefhttpswwwpiratewirescompjackbenimblejackbequickmost hostilea idea government serve internets speech policep pwhile facebook ceo mark zuckerberg come support hrefhttpsreasoncom20210325perhapsfacebooksupportssection230reformbecauseitcouldmakebigtechevenmorepowerfultweaking section 230a change congress power content moderation policies twitter remained defiantly opposed increased regulation interviewed lauren culbertson twitters head public policy book hrefhttpswwwamazoncomexecobidosasin1982159596reasonmagazinea20emtech panicema warned chipping away section 230 quotentrench incumbentsquot quotstifle innovation competitionquot activists sued twitter demanding site remove thenpresident donald trumps account twitter refused citing section 230 trump gone twitterhaving finally behaved way manifestly violated sites policiesbut protections section 230 dorseys support free speech site acted earlier heavyhanded fashion undoubtedly democratic politicians progressive media figures wish hadp ptwitters board hrefhttpswwwprnewswirecomnewsreleasesjackdorseystepsdownastwitterceoboardunanimouslyappointsctoparagagrawalassuccessor301432989htmlunanimously approveda parag agrawal companys current chief technical officer new ceo agrawals main project twitter bluesky initiative designed create quotan open decentralized standard social media help better control abusive misleading information platformquot hrefhttpswwwtechnologyreviewcom202011181012066emtechstagetwittersctoonmisinformationinterviewa year ago agrawal commented thought twitter quotfocus thinking free speechquotp pquotour role bound amendment role serve healthy public conversation moves reflective things believe lead healthier public conversationquot said quotthe kinds things focus thinking free speech thinking times changedquotp pagrawal correct course twitter bound amendment private company moderation decisions wants dorseys leadership twitter place wideranging conversation topics political importance hrefhttpsreasoncom20201014hunterbidennewyorkpoststorymediafacebookburismaukrainedespite undeniably questionable moderation decisionsa dorsey resisted pressure democratic republican lawmakers bring company line views agrawal remains seenp pthe post relnofollow hrefhttpsreasoncom20211129jackdorseytwitterresignationparagagrawalcensorshipjack dorseys exit twitter worsen tech censorshipa appeared relnofollow hrefhttpsreasoncomreasoncomap |
61a5555cdf82b6d760075dc8 | Democracy in India: Down but Not Out | img altdemocracy in india down but not out srchttpswwwamericanpurposecomcontentimages202111slide16jpegpin democracys global trajectory over the last seventyfive yearsfrom its worldwide conflict with international communism during the cold war to the surge of democratization from the mid1970s to the mid1990s to the end and indeed partial reversal of its progress in the democratic recession of the last several yearsindia has played an important role the worlds most populous democracy it also qualifies as one of the least likely it includes many different linguistic social and religious groups and it had no real tradition of democratic governance or even national unity before its independence from great britain in 1947 despite these handicaps however and with a twentyonemonth hiatus from june 1975 to march 1977 india has remained staunchly democratic demonstrating both the breadth of democracys appeal and the strength of its institutionsuntil recently when it began to drift in an undemocratic directionppthe principal credit for the countrys initially democratic course belongs to modern indias two founders mohandas gandhi known as the mahatma the leader of the movement that secured independence and jawaharlal nehru for seventeen years thereafter indias prime minister both were educated in britain where they absorbed a commitment to democratic values the two determined that their country would become not only democratic but a civic democracy that honored and protected the rights of all its citizens including the 20 percent who were not as gandhi and nehru were hindus the largest minority religion was then and continues to be islam the faith of more than two hundred million indians today the two founders established the principle of secularism whereby all religions enjoyed equal legal standingppin the last decade however india has joined the ranks of the democratic backsliders secularism in particular has eroded in practice the architect of this regression is the countrys current prime minister narendra modi he led the bharatiya janata party bjp with its roots in indias centuryold hindu nationalist movement that gandhi and nehru vigorously opposed during their lifetimes to victories in the 2014 and 2019 national elections on both occasions it won a clear majority in the indian parliament the bjp had previously participated in governments but had always had to do so as part of multiparty coalitions the fact that it represented above all the interests of highcaste hindus the most influential although not numerically the largest segment of indias population had limited its appealppmodi managed to extend his partys electoral reach by emphasizing religion rather than caste and he did so by making clear his hostility to islam to its practitioners in india and to pakistan the neighboring country carved out of british india in 1947 where islam is the official state religion his strategy involved mobilizing the countrys hindu majority against alleged threats to it from muslimsppthe prime ministers electoral success stemmed as well from three additional sources his humble origins helped him to present himself as a populist opposing on behalf of the people as a whole what he designated as the countrys selfserving corrupt elite his particular target was the congress partyin nehrus day the countrys dominant political force but now severely reduced in political strength modi demonstrated formidable personal political skills he is also an energetic and often magnetic campaigner in addition he employed in both his victorious elections the most advanced digital technology to a far greater extent and to much better effect than his opponentsppin office modis government has tolerated encouraged and in some cases carried out antimuslim initiatives it has looked the other way when groups of hindu vigilantes have assaulted muslim communities it has enacted legislation harmful to the interests of muslims such as the law suspending the special status of indias only muslimmajority province kashmir it has intimidated directly and indirectly critics of these and other policies who work in the press and the universities it has worked to limit the legal protections muslims enjoy from indias courtsppin his book a hrefhttpsamznto3xxbv92emmodis india hindu nationalism and the rise of ethnic democracyema christophe jaffrelot who holds academic positions in paris at cerisciences pocns and in london at kings college recounts in great detail the prime ministers political rise and the way bjpdominated governments at both the national and provincial levels have worked to turn the civic secular liberal democracy that gandhi and nehru established into what he calls an ethnic democracy in which religious minorities have a legal and political status inferior to that of the majoritypdiv
span datapullquoteeven in its greatest triumph in 2019 the bjp received only 37 percent of the popular votespan
divpthe principal rationale that modis colleagues and followers give for their antimuslim activities are not based on facts the claim that all or even many indians who adhere to the islamic faith are terrorists for example or the assertion that muslims are displacing hindus demographically in part by the seduction of hindu women by muslim men in what those who propagate this allegation call a love jihad are not trueppsome features of the bjps appeal are however grounded in reality its harsh populist attacks on the opposition congress party gain credibility from the fact that the congress leadership is in practice determined by the nondemocratic principle of heredity a few years after nehrus death his daughter indira gandhi succeeded him as prime minister when she was assassinated the office passed to her son rajiv gandhi and when he too died violently his italianborn wife sonia became the partys leader her only qualification for the position was her marriage rajiv and sonias son rahul was the partys candidate for prime minister in the most recent election but he did not to put it mildly present a dynamic compelling alternative to mr modi moreover although indias muslims do not carry out acts of terrorism against their country the government of pakistan does which unfortunately only serves to increase antimuslim sentiment among indias hindusphrpwhile indias democratic slippage has been under way for the seven years that modi has been prime minister it is not necessarily destined to continue the reason that this is so goes back to democracys basic structure it is a hybrid form of government combining two equally important component parts one is popular sovereigntyfree and fair elections the other is liberty which comes in three varieties economic religious and political the first part involves how governments are chosen the second what governments can and more importantly cannot do once in power the distinction is a theme of my 2006 book a hrefhttpswwwamazoncomdemocracysgoodnamepopulargovernmentdp1586485148refsr_1_2keywordsmichaelmandelbaumdemocracy27sgoodnameqid1636744868sbookssr12emdemocracys good name the rise and risks of the worlds most popular form of governmentemappthe bjp used its success in elections to violate norms of liberty an electoral defeat for the party would bring to power a different government with every chance that the new leaders would be more committed to civic than to ethnic nationalism and such a development is entirely possibleppelections will continue to be held in india they will not be suspended and cannot be successfully rigged indians expect value and participate enthusiastically in them and while modis bjp has managed to tilt the electoral playing field in its favor by raising far more money than its opponents and constraining the operations of the countrys electoral oversight body the country is too big and its citizens too rambunctious to permit the governing party to control the outcome of national votingppeven in its greatest triumph in 2019 moreover the bjp received only 37 percent of the popular vote the rest being divided among the congress party and a number of regional parties almost twothirds of the electorate that is spurned modi in india as in other countries such as great britain with similar electoral systems a mere plurality of the votes can yield a majority of the seats in the legislature historically moreover in the countrys many national provincial and local elections incumbents have regularly lost power that did not occur in 2019 but the election of that year took place under special circumstances shortly before the voting india suffered a pakistani terrorist attack in kashmir in which forty people died modi ordered a retaliatory strike on pakistan and claimed without convincing evidence that the indian strike had inflicted serious damage he then campaigned as the stalwart defender of the nation the tendency of the public to rally around the leader of the moment in such circumstances in evidence in many countries throughout history surely added to his vote totalppunder normal circumstances indian incumbents have often lost power because they have not fulfilled their campaign promises modi has not fulfilled his the acceleration of economic growth and the alleviation of economic inequality that he promised in 2014 have not materialized nor did his government perform well in coping with the covid19 pandemic in 2020 in the elections during that year to choose the governments of several major provinces he campaigned vigorously but achieved disappointing results suggesting that his formula for political success might be losing its potencyppthe course of indian politics like the course of politics in every country is unpredictable it is impossible to know the outcome of the next national election scheduled for 2024 but it is not at all impossible for the bjp to lose it elections have consequences and one consequence of such an outcome could well be the end of the policies that narendra modi and his party have carried out since 2014 and a return to the older and more fully democratic political tradition of the india of mohandas gandhi and jawaharlal nehruppa hrefhttpswwwamericanpurposecomauthormichaelmandelbaumstrongemmichael mandelbaumemstrongaem is the christian a herter professor emeritus of american foreign policy at the johns hopkins school of advanced international studies and a member of the editorial board of emamerican purposeem his new history of american foreign policy from 1765 to 2015 ema hrefhttpswwwamazoncomfouragesamericanforeignpolicydp0197621791refsr_1_1cridbeetklcuse72keywordsmichaelmandelbaumthefouragesofamericanforeignpolicyqid1636745166sbookssprefixmichaelmandelbaum2cstripbooks2c166sr11the four ages of american foreign policy weak power great power superpower hyperpoweraem will be published in june 2022emppppemmodi image httpscommonswikimediaorgwindexphpcurid38865695emppemnehru image afp httpscommonswikimediaorgwindexphpcurid37641536emppemgandhi image public domain httpscommonswikimediaorgwindexphpcurid76882768emp | img altdemocracy india srchttpswwwamericanpurposecomcontentimages202111slide16jpegpin democracys global trajectory seventyfive yearsfrom worldwide conflict international communism cold war surge democratization mid1970s mid1990s end partial reversal progress democratic recession yearsindia played important role worlds populous democracy qualifies likely includes different linguistic social religious groups real tradition democratic governance national unity independence great britain 1947 despite handicaps twentyonemonth hiatus june 1975 march 1977 india remained staunchly democratic demonstrating breadth democracys appeal strength institutionsuntil recently began drift undemocratic directionppthe principal credit countrys initially democratic course belongs modern indias founders mohandas gandhi known mahatma leader movement secured independence jawaharlal nehru seventeen years indias prime minister educated britain absorbed commitment democratic values determined country democratic civic democracy honored protected rights citizens including 20 percent gandhi nehru hindus largest minority religion continues islam faith million indians today founders established principle secularism religions enjoyed equal legal standingppin decade india joined ranks democratic backsliders secularism particular eroded practice architect regression countrys current prime minister narendra modi led bharatiya janata party bjp roots indias centuryold hindu nationalist movement gandhi nehru vigorously opposed lifetimes victories 2014 2019 national elections occasions won clear majority indian parliament bjp previously participated governments multiparty coalitions fact represented interests highcaste hindus influential numerically largest segment indias population limited appealppmodi managed extend partys electoral reach emphasizing religion caste making clear hostility islam practitioners india pakistan neighboring country carved british india 1947 islam official state religion strategy involved mobilizing countrys hindu majority alleged threats muslimsppthe prime ministers electoral success stemmed additional sources humble origins helped present populist opposing behalf people designated countrys selfserving corrupt elite particular target congress partyin nehrus day countrys dominant political force severely reduced political strength modi demonstrated formidable personal political skills energetic magnetic campaigner addition employed victorious elections advanced digital technology far greater extent better effect opponentsppin office modis government tolerated encouraged cases carried antimuslim initiatives looked way groups hindu vigilantes assaulted muslim communities enacted legislation harmful interests muslims law suspending special status indias muslimmajority province kashmir intimidated directly indirectly critics policies work press universities worked limit legal protections muslims enjoy indias courtsppin book hrefhttpsamznto3xxbv92emmodis india hindu nationalism rise ethnic democracyema christophe jaffrelot holds academic positions paris cerisciences pocns london kings college recounts great detail prime ministers political rise way bjpdominated governments national provincial levels worked turn civic secular liberal democracy gandhi nehru established calls ethnic democracy religious minorities legal political status inferior majoritypdiv span datapullquoteeven greatest triumph 2019 bjp received 37 percent popular votespan divpthe principal rationale modis colleagues followers antimuslim activities based facts claim indians adhere islamic faith terrorists example assertion muslims displacing hindus demographically seduction hindu women muslim men propagate allegation love jihad trueppsome features bjps appeal grounded reality harsh populist attacks opposition congress party gain credibility fact congress leadership practice determined nondemocratic principle heredity years nehrus death daughter indira gandhi succeeded prime minister assassinated office passed son rajiv gandhi died violently italianborn wife sonia partys leader qualification position marriage rajiv sonias son rahul partys candidate prime minister recent election mildly present dynamic compelling alternative mr modi indias muslims carry acts terrorism country government pakistan unfortunately serves increase antimuslim sentiment indias hindusphrpwhile indias democratic slippage way seven years modi prime minister necessarily destined continue reason goes democracys basic structure hybrid form government combining equally important component parts popular sovereigntyfree fair elections liberty comes varieties economic religious political involves governments chosen second governments importantly power distinction theme 2006 book hrefhttpswwwamazoncomdemocracysgoodnamepopulargovernmentdp1586485148refsr_1_2keywordsmichaelmandelbaumdemocracy27sgoodnameqid1636744868sbookssr12emdemocracys good rise risks worlds popular form governmentemappthe bjp success elections violate norms liberty electoral defeat party bring power different government chance new leaders committed civic ethnic nationalism development entirely possibleppelections continue held india suspended successfully rigged indians expect value participate enthusiastically modis bjp managed tilt electoral playing field favor raising far money opponents constraining operations countrys electoral oversight body country big citizens rambunctious permit governing party control outcome national votingppeven greatest triumph 2019 bjp received 37 percent popular vote rest divided congress party number regional parties twothirds electorate spurned modi india countries great britain similar electoral systems mere plurality votes yield majority seats legislature historically countrys national provincial local elections incumbents regularly lost power occur 2019 election year took place special circumstances shortly voting india suffered pakistani terrorist attack kashmir people died modi ordered retaliatory strike pakistan claimed convincing evidence indian strike inflicted damage campaigned stalwart defender nation tendency public rally leader moment circumstances evidence countries history surely added vote totalppunder normal circumstances indian incumbents lost power fulfilled campaign promises modi fulfilled acceleration economic growth alleviation economic inequality promised 2014 materialized government perform coping covid19 pandemic 2020 elections year choose governments major provinces campaigned vigorously achieved disappointing results suggesting formula political success losing potencyppthe course indian politics like course politics country unpredictable impossible know outcome national election scheduled 2024 impossible bjp lose elections consequences consequence outcome end policies narendra modi party carried 2014 return older fully democratic political tradition india mohandas gandhi jawaharlal nehruppa hrefhttpswwwamericanpurposecomauthormichaelmandelbaumstrongemmichael mandelbaumemstrongaem christian herter professor emeritus american foreign policy johns hopkins school advanced international studies member editorial board emamerican purposeem new history american foreign policy 1765 2015 ema hrefhttpswwwamazoncomfouragesamericanforeignpolicydp0197621791refsr_1_1cridbeetklcuse72keywordsmichaelmandelbaumthefouragesofamericanforeignpolicyqid1636745166sbookssprefixmichaelmandelbaum2cstripbooks2c166sr11the ages american foreign policy weak power great power superpower hyperpoweraem published june 2022emppppemmodi image httpscommonswikimediaorgwindexphpcurid38865695emppemnehru image afp httpscommonswikimediaorgwindexphpcurid37641536emppemgandhi image public domain httpscommonswikimediaorgwindexphpcurid76882768emp |
61a5557cdf82b6d760075dd0 | ZOOM EVENT: David Starkey and Brendan O’Neill live | pthe post a relnofollow hrefhttpswwwspikedonlinecom20211129zoomeventdavidstarkeyandbrendanoneilllivezoom event david starkey and brendan oneill livea appeared first on a relnofollow hrefhttpswwwspikedonlinecomspikedap | pthe post relnofollow hrefhttpswwwspikedonlinecom20211129zoomeventdavidstarkeyandbrendanoneilllivezoom event david starkey brendan oneill livea appeared relnofollow hrefhttpswwwspikedonlinecomspikedap |
61a555b7df82b6d760075dd2 | Chevron deference at stake in fight over payments for hospital drugs | pover at scotusblog ive written a case preview for a hrefhttpswwwscotusblogcomcasefilescasesamericanhospitalassociationvbecerra2emamerican hospital association v becerraema which is being argued tomorrow the case is not only important for what it could mean for administrative law its important in its own right because billions of dollars in hospital payments are at stakep
blockquotepthe case centers on a hrefhttpscasetextcomstatuteunitedstatescodetitle42thepublichealthandwelfarechapter7socialsecuritysubchapterxviiihealthinsuranceforagedanddisabledpartbsupplementarymedicalinsurancebenefitsforagedanddisabledsection1395lpaymentofbenefitsparta of a 2003 law that gives medicare two options for how to pay for [certain expensive outpatient] drugs under the first option medicare would survey hospitals about what it cost them to acquire the drugs medicare would then draw on the survey data and reimburse hospitals for their average acquisition costs subject to variations for different types of hospitals its a roughcut way to make hospitals whole without requiring them to submit receipts for every drug purchasep
pbut medicare immediately encountered a problem it just wasnt practical to survey hospitals about their acquisition costs fortunately the law anticipated that possibility and gave medicare a second option in the absence of survey data medicare could pay the average price for the drug as calculated and adjusted by the secretary [of health and human services] as necessary for purposes of this [option]p
pthis approach turned out to be costly a drugs average price is fixed elsewhere in the medicare statute typically at 106 of the drugs sale price as a policy matter this average sales price plus 6 approach is hard to defend because 6 of a large number is bigger than 6 of a small number hospitals have an incentive to dispense more expensive drugs even when there are cheaper and equally effective therapiesp
pother developments soon made the payment policy look even more dubious back in 1992 congress created something called the 340b program to support healthcare providers that serve poor and disadvantaged communities eligible providers get steep discounts on the drugs that they purchase anywhere between 20 and 50 of the normal pricep
pinitially few hospitals qualified for the 340b program today a hrefhttpswwwgovinfogovcontentpkgfr20171113pdf201723932pdfpage140more than twothirdsa of a hrefhttpswwwahaorgstatisticsfastfactsushospitalsnonprofit hospitalsa participate forprofits are excluded from the program for years medicare kept paying those 340b hospitals 106 of the average sales price of their outpatient drugs the upshot was that hospitals were buying highly discounted drugs and then charging the federal government full price that heightened the incentive to prescribe very expensive medications which is partly why medicare spending on outpatient drugs has ballooned growing an average of a hrefhttpsaspehhsgovtopicsprescriptiondrugsothermedicalproductsprescriptiondrugs0medicarepartbdrugspending81 per yeara from 2006 through 2017pblockquote
pill also be recapping the oral argument and discussing the outcome when the case is resolved read the whole thing a hrefhttpswwwscotusblogcom202111chevrondeferenceatstakeinfightoverpaymentsforhospitaldrugshereap
pa hrefhttptwittercomnicholas_bagleynicholas_bagleyapthe post a hrefhttpstheincidentaleconomistcomwordpresschevrondeferenceatstakeinfightoverpaymentsforhospitaldrugschevron deference at stake in fight over payments for hospital drugsa first appeared on a hrefhttpstheincidentaleconomistcomwordpressthe incidental economista | pover scotusblog ive written case preview hrefhttpswwwscotusblogcomcasefilescasesamericanhospitalassociationvbecerra2emamerican hospital association v becerraema argued tomorrow case important mean administrative law important right billions dollars hospital payments stakep blockquotepthe case centers ona hrefhttpscasetextcomstatuteunitedstatescodetitle42thepublichealthandwelfarechapter7socialsecuritysubchapterxviiihealthinsuranceforagedanddisabledpartbsupplementarymedicalinsurancebenefitsforagedanddisabledsection1395lpaymentofbenefitsparta 2003 law gives medicare options pay [certain expensive outpatient] drugs option medicare survey hospitals cost acquire drugs medicare draw survey data reimburse hospitals average acquisition costs subject variations different types hospitals roughcut way hospitals requiring submit receipts drug purchasep pbut medicare immediately encountered problem wasnt practical survey hospitals acquisition costs fortunately law anticipated possibility gave medicare second option absence survey data medicare pay average price drug calculated adjusted secretary [of health human services] necessary purposes [option]p pthis approach turned costly drugs average price fixed medicare statute typically 106 drugs sale price policy matter average sales price plus 6 approach hard defend 6 large number bigger 6 small number hospitals incentive dispense expensive drugs cheaper equally effective therapiesp pother developments soon payment policy look dubious 1992 congress created called 340b program support healthcare providers serve poor disadvantaged communities eligible providers steep discounts drugs purchase 20 50 normal pricep pinitially hospitals qualified 340b program todaya hrefhttpswwwgovinfogovcontentpkgfr20171113pdf201723932pdfpage140more twothirdsaofa hrefhttpswwwahaorgstatisticsfastfactsushospitalsnonprofit hospitalsaparticipate forprofits excluded program years medicare kept paying 340b hospitals 106 average sales price outpatient drugs upshot hospitals buying highly discounted drugs charging federal government price heightened incentive prescribe expensive medications partly medicare spending outpatient drugs ballooned growing average ofa hrefhttpsaspehhsgovtopicsprescriptiondrugsothermedicalproductsprescriptiondrugs0medicarepartbdrugspending81 yearafrom 2006 2017pblockquote pill recapping oral argument discussing outcome case resolved read thing hrefhttpswwwscotusblogcom202111chevrondeferenceatstakeinfightoverpaymentsforhospitaldrugshereap pa hrefhttptwittercomnicholas_bagleynicholas_bagleyapthe post hrefhttpstheincidentaleconomistcomwordpresschevrondeferenceatstakeinfightoverpaymentsforhospitaldrugschevron deference stake fight payments hospital drugsa appeared hrefhttpstheincidentaleconomistcomwordpressthe incidental economista |
61a55626df82b6d760075dda | Bitcoin and Electricity | pimg sizesmaxwidth 301px 100vw 301px srchttpmarginalrevolutioncomwpcontentuploads202111maxpixelnetcryptocurrencybitcoinminingbusinessfinance65607351024x1024png alt width301 srcsethttpmarginalrevolutioncomwpcontentuploads202111maxpixelnetcryptocurrencybitcoinminingbusinessfinance65607351024x1024png 1024w httpmarginalrevolutioncomwpcontentuploads202111maxpixelnetcryptocurrencybitcoinminingbusinessfinance6560735300x300png 300w httpmarginalrevolutioncomwpcontentuploads202111maxpixelnetcryptocurrencybitcoinminingbusinessfinance6560735150x150png 150w httpmarginalrevolutioncomwpcontentuploads202111maxpixelnetcryptocurrencybitcoinminingbusinessfinance6560735768x769png 768w httpmarginalrevolutioncomwpcontentuploads202111maxpixelnetcryptocurrencybitcoinminingbusinessfinance65607351534x1536png 1534w httpmarginalrevolutioncomwpcontentuploads202111maxpixelnetcryptocurrencybitcoinminingbusinessfinance6560735900x900png 900w httpmarginalrevolutioncomwpcontentuploads202111maxpixelnetcryptocurrencybitcoinminingbusinessfinance6560735png 1918w classwpimage82456 height301how many times have you read a hrefhttpswwwnytimescominteractive20210903climatebitcoincarbonfootprintelectricityhtmlsomething like thisa bitcoin uses as much electricity as malaysia or sweden or denmark or chile what a bore have you ever wondered however why the comparison is to countries why dont they ever tell you what would seem to be a more natural comparison which is how much bitcoin spends on electricityp
pthe reason is that electricity is incredibly cheap so bitcoin electricity expenditures priced in dollars dont look very large bitcoin uses something like 100 terra watt hours twh of electricity annually depending on the price of bitcoin but a twh costs less than 100 million 10 cents per kwh times 1000000000 thus bitcoin spends say 10 billion on electricity annually in fact its less than this since bitcoin miners can be located in places where electricity prices are especially cheapp
p10 billion in spending isnt a lot its less than the world a hrefhttpswwwglobenewswirecomnewsrelease2020011319694830enthetoothpastemarketwasvaluedatusd2609billionin2018anditisprojectedtoreachusd3698billionby2024registeringacagrof61htmlspends on toothpastea 30b much less than the a hrefhttpsmoneycnncomgalleries2011pf1105gallerymoney_wasters4htmlus spends on cigarettesa 80b and considerably less than the a hrefhttpswwwwolframalphacominputi28annualgovernmentcurrentexpendituresofunitedstates292f365us federal government spends in emone dayema 1865 billionp
pif we think of the 10 billion spent by bitcoin as a security budget as the spending secures the blockchain it also compares reasonably to us bank spending on cybersecurity a hrefhttpswwwcnbccom20210614bankofamericaspendsover1billionperyearoncybersecurityhtmlbank of americaa alone spent more than 1 billion on its cybersecurity budget and the total financial security budget is a hrefhttpswwwmarketwatchcompressreleaseusfinancialservicescybersecuritymarketsizebyglobalmajorcompaniesprofilecompetitivelandscapeandkeyregions203020210914teslaymuch largerap
pnone of this proves that bitcoin spending is well spent but it puts things in context it is also true of course that most of the new crypto platforms such as a hrefhttpselrondcomelronda i am an advisor use proof of stake which uses much less electricity than proof of workp
pstill the next time you read that bitcoin consumes as much electricity as sweden substitute bitcoin spends as much on electricity as americans spend on a hrefhttpsnews4sanantoniocomnewsnationworldamericansexpectedtospendrecord10billiononhalloweenin2021halloween costumesap
pphoto credit a hrefhttpswwwmaxpixelnetcryptocurrencybitcoinminingbusinessfinance6560735maxpixelap
pthe post a relnofollow hrefhttpmarginalrevolutioncommarginalrevolution202111bitcoinandelectricityhtmlbitcoin and electricitya appeared first on a relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap | pimg sizesmaxwidth 301px 100vw 301px srchttpmarginalrevolutioncomwpcontentuploads202111maxpixelnetcryptocurrencybitcoinminingbusinessfinance65607351024x1024png alt width301 srcsethttpmarginalrevolutioncomwpcontentuploads202111maxpixelnetcryptocurrencybitcoinminingbusinessfinance65607351024x1024png 1024w httpmarginalrevolutioncomwpcontentuploads202111maxpixelnetcryptocurrencybitcoinminingbusinessfinance6560735300x300png 300w httpmarginalrevolutioncomwpcontentuploads202111maxpixelnetcryptocurrencybitcoinminingbusinessfinance6560735150x150png 150w httpmarginalrevolutioncomwpcontentuploads202111maxpixelnetcryptocurrencybitcoinminingbusinessfinance6560735768x769png 768w httpmarginalrevolutioncomwpcontentuploads202111maxpixelnetcryptocurrencybitcoinminingbusinessfinance65607351534x1536png 1534w httpmarginalrevolutioncomwpcontentuploads202111maxpixelnetcryptocurrencybitcoinminingbusinessfinance6560735900x900png 900w httpmarginalrevolutioncomwpcontentuploads202111maxpixelnetcryptocurrencybitcoinminingbusinessfinance6560735png 1918w classwpimage82456 height301how times read hrefhttpswwwnytimescominteractive20210903climatebitcoincarbonfootprintelectricityhtmlsomething like thisa bitcoin uses electricity malaysia sweden denmark chile bore wondered comparison countries dont tell natural comparison bitcoin spends electricityp pthe reason electricity incredibly cheap bitcoin electricity expenditures priced dollars dont look large bitcoin uses like 100 terra watt hours twh electricity annually depending price bitcoin twh costs 100 million 10 cents kwh times 1000000000 bitcoin spends 10 billion electricity annually fact bitcoin miners located places electricity prices especially cheapp p10 billion spending isnt lot world hrefhttpswwwglobenewswirecomnewsrelease2020011319694830enthetoothpastemarketwasvaluedatusd2609billionin2018anditisprojectedtoreachusd3698billionby2024registeringacagrof61htmlspends toothpastea 30b hrefhttpsmoneycnncomgalleries2011pf1105gallerymoney_wasters4htmlus spends cigarettesa 80b considerably hrefhttpswwwwolframalphacominputi28annualgovernmentcurrentexpendituresofunitedstates292f365us federal government spends emone dayema 1865 billionp pif think 10 billion spent bitcoin security budget spending secures blockchain compares reasonably bank spending cybersecurity hrefhttpswwwcnbccom20210614bankofamericaspendsover1billionperyearoncybersecurityhtmlbank americaa spent 1 billion cybersecurity budget total financial security budget hrefhttpswwwmarketwatchcompressreleaseusfinancialservicescybersecuritymarketsizebyglobalmajorcompaniesprofilecompetitivelandscapeandkeyregions203020210914teslaymuch largerap pnone proves bitcoin spending spent puts things context true course new crypto platforms hrefhttpselrondcomelronda advisor use proof stake uses electricity proof workp pstill time read bitcoin consumes electricity sweden substitute bitcoin spends electricity americans spend hrefhttpsnews4sanantoniocomnewsnationworldamericansexpectedtospendrecord10billiononhalloweenin2021halloween costumesap pphoto credit hrefhttpswwwmaxpixelnetcryptocurrencybitcoinminingbusinessfinance6560735maxpixelap pthe post relnofollow hrefhttpmarginalrevolutioncommarginalrevolution202111bitcoinandelectricityhtmlbitcoin electricitya appeared relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap |
61a556f6df82b6d760075df0 | The good news about the Omicron variant | pspanit may not feel like it but with omicron the new covid variant we need to count our blessingsspanp
pspanomicron has been detected and may have first arisen in gauteng province south africa there have only been a few hundred cases detected so its hard to say much about it with any real certainty but it appears to be more transmissible and there are concerns that immunity whether from vaccination or prior infection will be less effective against it there have been as i write three cases detected in the uk and there are real and justified fears that we are heading once again into a lockdown christmas spanp
pspanbut nonetheless we have been very luckyspanp
divdiv
pspanwe mustnt forget that the virus is constantly mutating every time it copies itself there is a chance that it will make some minor error most of those mutations either have no effect or make it less effective at spreading but every so often one will improve it perhaps make it harder for the immune system to see or make the virus quicker at copying itselfspanp
pspanthe other new variants notably alpha and delta had several mutations but omicron has dozens around 50 and 10 of them are on the bits of the spike protein on the viruss surface which bind with our cells the receptor binding domains spana relnoopener hrefhttpstwittercomjeremyfarrar target_blankspansir jeremy farrarspanaspan the director of the wellcome trust and former member of sage tells me that these are exactly the kind of mutations which virologists have been expecting and dreading its biologically plausible that they will drive higher transmission theyve been identified before as ones we should be really careful aboutspanp
diva hrefhttpsunherdcom202111whatschinagotagainstgamingrefinnara hrefhttpsunherdcom202111whatschinagotagainstgamingrefinnarimg srchttpsunherdcomwpcontentuploads2021112gettyimages1194779570scaled1300x185jpgadiva hrefhttpsunherdcom202111whatschinagotagainstgamingrefinnarspanmore from this authorspanaa hrefhttpsunherdcom202111whatschinagotagainstgamingrefinnarh5is the who inventing diseasesh5apa hrefhttpsunherdcom202111whatschinagotagainstgamingrefinnarspanbyspan tom chiversapdivadiv
pspanso far it doesnt sound very lucky but in one mutation omicron has been kind to us like alpha before it it has a particular mutation spanispan6970delspanispan two missing rna letters in its genome part of the s gene which codes for the spike protein by happy chance those missing letters are at one of three places that many pcr tests look atspanp
pspanwhat it means is that if a pcr test comes back positive on two out of its three areas if it has an sgene dropout then you can be pretty sure youve got one of the variants it means that alpha last year and now omicron can be tracked pretty effectively just with pcr testing even without sequencing the genomes you can see where these sgene dropout results are happening and itll give you a good idea of how the variant is spreadingspanp
pspanits a complete gift that the sgene dropout hits this variant says spana relnoopener hrefhttpswwwebiacukaboutpeopleewanbirney target_blankspanewan birneyspanaspan the deputy directorgeneral of the european molecular biology laboratory if it didnt we would have much less of an idea where omicron is weve actually been lucky twice if delta hadnt replaced alpha then the sgene dropout wouldnt have told us anything because spanispanbothspanispan the circulating variants would have had itspanp
pspanso far so good but is the new variant more transmissible andor more able to bypass our immunity whether from vaccines or infection and is it more or less dangerous to people who catch itspanp
pspanthese are hard questions to answer because at the moment we only have data from south africa and south africas population is tricky to compare with ours spana relnoopener hrefhttpsourworldindataorgagestructuretextmedian20age2c20195020to202015 target_blankspanits younger for a startspanaspan the median south african is 26years old while the median brit is 40 its also spana relnoopener hrefhttpsourworldindataorgexplorerscoronavirusdataexplorerzoomtoselectiontruefacetnonepickersortascpickermetriclocationmetricpeoplevaccinated28bydose29interval7dayrollingaveragerelativetopopulationtruealignoutbreaksfalsecountrygbrzaf target_blankspanmuch less vaccinatedspanaspan somewhere around 75 of britons have been doublejabbed while barely a quarter have in south africa which is to my surprise spana relnoopener hrefhttpswwwnews24comhealth24medicalinfectiousdiseasescoronavirusvaccinesupplyisoutweighingdemandexpertssharetheirviewsonhowtoincreaseuptake20211126 target_blankspanmore to do with uptake than supplyspanaspan it has also had spana relnoopener hrefhttpsourworldindataorgexplorerscoronavirusdataexplorerzoomtoselectiontruefacetnonepickersortascpickermetriclocationhidecontrolstruemetricconfirmedcasesintervalcumulativerelativetopopulationtruealignoutbreaksfalsecountrygbrzaf target_blankspanfar fewer confirmed cases per capitaspanaspanspanp
pspanthat said we can make some guesses when a new variant emerges its difficult to tell whether it has spread because it is better at spreading or because it happens to have arisen in a convenient place imagine a virus which happened to mutate into a new variant in someone who was about to go to a major conference it might infect hundreds of people and show up all over the country but it wouldnt be because it was any more transmissible it was just that it got luckyspanp
diva hrefhttpsunherdcom202111thegreatclimatechangefallacyrefinnara hrefhttpsunherdcom202111thegreatclimatechangefallacyrefinnarimg srchttpsunherdcomwpcontentuploads202111gettyimages1350600662300x183jpgadiva hrefhttpsunherdcom202111thegreatclimatechangefallacyrefinnarspanmore from this authorspanaa hrefhttpsunherdcom202111thegreatclimatechangefallacyrefinnarh5the great climate change fallacyh5apa hrefhttpsunherdcom202111thegreatclimatechangefallacyrefinnarspanbyspan tom chiversapdivadiv
pspanwith omicron this seems unlikely to be the case thanks to the sgene dropout we can see that its spreading faster than youd expect farrar says that there has been a clear upswing of transmission in gauteng which seems to be driven by the variant it probably can outcompete delta says spana relnoopener hrefhttpsunherdcom202012howdangerousisthecovidmutationtextbirney2c20andbabak20javid2c20an20immunology20lab target_blankspanbabak javidspanaspan an immunology lab director at the university of california san francisco although by how much is still up in the air spanp
pspanis that because its better at spreading in general or because it can evade immunity so far we dont have the data to say for sure soon well start to get results from laboratory studies and later from epidemiological observations but spana relnoopener hrefhttpswwwcrickacukresearchfindaresearcherrupertbeale target_blankspanrupert bealespanaspan leader of the cell biology of infection lab at the crick institute thinks its a few weeks before we get useful information and the other side of christmas before we know anything definitivespanp
pspanbut on the plus side antibodies arent the only part of our immune system we also have tcells which are less easily fooled by mutations to oversimplify antibodies stop you getting infected in the first place but tcells stop you from getting very ill so javid and birney think it is plausible that omicron will spread quite easily among vaccinated andor previously infected people but will be less likely to kill them or make them severely illspanp
pthere has also been a relnoopener hrefhttpstwittercomsailorrooscoutstatus1464622927333232640 target_blankspeculationa that omicron is inherently less deadly to people with no preexisting immunity thats not impossible but everyone i spoke to said that any definitive conclusions are premature the speculation is extremely uninformed says beale we just dont know until it gets into a more vulnerable population which sadly it seems its likely to we can hope its less pathogenic but its foolish to make that assumptionp
pspanso it might be better at spreading and able to escape our immunity to at least some degree and while its theoretically possible it might be less deadly thats certainly not a proposition we want to put any weight on the question is what should we do and are we facing a second bleak covid winterspanp
pspanthe pandemic should have taught us that acting early is usually better than acting late and that preparing for worstcase scenarios is important its like chess says beale you play your moves in the most flexible order if we assume itll all be ok we might be right but if were wrong well end up with omicron spreading all over the place whereas if we assume itll be pretty bad we can always open up again later onspanp
pspanive seen a lot of people spana relnoopener hrefhttpstwittercomfirefoxx66status1464664975809691650s21 target_blankspansome of themspana a relnoopener hrefhttpstwittercomnoahpinionstatus1464942148839608320ref_srctwsrc5egoogle7ctwcamp5eserp7ctwgr5etweet target_blankspanvery sensiblespanaspan suggesting that theres no point closing borders to south africa because variants will get through anyway and that its just punishing countries for doing good surveillance but i think they are wrong spanp
pspanyes the variant will get through if it hasnt already farrar points out that it was first identified on 11 november and its sequence suggests that it had already been circulating for some time before then i think it may already be on every continent he says but that doesnt mean that theres no point in trying to reduce its spread border closures might buy you a little time birney agrees shutting the borders until we understand it minimising the seeding events is a good rational movespanp
diva hrefhttpsunherdcom202110themenwhofailedbritainrefinnara hrefhttpsunherdcom202110themenwhofailedbritainrefinnarimg srchttpsunherdcomwpcontentuploads2021102gettyimages12352517861copye1634122087853300x151jpgadiva hrefhttpsunherdcom202110themenwhofailedbritainrefinnarspanmore from this authorspanaa hrefhttpsunherdcom202110themenwhofailedbritainrefinnarh5the men who failed britainh5apa hrefhttpsunherdcom202110themenwhofailedbritainrefinnarspanbyspan tom chiversapdivadiv
pspanits true that theres a risk of punishing countries for responsible surveillance but i dont see what the alternative is pretending that they spanispandontspanispan have lots of omicron circulating perhaps the thing to do is spanispanalsospanispan put restrictions on countries with poor surveillancespanp
pspanbecause buying a little time might be important if nothing else it gives us time to understand it if omicron is highly virulent and vaccineresistant then our best response will be rather different to what it would be if it isnt it also gives us a chance to get more boosters in arms and to stockpile antiviral drugs spanp
pspanall the same arguments apply to other nonpharmaceutical interventions such as introducing vaccine passports or asking people to work from home if possible but there are other things britain can do too spanp
pspanone thing is to hugely increase our vaccine manufacturing capacity something which would be good for us and for the world rolling out childrens vaccines and booster jabs faster wouldnt hurt one scientist i spoke to suggested making antiviral meds available by post when people get a positive result they need to be given quickly to have a good effect so you cant rely on gp appointments you need to link them to track amp trace cheaper quicker pcr testing at airports would helpspanp
pspanbut while those measures are important theyre not addressing the root of the issue for farrar the emergence of omicron is just another reminder that we need to vaccinate the world not just the rich world theres been political drift for months now in terms of access to vaccines he said the rich world thought it was over so theyve been kicking it into the long grass variants like omicron will continue to arise until the world has a decent level of immunityspanp
diva hrefhttpsunherdcom202111whyrotterdameruptedrefinnara hrefhttpsunherdcom202111whyrotterdameruptedrefinnarimg srchttpsunherdcomwpcontentuploads20211121nov300x180jpgadiva hrefhttpsunherdcom202111whyrotterdameruptedrefinnarspansuggested readingspanaa hrefhttpsunherdcom202111whyrotterdameruptedrefinnarh5why rotterdam eruptedh5apa hrefhttpsunherdcom202111whyrotterdameruptedrefinnarspanbyspan senay boztasapdivadiv
pweve been lucky with omicron but it may well still end up becoming the dominant strain just as delta did before it if it doesnt then another one will come along and it will be incredibly disruptive says farrar everyones putting restrictions in certainly to avoid another lockdown christmas we need to act nowp
pspanbut if we want to be sure we dont have another one next year we need to get this pandemic behind us and that means billions more doses of vaccine distributed around the world we wont always be so luckyspanp
a hrefhttpsunherdcom202111thegoodnewsabouttheomicronvariantappcommentsview 47 commentsa | pspanit feel like omicron new covid variant need count blessingsspanp pspanomicron detected arisen gauteng province south africa cases detected hard real certainty appears transmissible concerns immunity vaccination prior infection effective write cases detected uk real justified fears heading lockdown christmasspanp pspanbut nonetheless luckyspanp divdiv pspanwe mustnt forget virus constantly mutating time copies chance minor error mutations effect effective spreading improve harder immune system virus quicker copying itselfspanp pspanthe new variants notably alpha delta mutations omicron dozens 50 10 bits spike protein viruss surface bind cells receptor binding domains spana relnoopener hrefhttpstwittercomjeremyfarrar target_blankspansir jeremy farrarspanaspan director wellcome trust member sage tells exactly kind mutations virologists expecting dreading biologically plausible drive higher transmission theyve identified ones careful aboutspanp diva hrefhttpsunherdcom202111whatschinagotagainstgamingrefinnara hrefhttpsunherdcom202111whatschinagotagainstgamingrefinnarimg srchttpsunherdcomwpcontentuploads2021112gettyimages1194779570scaled1300x185jpgadiva hrefhttpsunherdcom202111whatschinagotagainstgamingrefinnarspanmore authorspanaa hrefhttpsunherdcom202111whatschinagotagainstgamingrefinnarh5is inventing diseasesh5apa hrefhttpsunherdcom202111whatschinagotagainstgamingrefinnarspanbyspan tom chiversapdivadiv pspanso far doesnt sound lucky mutation omicron kind like alpha particular mutation spanispan6970delspanispan missing rna letters genome s gene codes spike protein happy chance missing letters places pcr tests look atspanp pspanwhat means pcr test comes positive areas sgene dropout pretty sure youve got variants means alpha year omicron tracked pretty effectively pcr testing sequencing genomes sgene dropout results happening itll good idea variant spreadingspanp pspanits complete gift sgene dropout hits variant says spana relnoopener hrefhttpswwwebiacukaboutpeopleewanbirney target_blankspanewan birneyspanaspan deputy directorgeneral european molecular biology laboratory didnt idea omicron weve actually lucky twice delta hadnt replaced alpha sgene dropout wouldnt told spanispanbothspanispan circulating variants itspanp pspanso far good new variant transmissible andor able bypass immunity vaccines infection dangerous people catch itspanp pspanthese hard questions answer moment data south africa south africas population tricky compare spana relnoopener hrefhttpsourworldindataorgagestructuretextmedian20age2c20195020to202015 target_blankspanits younger startspanaspan median south african 26years old median brit 40 spana relnoopener hrefhttpsourworldindataorgexplorerscoronavirusdataexplorerzoomtoselectiontruefacetnonepickersortascpickermetriclocationmetricpeoplevaccinated28bydose29interval7dayrollingaveragerelativetopopulationtruealignoutbreaksfalsecountrygbrzaf target_blankspanmuch vaccinatedspanaspan 75 britons doublejabbed barely quarter south africa surprisespana relnoopener hrefhttpswwwnews24comhealth24medicalinfectiousdiseasescoronavirusvaccinesupplyisoutweighingdemandexpertssharetheirviewsonhowtoincreaseuptake20211126 target_blankspanmore uptake supplyspanaspan spana relnoopener hrefhttpsourworldindataorgexplorerscoronavirusdataexplorerzoomtoselectiontruefacetnonepickersortascpickermetriclocationhidecontrolstruemetricconfirmedcasesintervalcumulativerelativetopopulationtruealignoutbreaksfalsecountrygbrzaf target_blankspanfar fewer confirmed cases capitaspanaspanspanp pspanthat said guesses new variant emerges difficult tell spread better spreading happens arisen convenient place imagine virus happened mutate new variant major conference infect hundreds people country wouldnt transmissible got luckyspanp diva hrefhttpsunherdcom202111thegreatclimatechangefallacyrefinnara hrefhttpsunherdcom202111thegreatclimatechangefallacyrefinnarimg srchttpsunherdcomwpcontentuploads202111gettyimages1350600662300x183jpgadiva hrefhttpsunherdcom202111thegreatclimatechangefallacyrefinnarspanmore authorspanaa hrefhttpsunherdcom202111thegreatclimatechangefallacyrefinnarh5the great climate change fallacyh5apa hrefhttpsunherdcom202111thegreatclimatechangefallacyrefinnarspanbyspan tom chiversapdivadiv pspanwith omicron unlikely case thanks sgene dropout spreading faster youd expect farrar says clear upswing transmission gauteng driven variant probably outcompete delta says spana relnoopener hrefhttpsunherdcom202012howdangerousisthecovidmutationtextbirney2c20andbabak20javid2c20an20immunology20lab target_blankspanbabak javidspanaspan immunology lab director university california san francisco airspanp pspanis better spreading general evade immunity far dont data sure soon start results laboratory studies later epidemiological observations spana relnoopener hrefhttpswwwcrickacukresearchfindaresearcherrupertbeale target_blankspanrupert bealespanaspan leader cell biology infection lab crick institute thinks weeks useful information christmas know definitivespanp pspanbut plus antibodies arent immune system tcells easily fooled mutations oversimplify antibodies stop getting infected place tcells stop getting ill javid birney think plausible omicron spread easily vaccinated andor previously infected people likely kill severely illspanp pthere relnoopener hrefhttpstwittercomsailorrooscoutstatus1464622927333232640 target_blankspeculationa omicron inherently deadly people preexisting immunity thats impossible spoke said definitive conclusions premature speculation extremely uninformed says beale dont know gets vulnerable population sadly likely hope pathogenic foolish assumptionp pspanso better spreading able escape immunity degree theoretically possible deadly thats certainly proposition want weight question facing second bleak covid winterspanp pspanthe pandemic taught acting early usually better acting late preparing worstcase scenarios important like chess says beale play moves flexible order assume itll ok right wrong end omicron spreading place assume itll pretty bad open later onspanp pspanive seen lot people spana relnoopener hrefhttpstwittercomfirefoxx66status1464664975809691650s21 target_blankspansome themspana relnoopener hrefhttpstwittercomnoahpinionstatus1464942148839608320ref_srctwsrc5egoogle7ctwcamp5eserp7ctwgr5etweet target_blankspanvery sensiblespanaspan suggesting theres point closing borders south africa variants punishing countries good surveillance think wrongspanp pspanyes variant hasnt farrar points identified 11 november sequence suggests circulating time think continent says doesnt mean theres point trying reduce spread border closures buy little time birney agrees shutting borders understand minimising seeding events good rational movespanp diva hrefhttpsunherdcom202110themenwhofailedbritainrefinnara hrefhttpsunherdcom202110themenwhofailedbritainrefinnarimg srchttpsunherdcomwpcontentuploads2021102gettyimages12352517861copye1634122087853300x151jpgadiva hrefhttpsunherdcom202110themenwhofailedbritainrefinnarspanmore authorspanaa hrefhttpsunherdcom202110themenwhofailedbritainrefinnarh5the men failed britainh5apa hrefhttpsunherdcom202110themenwhofailedbritainrefinnarspanbyspan tom chiversapdivadiv pspanits true theres risk punishing countries responsible surveillance dont alternative pretending spanispandontspanispan lots omicron circulating thing spanispanalsospanispan restrictions countries poor surveillancespanp pspanbecause buying little time important gives time understand omicron highly virulent vaccineresistant best response different isnt gives chance boosters arms stockpile antiviral drugsspanp pspanall arguments apply nonpharmaceutical interventions introducing vaccine passports asking people work home possible things britain toospanp pspanone thing hugely increase vaccine manufacturing capacity good world rolling childrens vaccines booster jabs faster wouldnt hurt scientist spoke suggested making antiviral meds available post people positive result need given quickly good effect cant rely gp appointments need link track amp trace cheaper quicker pcr testing airports helpspanp pspanbut measures important theyre addressing root issue farrar emergence omicron reminder need vaccinate world rich world theres political drift months terms access vaccines said rich world thought theyve kicking long grass variants like omicron continue arise world decent level immunityspanp diva hrefhttpsunherdcom202111whyrotterdameruptedrefinnara hrefhttpsunherdcom202111whyrotterdameruptedrefinnarimg srchttpsunherdcomwpcontentuploads20211121nov300x180jpgadiva hrefhttpsunherdcom202111whyrotterdameruptedrefinnarspansuggested readingspanaa hrefhttpsunherdcom202111whyrotterdameruptedrefinnarh5why rotterdam eruptedh5apa hrefhttpsunherdcom202111whyrotterdameruptedrefinnarspanbyspan senay boztasapdivadiv pweve lucky omicron end dominant strain delta doesnt come incredibly disruptive says farrar everyones putting restrictions certainly avoid lockdown christmas need act nowp pspanbut want sure dont year need pandemic means billions doses vaccine distributed world wont luckyspanp hrefhttpsunherdcom202111thegoodnewsabouttheomicronvariantappcommentsview 47 commentsa |
61a6a64ba83e2b4fc0f7240a | Chris Cuomo Violated Journalism Norms To Help His Brother and Should Resign From CNN | div
picture
source sizesminwidth 600px 331px 100vw typeimagewebp srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202111evphotostwo2510282400x1350jpgwebp 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202111evphotostwo2510281200x675jpgwebp 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202111evphotostwo251028800x450jpgwebp 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202111evphotostwo251028600x338jpgwebp 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202111evphotostwo251028331x186jpgwebp 331w
source sizesminwidth 600px 331px 100vw typeimagejpeg srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202111evphotostwo2510282400x1350jpg 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202111evphotostwo2510281200x675jpg 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202111evphotostwo251028800x450jpg 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202111evphotostwo251028600x338jpg 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202111evphotostwo251028331x186jpg 331w
img width1200 altevphotostwo251028 srchttpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202111evphotostwo251028800x450jpg height675
picture
div
pthe office of new yorks attorney general a hrefhttpsagnygovpressrelease2021additionaltranscriptsexhibitsandvideosindependentinvestigationsexualreleased thousands of pagesa of testimony relating to the sexual harassment allegations against former gov andrew cuomo and the new information makes it abundantly clear that cnn host chris cuomo involved himself in his brothers efforts to survive public scrutiny contrary to chris cuomos claim that he did not act as an official advisor to his brother the documents reveal that he actively used his journalistic access and connections to find out more information about the accusersand potentially to discredit themp
pchris texted his brothers longserving handler melissa derosa about one of the accusers saying quoti have a lead on the wedding girlquot the wedding girl is anna ruch who accused andrew of a hrefhttpswwwnytimescom20210301nyregioncuomoharassmentannaruchhtmlmaking a pass at hera chriss quotleadquot was a possible means of casting aspersions on her accusation chris told the attorney generals factfinders that he had learned of a source who might say ruch had ulterior motivesp
pdespite claiming during his interview with the attorney generals office that quoti would never do oppo research on anybody alleging anything like thisquot he was emclearly emengaged in a form of opposition research he wasnt just passively listening to his brothers side of the story and offering words of encouragement ha hrefhttpsreasoncom20210520chriscuomocnnandrewcuomoresigncalle took part in the strategizingap
pthats not a crime of course its unsurprising that he would take his brothers side and want to help him but it was wrong for chris to mislead his viewers about the role he played and it was wildly unethical to ignore the scandal during his broadcast while privately participating in the governors response effortsp
pthe matter was badly handled by the network at the height of the pandemic cnn broke its own policy and allowed andrew to give fluff interviews to chris that glamorized the thengovernors response to covid19 these interviews never should have taken place and they look especially ridiculous now that we know about a hrefhttpswwwpbsorgnewshourpoliticscuomoexitisntstoppingpushforanswersonnursinghomesthe nursing home scandala and subsequent a hrefhttpswwwnytimescom20210331nyregioncuomobooknursinghomeshtmlcoverupap
pgiven that chris significantly understated his involvement in his brothers strategizing cnn must discipline him the network says its reviewing the anchors conduct it is difficult to imagine any competent review reaching the conclusion that he should keep his job an important television journalist being the brother of a highprofile government official was an ethically challenging situation at best and if there was some line in the sand that made it workable enough chris cuomo clearly crossed itp
pquotby keeping cuomo on the air and in his job cnn would send the message that journalistic ethics are only for the little people and viewers are on their ownquot a hrefhttpswwwtheatlanticcomideasarchive202111firechriscuomo620835wrotea emthe atlanticems david graham quotcuomo should take some time off and reflect on his chosen professionand if and when he comes back perhaps he should choose a new beatquotp
pan entirely new line of work might be for the bestp
piframe allowfullscreen srchttpswwwyoutubecomembedyrogyxzwfxwfeatureoembed width500 titlebombshell cnns chris cuomo used media sources to help brother andrew navigate assault allegations height281iframep
pthe post a relnofollow hrefhttpsreasoncom20211130chriscuomocnnresignandrewjournalismchris cuomo violated journalism norms to help his brother and should resign from cnna appeared first on a relnofollow hrefhttpsreasoncomreasoncomap | div picture source sizesminwidth 600px 331px 100vw typeimagewebp srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202111evphotostwo2510282400x1350jpgwebp 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202111evphotostwo2510281200x675jpgwebp 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202111evphotostwo251028800x450jpgwebp 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202111evphotostwo251028600x338jpgwebp 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202111evphotostwo251028331x186jpgwebp 331w source sizesminwidth 600px 331px 100vw typeimagejpeg srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202111evphotostwo2510282400x1350jpg 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202111evphotostwo2510281200x675jpg 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202111evphotostwo251028800x450jpg 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202111evphotostwo251028600x338jpg 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202111evphotostwo251028331x186jpg 331w img width1200 altevphotostwo251028 srchttpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202111evphotostwo251028800x450jpg height675 picture div pthe office new yorks attorney general hrefhttpsagnygovpressrelease2021additionaltranscriptsexhibitsandvideosindependentinvestigationsexualreleased thousands pagesa testimony relating sexual harassment allegations gov andrew cuomo new information makes abundantly clear cnn host chris cuomo involved brothers efforts survive public scrutiny contrary chris cuomos claim act official advisor brother documents reveal actively journalistic access connections find information accusersand potentially discredit themp pchris texted brothers longserving handler melissa derosa accusers saying quoti lead wedding girlquot wedding girl anna ruch accused andrew hrefhttpswwwnytimescom20210301nyregioncuomoharassmentannaruchhtmlmaking pass hera chriss quotleadquot possible means casting aspersions accusation chris told attorney generals factfinders learned source ruch ulterior motivesp pdespite claiming interview attorney generals office quoti oppo research anybody alleging like thisquot wasemclearlyemengaged form opposition research wasnt passively listening brothers story offering words encouragement ha hrefhttpsreasoncom20210520chriscuomocnnandrewcuomoresigncalle took strategizingap pthats crime course unsurprising brothers want help wrong chris mislead viewers role played wildly unethical ignore scandal broadcast privately participating governors response effortsp pthe matter badly handled network height pandemic cnn broke policy allowed andrew fluff interviews chris glamorized thengovernors response covid19 interviews taken place look especially ridiculous know hrefhttpswwwpbsorgnewshourpoliticscuomoexitisntstoppingpushforanswersonnursinghomesthe nursing home scandala subsequent hrefhttpswwwnytimescom20210331nyregioncuomobooknursinghomeshtmlcoverupap pgiven chris significantly understated involvement brothers strategizing cnn discipline network says reviewing anchors conduct difficult imagine competent review reaching conclusion job important television journalist brother highprofile government official ethically challenging situation best line sand workable chris cuomo clearly crossed itp pquotby keeping cuomo air job cnn send message journalistic ethics little people viewers ownquot hrefhttpswwwtheatlanticcomideasarchive202111firechriscuomo620835wroteaemthe atlanticems david graham quotcuomo time reflect chosen professionand comes choose new beatquotp pan entirely new line work bestp piframe allowfullscreen srchttpswwwyoutubecomembedyrogyxzwfxwfeatureoembed width500 titlebombshell cnns chris cuomo media sources help brother andrew navigate assault allegations height281iframep pthe post relnofollow hrefhttpsreasoncom20211130chriscuomocnnresignandrewjournalismchris cuomo violated journalism norms help brother resign cnna appeared relnofollow hrefhttpsreasoncomreasoncomap |
61a6a68ca83e2b4fc0f72410 | Immigrants keep us out of nursing homes | blockquotepwe examine whether immigration causally affects the likelihood that the usborn elderly live in institutional settings using a shiftshare instrument to identify exogenous variation in immigration we find that a 10 percentage point increase in the lesseducated foreignborn labor force share in a local area reduces institutionalization among the elderly by 15 and 38 percentage points for those aged 65 and 80 a 2629 percent effect relative to the mean the estimates imply that a typical usborn individual over age 65 in the year 2000 was 05 percentage points 10 percent less likely to be living in an institution than would have been the case if immigration had remained at 1980 levels we show that immigration affects the availability and cost of home services including those provided by home health aides gardeners and housekeepers and other lesseducated workers reducing the cost of aging in the communitypblockquote
phere is a relnoopener hrefhttpswwwnberorgpapersw29520fromrss target_blankmore from kristin f butcher kelsey moran and tara watsonap
pthe post a relnofollow hrefhttpmarginalrevolutioncommarginalrevolution202111immigrantskeepusoutofnursinghomeshtmlimmigrants keep us out of nursing homesa appeared first on a relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap | blockquotepwe examine immigration causally affects likelihood usborn elderly live institutional settings shiftshare instrument identify exogenous variation immigration find 10 percentage point increase lesseducated foreignborn labor force share local area reduces institutionalization elderly 15 38 percentage points aged 65 80 2629 percent effect relative mean estimates imply typical usborn individual age 65 year 2000 05 percentage points 10 percent likely living institution case immigration remained 1980 levels immigration affects availability cost home services including provided home health aides gardeners housekeepers lesseducated workers reducing cost aging communitypblockquote phere relnoopener hrefhttpswwwnberorgpapersw29520fromrss target_blankmore kristin f butcher kelsey moran tara watsonap pthe post relnofollow hrefhttpmarginalrevolutioncommarginalrevolution202111immigrantskeepusoutofnursinghomeshtmlimmigrants nursing homesa appeared relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap |
61a6a70ba83e2b4fc0f72414 | Academic Freedom Alliance Letter to the University of Rochester | pthe a hrefhttpsacademicfreedomorgacademic freedom alliancea has released a a hrefhttpsacademicfreedomorgafasendslettertouniversityofrochesteronprofessorsuseofnwordpublic lettera to the university of rochester objecting to the treatment of an english professor there professor david bleich has long taught classes dealing with sensitive subjects in race and gender those courses include readings that make use of offensive language as is often the case the details of the assigned texts need to be discussed in class and the texts need to be read aloud and quoted accurately in order to facilitate that careful analysis such conversations can sometimes be difficult but they are at the heart of what it takes to do collegelevel work in literary criticism and analysisp
pthis semester professor bleich is teaching a class on gender and anger he read aloud from a short story that had been assigned to the class the portion of the text he read included the nword students objected and there was a vigorous conversation about the use of the word in a subsequent class professor bleich read to the students a section of harvard law school professor a hrefhttpshlsharvardedufacultydirectory10470kennedyrandall kennedyas a hrefhttpswwwchroniclecomarticleisiteveroktoenunciateaslurintheclassroomcid2gen_login_refreshcidgen_sign_inemchronicle of higher educationema article on the use of the nword in classroom settingsp
pthe university responded by suspending him from teaching his class and putting in place various restrictive conditions that must be satisfied before he would be allowed to resume teaching the university is taking the position that it is never appropriate for a professor to say the nword aloud in a college classp
pthis issue has become a common one at universities across the country some professors have been insufficiently thoughtful about the language they use in classes and these controversies have sometimes led to a desirable reconsideration of how instructors approach their teaching but these controversies have also stifled the ability of professors to engage in the kinds of conversations that should be taking place in college classrooms it is not appropriate for professors to hurl slurs at their students but it is academically essential that professors be able to discuss slurs and how they are used universities ought to be able to understand the a hrefhttpsreasoncom20210603wittgensteinvsthewokedifference between the use of a word and the mention of a wordap
pthe bleich case highlights the dangers here a dean from a completely different discipline has made a unilateral decision about how english professors should conduct their literature classes the same sweeping edicts from above would have implications for a host of other classes where offensive language might need to be discussed frankly and clearly in disciplines ranging from anthropology to history to philosophy to linguisticsp
pthe university of rochester is going down a path that violates its own clearly stated contractual commitments to academic freedom and in the process it is doing a disservice to both its students and its professorsp
pfrom our letter to the university of rochesterp
blockquotepas the aaup has elaborated on the implications of this freedom to teach it has repeatedly emphasized that classroom discussions of the type at issue here are well within the bounds of the principles of academic freedom to which rochester has contractually committed itself and that are generally accepted within the profession the aaups a hrefhttpswwwaauporgreportfreedomexpressionandcampusspeechcodes1994 report on freedom of expressiona firmly concluded that it would be a breach of professional ethics and outside the bounds of academic freedom for a professor to ridicule or harass a student in the classroom but that such quotverbal assaultsquot had to be sharply distinguished from the expression of hateful ideas including the words that are used to express those ideas offensive speech must sometimes be used in the classroom and it is subversive of the protection of freedom of classroom teaching to depart from established legal standards of harassment to proscribe frank classroom discussions of the ideas words and behaviors that might be used to harasspblockquote
pa hrefhttpsacademicfreedomorgwpcontentuploads202111afalettertouniversityofrochesterregardingdavidbleichpdfyou can read the whole thing hereap
punsurprisingly professor kennedy was unamused by the suggestion that it is inappropriate for a college professor to read aloud from kennedys own work a hrefhttpsacademicfreedomorgafasendslettertouniversityofrochesteronprofessorsuseofnwordas he told the afaap
blockquotepquotit is profoundly disturbing to see an instructor investigated and disciplined for grappling in class with a term that has had and continues to have a hugely consequential place in american culture the demand to make this term nigger literally unmentionable is a demand that ought not be honored compelled silence or bowdlerization is antithetical to the academic intellectual and artistic freedom essential to higher educationquotpblockquote
pthe university of rochester should immediately reverse course and reaffirm its commitment to being an institution of higher education and a university that respects the intellectual abilities of its students and the academic freedom of its professorsp
pthe post a relnofollow hrefhttpsreasoncomvolokh20211130academicfreedomalliancelettertotheuniversityofrochesteracademic freedom alliance letter to the university of rochestera appeared first on a relnofollow hrefhttpsreasoncomreasoncomap | pthe hrefhttpsacademicfreedomorgacademic freedom alliancea released hrefhttpsacademicfreedomorgafasendslettertouniversityofrochesteronprofessorsuseofnwordpublic lettera university rochester objecting treatment english professor professor david bleich long taught classes dealing sensitive subjects race gender courses include readings use offensive language case details assigned texts need discussed class texts need read aloud quoted accurately order facilitate careful analysis conversations difficult heart takes collegelevel work literary criticism analysisp pthis semester professor bleich teaching class gender anger read aloud short story assigned class portion text read included nword students objected vigorous conversation use word subsequent class professor bleich read students section harvard law school professor hrefhttpshlsharvardedufacultydirectory10470kennedyrandall kennedyas hrefhttpswwwchroniclecomarticleisiteveroktoenunciateaslurintheclassroomcid2gen_login_refreshcidgen_sign_inemchronicle higher educationema article use nword classroom settingsp pthe university responded suspending teaching class putting place restrictive conditions satisfied allowed resume teaching university taking position appropriate professor nword aloud college classp pthis issue common universities country professors insufficiently thoughtful language use classes controversies led desirable reconsideration instructors approach teaching controversies stifled ability professors engage kinds conversations taking place college classrooms appropriate professors hurl slurs students academically essential professors able discuss slurs universities ought able understand hrefhttpsreasoncom20210603wittgensteinvsthewokedifference use word mention wordap pthe bleich case highlights dangers dean completely different discipline unilateral decision english professors conduct literature classes sweeping edicts implications host classes offensive language need discussed frankly clearly disciplines ranging anthropology history philosophy linguisticsp pthe university rochester going path violates clearly stated contractual commitments academic freedom process disservice students professorsp pfrom letter university rochesterp blockquotepas aaup elaborated implications freedom teach repeatedly emphasized classroom discussions type issue bounds principles academic freedom rochester contractually committed generally accepted profession aaups hrefhttpswwwaauporgreportfreedomexpressionandcampusspeechcodes1994 report freedom expressiona firmly concluded breach professional ethics outside bounds academic freedom professor ridicule harass student classroom quotverbal assaultsquot sharply distinguished expression hateful ideas including words express ideas offensive speech classroom subversive protection freedom classroom teaching depart established legal standards harassment proscribe frank classroom discussions ideas words behaviors harasspblockquote pa hrefhttpsacademicfreedomorgwpcontentuploads202111afalettertouniversityofrochesterregardingdavidbleichpdfyou read thing hereap punsurprisingly professor kennedy unamused suggestion inappropriate college professor read aloud kennedys work hrefhttpsacademicfreedomorgafasendslettertouniversityofrochesteronprofessorsuseofnwordas told afaap blockquotepquotit profoundly disturbing instructor investigated disciplined grappling class term continues hugely consequential place american culture demand term nigger literally unmentionable demand ought honored compelled silence bowdlerization antithetical academic intellectual artistic freedom essential higher educationquotpblockquote pthe university rochester immediately reverse course reaffirm commitment institution higher education university respects intellectual abilities students academic freedom professorsp pthe post relnofollow hrefhttpsreasoncomvolokh20211130academicfreedomalliancelettertotheuniversityofrochesteracademic freedom alliance letter university rochestera appeared relnofollow hrefhttpsreasoncomreasoncomap |
61a6a788a83e2b4fc0f72420 | A South Korean floating city? | blockquotepthe worlds first floating city will be built off the coast of south korea and it will be hurricaneproof floodproof and selfsustainingp
pthe united nationsbacked project will be constructed off the coast of busan and was designed as a response to rising sea levels a relnoreferrer noopener hrefhttpswwwbusinessinsidercomfloatingcityunitednationssouthkorea202111 target_blankbusiness insider reporteda it is expected to be completed by 2025p
pthe futuristic city will be made up of large hexagonal platforms that float on the water the design will utilize a limestone coating thats buoyant despite being two to three times as hard as concrete project leaders told the outletp
pthe ultimate goal of the pioneering project is to create a floodproof community able to withstand a category 5 hurricane for 10000 residents it will also be able to produce its own food energy and freshwater with communal farming at the heart of every platform a relnoreferrer noopener hrefhttpsoceanixcitycommedia target_blankaccording to its designer oceanixapblockquote
phere is a relnoopener hrefhttpsnypostcom20211129southkoreahopestobuildsustainablefloatingcityby2025 target_blankmore from the new york postap
pthe post a relnofollow hrefhttpmarginalrevolutioncommarginalrevolution202111asouthkoreanfloatingcityhtmla south korean floating citya appeared first on a relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap | blockquotepthe worlds floating city built coast south korea hurricaneproof floodproof selfsustainingp pthe united nationsbacked project constructed coast busan designed response rising sea levelsa relnoreferrer noopener hrefhttpswwwbusinessinsidercomfloatingcityunitednationssouthkorea202111 target_blankbusiness insider reporteda expected completed 2025p pthe futuristic city large hexagonal platforms float water design utilize limestone coating thats buoyant despite times hard concrete project leaders told outletp pthe ultimate goal pioneering project create floodproof community able withstand category 5 hurricane 10000 residents able produce food energy freshwater communal farming heart platforma relnoreferrer noopener hrefhttpsoceanixcitycommedia target_blankaccording designer oceanixapblockquote phere relnoopener hrefhttpsnypostcom20211129southkoreahopestobuildsustainablefloatingcityby2025 target_blankmore new york postap pthe post relnofollow hrefhttpmarginalrevolutioncommarginalrevolution202111asouthkoreanfloatingcityhtmla south korean floating citya appeared relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap |
61a6a843a83e2b4fc0f7243a | Jason Abaluck writes me about masks and the Bangladesh RCT study | pthis all him no double indent thoughp
pas a regular reader of your blog and one of the pis of the a relnoopener noreferrer hrefhttpsnam12safelinksprotectionoutlookcomurlhttps3a2f2fsecurewebciscocom2f1wxa_or1olix2falx3qinhwabth0cccrrhiongpipr4gg1p7hs1pt6tufis971qrkmxo9zojq2stodnuvwhkh_yvdai7mhwgny6iqm4lfttis9ebpf1wgs6f53wly3uhv55sunjcr3bf3wlz6kqpnqxzsdkpwfylvynsis9ia3o8wo5awahmx14_zlljdshco3hgvmtgwywa3vldoieetojafmoxpetcsbfldwvwrymvcql4h_dicjpqzwmw83hodstzfqcyjgou_zwmu7vvvrpac2bmra5qprsfc76rsbiqit3bxf1e9tmqnczlxpwj0yiartwn5aoretxs72o4r90st0o88idasnpvylxmbnpnawp9zlzl7mxgcxdqig6he1dlo54un0gwvuldgyg7tq8soqtmy96n_mbo70ff9ez0amfqougypve1hmonq2fhttps253a252f252fwwwpovertyactionorg252fsites252fdefault252ffiles252fpublications252fmask_second_stage_paper_20211108pdfpdfdata047c017cjasonabaluck40yaleedu7cd86a7545b19d4ce2b61608d9b2d34a0a7cdd8cbebb21394df8b4114e3e87abeb5c7c07c07c6377374443298388647cunknown7ctwfpbgzsb3d8eyjwijoimc4wljawmdailcjqijoiv2lumziilcjbtii6ik1hawwilcjxvci6mn03d7c3000sdatayyhvdwfnale57ee62x0nnimghnulcn1wrp2foyp4vovc3dreserved0 datalinkindex0 dataauthnotapplicable target_blankbangladesh mask rcta now in press at isciencei i was surprised to see your claim that with more data transparency it does not seem to be holding up very wellp
ol start1 type1
lithe a relnoopener noreferrer hrefhttpsnam12safelinksprotectionoutlookcomurlhttp3a2f2fsecurewebciscocom2f1lk3nxgypnxbjnisii_up34nslbt8qgdhravmdqumtivnexyt7h2auahygwaeatrocl100qmnctzl8gapr4upmriaai8zdcwmehnbywbwywu1bmrl3l8imgvabf2ujzzhqeejormtz_szz4nmluxujx9x8hxogmuhzj1cjdkov7fhkrhlzmc6b7_ufnpah2kp091gq0ekia1ujhjk5krylajgepcpftjt7dzbiyj2nhlamhvh1xppnodprf4zgjfhpkenvgfev6d_obfteokxnny2ya3yapuuyhh3wd4fwcshhy6wrsap4j9bv0ecdo9vd08hehkuskdbvlepefrbnpzo_mg3y6nqctagcl2lejgifhulhz0b3pej1tnjs7ojlp6n5eh__rmjfn7rfeas_yhl5j0pvq_uxkicgi_fl4lmhw1j5shqs3vlvehaslp6ibdscljk4u_lq2fhttp253a252f252fwwwargminnet252f2021252f11252f23252fmaskrctrevisited252fdata047c017cjasonabaluck40yaleedu7cd86a7545b19d4ce2b61608d9b2d34a0a7cdd8cbebb21394df8b4114e3e87abeb5c7c07c07c6377374443298488367cunknown7ctwfpbgzsb3d8eyjwijoimc4wljawmdailcjqijoiv2lumziilcjbtii6ik1hawwilcjxvci6mn03d7c3000sdataomkopmvw0fefu5a6j1pasgrosvxuasx2mtdzsjs0vmy3dreserved0 datalinkindex1 dataauthnotapplicable target_blankarticle you linkeda claims in agreement with our study that our intervention led to a roughly 10 reduction in symptomatic seropositivity going from 12 to 41 of the population masked taking this estimate at face value going from no one masked to everyone masked would imply ia considerably larger effecti additionallyli
ol
ol start1 type1
li
ol start1 typea
liwe see a similar but more precisely estimated proportionate reduction in covid symptoms [95 ci 717] preregistered corresponding to 1500 individuals with covid symptoms preventedli
liwe see larger proportionate drops in symptomatic seropositivity and covid in villages where maskuse increased by more not preregistered with the effect size roughly matching our main resultli
ol
li
ol
pthe nave linear iv estimate would be a 33 reduction in covid from universal masking people underwhelmed by the absolute number of cases prevented need to ask iwhat did you expect if masks are a relnoopener noreferrer hrefhttpssecurewebciscocom1j9mc9oigpmmezpdqtw6raxtt9hguy07s_zwjnxazv1mwmsh4nltdiksu8igygqe0wpro0pauk3rowjzvzvrag_sxwqloc05skrmbl7kvlcpzqwsfsmb5e8bcxtdgtjsfbhs3r3cqmxunlc8syl4w8kpyz81ehspy9e_wpsamjgfhesegsq1jsubncwg3fnpimbtsb4pwyqtnsyqnfgno7bwikyusyo5ufto8grovm3bebajpy88keobx5imzra8hhvefex493asrcqf0rft_akrgihlycv39uh4_sekgtvhtsj7hconb3ydh79z_0clnhrfwelsgpq1kxknnuclif8s70i9dwbunoi7upz8yfttt5naz9t38jugk5osfffrnm6id93qtqybk68ycl98canpezyza5z8fwfdwnslnfg2euj7c0_e0bphbhttps3a2f2fwwwizaorg2fpublications2fdp2f133192ffacemasksconsiderablyreducecovid19casesingermanyasyntheticcontrolmethodapproach datalinkindex2 dataauthnotapplicable target_blankasa a relnoopener noreferrer hrefhttpssecurewebciscocom1neudrhby6r0eevn9myzhi4mkxxss2pvbzqwcg0kemnhexkbmzymytv4rsjee3kkuqbfuhddeanwq71af6ybsujbjjgiurowihjzujeo0csh40sibmal3szjtnswcw8h3cdxalmhjghj2wcnzjl73bvijtmhs9eyvlegjgda7upomzdnrq21wuczz6zgflbcrlxpl8ci4d7ijqrewhco8pkke5dugfwa_btl4rmdy2jbj35ryx2gkytdhbqdfyhfc1wbkn9mfcejtutvzmwatniliydwryesrrsvh17bianumdrj2idxizei0vp47k6twuugxna5tixzgvaeh0yo3qb1ekxnwmidcwf3rfty9svnkrlur5dgunrgxf645xqkwdx528psstwufhgwybthif7q9d8figzw2ybfvwbnj2bzcprzfssddz3assdahttps3a2f2fwwwhealthaffairsorg2fdoi2f1013772fhlthaff202000818 datalinkindex3 dataauthnotapplicable target_blankeffectivea as the a relnoopener noreferrer hrefhttpswwwsciencedirectcomsciencearticlepiis0304407620303468 datalinkindex4 dataauthnotapplicable target_blankobservationala a relnoopener noreferrer hrefhttpswwwelibraryimforgviewjournals00120212050012021issue205enxml datalinkindex5 dataauthnotapplicable target_blankliteraturea suggests ii see our results as on the low end of these estimates and this is precisely what we powered the study to detectp
ol start2 type1
lilets distinguish betweenli
ol
ol start2 type1
li
ol start1 typea
lithe absolute reduction in raw consenting symptomatic seropositives 20 cases preventedli
lithe absolute reduction in the iproportioni of consenting symptomatic seropositives 008 percentage points or 105 cases preventedli
lithe relative reduction in the proportion of consenting symptomatic seropositives 95 in casesli
ol
li
ol
pben recht advocates analyzing a the difference in means inot controlling for population ithis is not the specification we preregistered as it will have less power due to random fluctuations in population and indeed the difference in raw symptomatic seropositives overlooks the fact that the treatment population was larger there are more people possibly ill fixating on this specification in lieu of our preregistered one for which we powered the study is reverse phackingp
pre b vs c we find a result of almost identical significance in a linear modelii suggesting the same proportionate reduction if we divide the coefficient by the base rate we believe the relative reduction in c is more externally valid as it is difficult to write down a structural pandemic model where masks lead to an absolute reduction in covid regardless of the base rate and the absolute number in b is a function of the consent rate in our studyp
ol start3 type1
liit is certainly true that survey response bias is a potential concern we have repeatedly acknowledged this shortcoming of ianyi realworld rct evaluating masks that respondents cannot be blinded the direction of the bias is unclear individuals might be more attuned to symptoms in the treatment group we conduct many robustness checks in the paper we have now obtained funding to replicate the entire study and collect blood spots from symptomatic and nonsymptomatic individuals to partially mitigate this bias we will still need to check for balance in blood consent rates with respect to observables as we do in the current studyli
ol
ol start4 type1
liwe do not say that surgical masks work better than cloth masks what we say is that the evidence in favor of surgical masks is more robust we find an effect on symptomatic seropositivity regardless of whether we drop or impute missing values for nonconsenters while the effect of cloth masks on symptomatic seropositivity depends on how we do this imputation we find robust effects on symptoms for both types of masksli
ol
pi agree with you that our study identifies only the mediumterm impact of our intervention and there are critically important policy questions about the longterm equilibrium impact of masking as well as how the costs and benefits scale for people of different ages and vaccination statusesp
pthe post a relnofollow hrefhttpmarginalrevolutioncommarginalrevolution202111jasonabaluckwritesmeaboutmaskshtmljason abaluck writes me about masks and the bangladesh rct studya appeared first on a relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap | pthis double indent thoughp pas regular reader blog pis thea relnoopener noreferrer hrefhttpsnam12safelinksprotectionoutlookcomurlhttps3a2f2fsecurewebciscocom2f1wxa_or1olix2falx3qinhwabth0cccrrhiongpipr4gg1p7hs1pt6tufis971qrkmxo9zojq2stodnuvwhkh_yvdai7mhwgny6iqm4lfttis9ebpf1wgs6f53wly3uhv55sunjcr3bf3wlz6kqpnqxzsdkpwfylvynsis9ia3o8wo5awahmx14_zlljdshco3hgvmtgwywa3vldoieetojafmoxpetcsbfldwvwrymvcql4h_dicjpqzwmw83hodstzfqcyjgou_zwmu7vvvrpac2bmra5qprsfc76rsbiqit3bxf1e9tmqnczlxpwj0yiartwn5aoretxs72o4r90st0o88idasnpvylxmbnpnawp9zlzl7mxgcxdqig6he1dlo54un0gwvuldgyg7tq8soqtmy96n_mbo70ff9ez0amfqougypve1hmonq2fhttps253a252f252fwwwpovertyactionorg252fsites252fdefault252ffiles252fpublications252fmask_second_stage_paper_20211108pdfpdfdata047c017cjasonabaluck40yaleedu7cd86a7545b19d4ce2b61608d9b2d34a0a7cdd8cbebb21394df8b4114e3e87abeb5c7c07c07c6377374443298388647cunknown7ctwfpbgzsb3d8eyjwijoimc4wljawmdailcjqijoiv2lumziilcjbtii6ik1hawwilcjxvci6mn03d7c3000sdatayyhvdwfnale57ee62x0nnimghnulcn1wrp2foyp4vovc3dreserved0 datalinkindex0 dataauthnotapplicable target_blankbangladesh mask rctanow press atisciencei surprised claim data transparency holding wellp ol start1 type1 lithea relnoopener noreferrer hrefhttpsnam12safelinksprotectionoutlookcomurlhttp3a2f2fsecurewebciscocom2f1lk3nxgypnxbjnisii_up34nslbt8qgdhravmdqumtivnexyt7h2auahygwaeatrocl100qmnctzl8gapr4upmriaai8zdcwmehnbywbwywu1bmrl3l8imgvabf2ujzzhqeejormtz_szz4nmluxujx9x8hxogmuhzj1cjdkov7fhkrhlzmc6b7_ufnpah2kp091gq0ekia1ujhjk5krylajgepcpftjt7dzbiyj2nhlamhvh1xppnodprf4zgjfhpkenvgfev6d_obfteokxnny2ya3yapuuyhh3wd4fwcshhy6wrsap4j9bv0ecdo9vd08hehkuskdbvlepefrbnpzo_mg3y6nqctagcl2lejgifhulhz0b3pej1tnjs7ojlp6n5eh__rmjfn7rfeas_yhl5j0pvq_uxkicgi_fl4lmhw1j5shqs3vlvehaslp6ibdscljk4u_lq2fhttp253a252f252fwwwargminnet252f2021252f11252f23252fmaskrctrevisited252fdata047c017cjasonabaluck40yaleedu7cd86a7545b19d4ce2b61608d9b2d34a0a7cdd8cbebb21394df8b4114e3e87abeb5c7c07c07c6377374443298488367cunknown7ctwfpbgzsb3d8eyjwijoimc4wljawmdailcjqijoiv2lumziilcjbtii6ik1hawwilcjxvci6mn03d7c3000sdataomkopmvw0fefu5a6j1pasgrosvxuasx2mtdzsjs0vmy3dreserved0 datalinkindex1 dataauthnotapplicable target_blankarticle linkedaclaims agreement study intervention led roughly 10 reduction symptomatic seropositivity going 12 41 population masked taking estimate face value going masked masked implyia considerably larger effecti additionallyli ol ol start1 type1 li ol start1 typea liwe similar precisely estimated proportionate reduction covid symptoms [95 ci 717] preregistered corresponding 1500 individuals covid symptoms preventedli liwe larger proportionate drops symptomatic seropositivity covid villages maskuse increased preregistered effect size roughly matching main resultli ol li ol pthe nave linear iv estimate 33 reduction covid universal masking people underwhelmed absolute number cases prevented need askiwhat expect masks area relnoopener noreferrer hrefhttpssecurewebciscocom1j9mc9oigpmmezpdqtw6raxtt9hguy07s_zwjnxazv1mwmsh4nltdiksu8igygqe0wpro0pauk3rowjzvzvrag_sxwqloc05skrmbl7kvlcpzqwsfsmb5e8bcxtdgtjsfbhs3r3cqmxunlc8syl4w8kpyz81ehspy9e_wpsamjgfhesegsq1jsubncwg3fnpimbtsb4pwyqtnsyqnfgno7bwikyusyo5ufto8grovm3bebajpy88keobx5imzra8hhvefex493asrcqf0rft_akrgihlycv39uh4_sekgtvhtsj7hconb3ydh79z_0clnhrfwelsgpq1kxknnuclif8s70i9dwbunoi7upz8yfttt5naz9t38jugk5osfffrnm6id93qtqybk68ycl98canpezyza5z8fwfdwnslnfg2euj7c0_e0bphbhttps3a2f2fwwwizaorg2fpublications2fdp2f133192ffacemasksconsiderablyreducecovid19casesingermanyasyntheticcontrolmethodapproach datalinkindex2 dataauthnotapplicable target_blankasaa relnoopener noreferrer hrefhttpssecurewebciscocom1neudrhby6r0eevn9myzhi4mkxxss2pvbzqwcg0kemnhexkbmzymytv4rsjee3kkuqbfuhddeanwq71af6ybsujbjjgiurowihjzujeo0csh40sibmal3szjtnswcw8h3cdxalmhjghj2wcnzjl73bvijtmhs9eyvlegjgda7upomzdnrq21wuczz6zgflbcrlxpl8ci4d7ijqrewhco8pkke5dugfwa_btl4rmdy2jbj35ryx2gkytdhbqdfyhfc1wbkn9mfcejtutvzmwatniliydwryesrrsvh17bianumdrj2idxizei0vp47k6twuugxna5tixzgvaeh0yo3qb1ekxnwmidcwf3rfty9svnkrlur5dgunrgxf645xqkwdx528psstwufhgwybthif7q9d8figzw2ybfvwbnj2bzcprzfssddz3assdahttps3a2f2fwwwhealthaffairsorg2fdoi2f1013772fhlthaff202000818 datalinkindex3 dataauthnotapplicable target_blankeffectiveaas thea relnoopener noreferrer hrefhttpswwwsciencedirectcomsciencearticlepiis0304407620303468 datalinkindex4 dataauthnotapplicable target_blankobservationalaa relnoopener noreferrer hrefhttpswwwelibraryimforgviewjournals00120212050012021issue205enxml datalinkindex5 dataauthnotapplicable target_blankliteratureasuggestsii results low end estimates precisely powered study detectp ol start2 type1 lilets distinguish betweenli ol ol start2 type1 li ol start1 typea lithe absolute reduction raw consenting symptomatic seropositives 20 cases preventedli lithe absolute reduction theiproportioniof consenting symptomatic seropositives 008 percentage points 105 cases preventedli lithe relative reduction proportion consenting symptomatic seropositives 95 casesli ol li ol pben recht advocates analyzing difference meansinot controlling populationithis specification preregistered power random fluctuations population difference raw symptomatic seropositives overlooks fact treatment population larger people possibly ill fixating specification lieu preregistered powered study reverse phackingp pre b vs c find result identical significance linear modeliisuggesting proportionate reduction divide coefficient base rate believe relative reduction c externally valid difficult write structural pandemic model masks lead absolute reduction covid regardless base rate absolute number b function consent rate studyp ol start3 type1 liit certainly true survey response bias potential concern repeatedly acknowledged shortcoming ofianyi realworld rct evaluating masks respondents blinded direction bias unclear individuals attuned symptoms treatment group conduct robustness checks paper obtained funding replicate entire study collect blood spots symptomatic nonsymptomatic individuals partially mitigate bias need check balance blood consent rates respect observables current studyli ol ol start4 type1 liwe surgical masks work better cloth masks evidence favor surgical masks robust find effect symptomatic seropositivity regardless drop impute missing values nonconsenters effect cloth masks symptomatic seropositivity depends imputation find robust effects symptoms types masksli ol pi agree study identifies mediumterm impact intervention critically important policy questions longterm equilibrium impact masking costs benefits scale people different ages vaccination statusesp pthe post relnofollow hrefhttpmarginalrevolutioncommarginalrevolution202111jasonabaluckwritesmeaboutmaskshtmljason abaluck writes masks bangladesh rct studya appeared relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap |
61a7f7d4353613f0736d617e | Pandemic Restrictions May Harm Infants' Cognitive Development, New Study Finds | div
picture
source sizesminwidth 600px 331px 100vw typeimagewebp srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202112dreamstime_xxl_1876678512400x1350jpgwebp 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202112dreamstime_xxl_1876678511200x675jpgwebp 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202112dreamstime_xxl_187667851800x450jpgwebp 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202112dreamstime_xxl_187667851600x338jpgwebp 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202112dreamstime_xxl_187667851331x186jpgwebp 331w
source sizesminwidth 600px 331px 100vw typeimagejpeg srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202112dreamstime_xxl_1876678512400x1350jpg 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202112dreamstime_xxl_1876678511200x675jpg 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202112dreamstime_xxl_187667851800x450jpg 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202112dreamstime_xxl_187667851600x338jpg 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202112dreamstime_xxl_187667851331x186jpg 331w
img width1200 altdreamstime_xxl_187667851 srchttpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202112dreamstime_xxl_187667851800x450jpg height675
picture
div
pcovid19 mitigation policies like masks social distancing lockdowns and school closures may have harmed the cognitive development of infants verbal nonverbal and early learning scores dropped among babies born during the pandemic a hrefhttpswwwmedrxivorgcontent1011012021081021261846v1fulltextaccording to a new study from brown universityap
pquotwe find that children born during the pandemic have significantly reduced verbal motor and overall cognitive performance compared to children born prepandemicquot wrote the studys authors quotresults highlight that even in the absence of direct sarscov2 infection and covid19 illness the environmental changes associated with the covid19 pandemic is significantly and negatively affecting infant and child developmentquotp
poutcomes were worse for males than females and children in lower socioeconomic households were worst offp
pthe study has not yet been peerreviewed and it has several limitations researchers gathered data on 118 children born during the pandemic and compared their cognitive outcomes to a dataset that included 605 kids who were between the ages of 3 months and 3 years in the 2011 to 2020 period while the pandemic may feel as if it has gone on forever its actually only been 20 months which is not a lot of time for a newborn to develop sufficiently testable skills sean deoni an associate professor at brown and one of the studys authors cautioned that the findings should not be generalized to all kidsp
pquoti think only time will tell if we see prolonged effects or if this is transient and they recover or normalize as they get older and if it impacts more mature skills like executive functions and social skillsquot he tells emreasonemp
pemthe daily mailems report on the study a hrefhttpswwwdailymailcouknewsarticle10247315facemasksharmchildrensdevelopmentstudyblamessignificantlyreduceddevelopmenthtmlemphasizeda the possibility that face masks were responsible for the measured cognitive decline though none of the kids in the pandemic dataset are old enough to be covered by mask mandatesp
pquoti did not speak with the reporterwriter from the emdaily mailem and i dont agree with the rather sensationalized headline that masks are doing harm to our kiddosquot he says quotindeed we were not able to directly test whether the trends we observed were due to mask wearing or other potential environmental factors the best we can say is that we are observing that children have reduced development relative to children we have tested previouslyquotp
pdeoni pointed out that the largest reductions were in the categories of motor skills and language skills which may indicate other mitigation efforts such as social distancing as likelier culpritsp
pstill this pandemicera drop in cognitive outcomes is notable and even if the harms end up being smaller than they appear in this study its worth keeping in mind that the embenefits emof covid19 restrictions are extremely limited for this age cohort due to the viruss a hrefhttpsnymagcomintelligencer202109covid19vaccinestatusagediscriminationhtmlage discriminationa young people were almost entirely spared from negative health outcomes relating to the disease itself only a hrefhttpswwwlatimescomcaliforniastory20210910secondchilddiesofcovid19inorangecountyabout 500 childrena in the us have died of covid19 and it is likely that a significant number of those victims had other health problems or compromised immune systems for the overwhelming majority of healthy kids there is no good evidence that they should have to wear masks practice social distancing and frequently miss schoolp
pyet in much of the country the restrictions on young people are currently emmore emstringent than the restrictions on adults and the elderly in large democratic cities like new york city and washington dc schoolchildren are generally masked and when its time to eat lunch they do so outdoorseven as the weather a hrefhttpsmobiletwittercomkarolstatus1463156903295569922grows colderap
phaving to eat lunch outside in the cold is a punishment currently endured by school kids and only school kids adults are eating indoors at restaurants and drinking indoors at bars now that dcs mask mandate has ended indoor gyms can once again let their customers go masklessa hrefhttpswwwwwnytvcom20210923schoolathletesmustwearmasksindoorsportsstatesaysbut in many places masks are still required for indoor school sportsa it doesnt make any sense that authorities are enforcing the harshest restrictions on the least atrisk peoplep
pthe rules for the collegeaged are if anything a hrefhttpsreasoncom20210921collegecampuseshavethecraziestcovid19restrictionsofalleven more extremea many campuses severely limit interactions between students require masks even outside and discourage nearly all forms of socialization whats occurring is something close to the exact opposite of the ideal whatever mitigation policies are in place for adults and the elderly the policies for young people should be less restrictive not morep
piframe allowfullscreen srchttpswwwyoutubecomembed3fazrrxzr74featureoembed width500 titlerobby soave kids forced to wear masks eat outside while adults enjoy freedom this is pointless height281iframep
pthe post a relnofollow hrefhttpsreasoncom20211201masksharminfantspandemicrestrictionsbabiescovidbrownstudypandemic restrictions may harm infants cognitive development new study findsa appeared first on a relnofollow hrefhttpsreasoncomreasoncomap | div picture source sizesminwidth 600px 331px 100vw typeimagewebp srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202112dreamstime_xxl_1876678512400x1350jpgwebp 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202112dreamstime_xxl_1876678511200x675jpgwebp 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202112dreamstime_xxl_187667851800x450jpgwebp 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202112dreamstime_xxl_187667851600x338jpgwebp 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202112dreamstime_xxl_187667851331x186jpgwebp 331w source sizesminwidth 600px 331px 100vw typeimagejpeg srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202112dreamstime_xxl_1876678512400x1350jpg 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202112dreamstime_xxl_1876678511200x675jpg 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202112dreamstime_xxl_187667851800x450jpg 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202112dreamstime_xxl_187667851600x338jpg 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202112dreamstime_xxl_187667851331x186jpg 331w img width1200 altdreamstime_xxl_187667851 srchttpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202112dreamstime_xxl_187667851800x450jpg height675 picture div pcovid19 mitigation policies like masks social distancing lockdowns school closures harmed cognitive development infants verbal nonverbal early learning scores dropped babies born pandemic hrefhttpswwwmedrxivorgcontent1011012021081021261846v1fulltextaccording new study brown universityap pquotwe find children born pandemic significantly reduced verbal motor overall cognitive performance compared children born prepandemicquot wrote studys authors quotresults highlight absence direct sarscov2 infection covid19 illness environmental changes associated covid19 pandemic significantly negatively affecting infant child developmentquotp poutcomes worse males females children lower socioeconomic households worst offp pthe study peerreviewed limitations researchers gathered data 118 children born pandemic compared cognitive outcomes dataset included 605 kids ages 3 months 3 years 2011 2020 period pandemic feel gone forever actually 20 months lot time newborn develop sufficiently testable skills sean deoni associate professor brown studys authors cautioned findings generalized kidsp pquoti think time tell prolonged effects transient recover normalize older impacts mature skills like executive functions social skillsquot tellsemreasonemp pemthe daily mailems report study hrefhttpswwwdailymailcouknewsarticle10247315facemasksharmchildrensdevelopmentstudyblamessignificantlyreduceddevelopmenthtmlemphasizeda possibility face masks responsible measured cognitive decline kids pandemic dataset old covered mask mandatesp pquoti speak reporterwriter emdaily mailem dont agree sensationalized headline masks harm kiddosquot says quotindeed able directly test trends observed mask wearing potential environmental factors best observing children reduced development relative children tested previouslyquotp pdeoni pointed largest reductions categories motor skills language skills indicate mitigation efforts social distancing likelier culpritsp pstill pandemicera drop cognitive outcomes notable harms end smaller appear study worth keeping mind theembenefitsemof covid19 restrictions extremely limited age cohort viruss hrefhttpsnymagcomintelligencer202109covid19vaccinestatusagediscriminationhtmlage discriminationa young people entirely spared negative health outcomes relating disease hrefhttpswwwlatimescomcaliforniastory20210910secondchilddiesofcovid19inorangecountyabout 500 childrena died covid19 likely significant number victims health problems compromised immune systems overwhelming majority healthy kids good evidence wear masks practice social distancing frequently miss schoolp pyet country restrictions young people currentlyemmoreemstringent restrictions adults elderly large democratic cities like new york city washington dc schoolchildren generally masked time eat lunch outdoorseven weather hrefhttpsmobiletwittercomkarolstatus1463156903295569922grows colderap phaving eat lunch outside cold punishment currently endured school kids school kids adults eating indoors restaurants drinking indoors bars dcs mask mandate ended indoor gyms let customers masklessa hrefhttpswwwwwnytvcom20210923schoolathletesmustwearmasksindoorsportsstatesaysbut places masks required indoor school sportsa doesnt sense authorities enforcing harshest restrictions atrisk peoplep pthe rules collegeaged hrefhttpsreasoncom20210921collegecampuseshavethecraziestcovid19restrictionsofalleven extremea campuses severely limit interactions students require masks outside discourage nearly forms socialization whats occurring close exact opposite ideal mitigation policies place adults elderly policies young people restrictive morep piframe allowfullscreen srchttpswwwyoutubecomembed3fazrrxzr74featureoembed width500 titlerobby soave kids forced wear masks eat outside adults enjoy freedom pointless height281iframep pthe post relnofollow hrefhttpsreasoncom20211201masksharminfantspandemicrestrictionsbabiescovidbrownstudypandemic restrictions harm infants cognitive development new study findsa appeared relnofollow hrefhttpsreasoncomreasoncomap |
61a7f805353613f0736d6180 | Organizing for Power – Jane McAlevey Pt 3 | a relnofollow hrefhttpstheanalysisnewsorganizingforpowerjanemcaleveypt3 titleorganizing for power jane mcalevey pt 3img sizesmaxwidth 1024px 100vw 1024px srchttpstheanalysisnewswpcontentuploads202111weborganizingforpowerjanemcalevey1024x603jpg width1024 alt srcsethttpstheanalysisnewswpcontentuploads202111weborganizingforpowerjanemcalevey1024x603jpg 1024w httpstheanalysisnewswpcontentuploads202111weborganizingforpowerjanemcalevey300x177jpg 300w httpstheanalysisnewswpcontentuploads202111weborganizingforpowerjanemcalevey768x452jpg 768w httpstheanalysisnewswpcontentuploads202111weborganizingforpowerjanemcaleveyjpg 1100w classwebfeedsfeaturedvisual wppostimage height603aparve error src mismatch url httpswwwyoutubecomwatchv2adro2gbask src in httpswwwyoutubecomembed2adro2gbaskfeatureoembedampenablejsapi1amporiginhttpstheanalysisnews src gen httpswwwyoutubecomembed2adro2gbaskactual comparison url httpswwwyoutubecomwatchv2adro2gbask src in httpswwwyoutubecomembed2adro2gbaskenablejsapi1amporiginhttps3a2f2ftheanalysisp
pa relnofollow hrefhttpstheanalysisnewsorganizingforpowerjanemcaleveypt3sourceap | relnofollow hrefhttpstheanalysisnewsorganizingforpowerjanemcaleveypt3 titleorganizing power jane mcalevey pt 3img sizesmaxwidth 1024px 100vw 1024px srchttpstheanalysisnewswpcontentuploads202111weborganizingforpowerjanemcalevey1024x603jpg width1024 alt srcsethttpstheanalysisnewswpcontentuploads202111weborganizingforpowerjanemcalevey1024x603jpg 1024w httpstheanalysisnewswpcontentuploads202111weborganizingforpowerjanemcalevey300x177jpg 300w httpstheanalysisnewswpcontentuploads202111weborganizingforpowerjanemcalevey768x452jpg 768w httpstheanalysisnewswpcontentuploads202111weborganizingforpowerjanemcaleveyjpg 1100w classwebfeedsfeaturedvisual wppostimage height603aparve error src mismatch url httpswwwyoutubecomwatchv2adro2gbask src httpswwwyoutubecomembed2adro2gbaskfeatureoembedampenablejsapi1amporiginhttpstheanalysisnews src gen httpswwwyoutubecomembed2adro2gbaskactual comparison url httpswwwyoutubecomwatchv2adro2gbask src httpswwwyoutubecomembed2adro2gbaskenablejsapi1amporiginhttps3a2f2ftheanalysisp pa relnofollow hrefhttpstheanalysisnewsorganizingforpowerjanemcaleveypt3sourceap |
61a7f80d353613f0736d6184 | A Brief History of Identity Marxism | h4the new discourses podcast with james lindsay episode 56h4
pthe ideology that is most conveniently identified as wokeness is much more accurately described by the phrase identity marxism that is wokeness is a marxian approach to identity politics for similar aims to those marxism has always touted in this regard critical race theory is race marxism critical gender theory is gender marxism queer theory is gender sex and sexuality marxism fat studies is fat marxism postcolonial theory is postcolonial marxism and disability studies is disability marxism all together working intersectionally they are one new species of marxism identity marxism in this episode of the new discourses podcast james lindsay walks the listener through a history of the various strains of marxist thought to make the case that wokeness is best thought of this way indeed it must be understood this way in so doing he elucidates what marxism really represents as a broad overarching philosophy or religion and indicates that the various species of marxism including vulgar cultural neo and now identity marxism are all essentially the same project in different guises join him for a penetrating discussion that frames wokeness as it really isp
hr
pemsubscribe to the new discourses podcast on spanspana relnoopener noreferrer hrefhttpssoundcloudcomnewdiscourses target_blanksoundcloudaspanspan spanspana relnoopener noreferrer hrefhttpspodcastsapplecomuspodcastnewdiscoursesid1499880546 target_blankapple podcastsaspanspan spanspana relnoopener noreferrer hrefhttpspodcastsgooglecomfeedahr0cdovl2zlzwrzlnnvdw5ky2xvdwquy29tl3vzzxjzl3nvdw5ky2xvdwq6dxnlcnm6nzgxmte2mzi1l3nvdw5kcy5yc3m target_blankgoogle podcastsaspanspan spanspana relnoopener noreferrer hrefhttpsopenspotifycomshow0hfzdaxi5l4lnjqstfwgzpsikd5rtswgt1epiuyrixmlgw target_blankspotifyaspanspan spanspana relnoopener noreferrer hrefhttpswwwstitchercompodcastnewdiscourses target_blankstitcheraspanspana relnoopener noreferrer hrefhttpswwwstitchercompodcastnewdiscourses target_blanka spanspana relnoopener noreferrer hrefhttpswwwyoutubecomplaylistlistpl2hruftaprxcqcbydcaullid2d9exyny target_blankyoutubeaspanspan or by spanspana relnoopener noreferrer hrefhttpsfeedssoundcloudcomuserssoundcloudusers781116325soundsrss target_blankrssaspanspanemp
pemprevious episodes of the new discourses podcast are available spanspana relnoopener hrefhttpsnewdiscoursescomtagndpodcast target_blankhereaspanspanemp
pthe post a relnofollow hrefhttpsnewdiscoursescom202112abriefhistoryofidentitymarxisma brief history of identity marxisma appeared first on a relnofollow hrefhttpsnewdiscoursescomnew discoursesap | h4the new discourses podcast james lindsay episode 56h4 pthe ideology conveniently identified wokeness accurately described phrase identity marxism wokeness marxian approach identity politics similar aims marxism touted regard critical race theory race marxism critical gender theory gender marxism queer theory gender sex sexuality marxism fat studies fat marxism postcolonial theory postcolonial marxism disability studies disability marxism working intersectionally new species marxism identity marxism episode new discourses podcast james lindsay walks listener history strains marxist thought case wokeness best thought way understood way elucidates marxism represents broad overarching philosophy religion indicates species marxism including vulgar cultural neo identity marxism essentially project different guises join penetrating discussion frames wokeness isp hr pemsubscribe new discourses podcast spanspana relnoopener noreferrer hrefhttpssoundcloudcomnewdiscourses target_blanksoundcloudaspanspanspanspana relnoopener noreferrer hrefhttpspodcastsapplecomuspodcastnewdiscoursesid1499880546 target_blankapple podcastsaspanspanspanspana relnoopener noreferrer hrefhttpspodcastsgooglecomfeedahr0cdovl2zlzwrzlnnvdw5ky2xvdwquy29tl3vzzxjzl3nvdw5ky2xvdwq6dxnlcnm6nzgxmte2mzi1l3nvdw5kcy5yc3m target_blankgoogle podcastsaspanspanspanspana relnoopener noreferrer hrefhttpsopenspotifycomshow0hfzdaxi5l4lnjqstfwgzpsikd5rtswgt1epiuyrixmlgw target_blankspotifyaspanspanspanspana relnoopener noreferrer hrefhttpswwwstitchercompodcastnewdiscourses target_blankstitcheraspanspana relnoopener noreferrer hrefhttpswwwstitchercompodcastnewdiscourses target_blankaspanspana relnoopener noreferrer hrefhttpswwwyoutubecomplaylistlistpl2hruftaprxcqcbydcaullid2d9exyny target_blankyoutubeaspanspan byspanspana relnoopener noreferrer hrefhttpsfeedssoundcloudcomuserssoundcloudusers781116325soundsrss target_blankrssaspanspanemp pemprevious episodes new discourses podcast available spanspana relnoopener hrefhttpsnewdiscoursescomtagndpodcast target_blankhereaspanspanemp pthe post relnofollow hrefhttpsnewdiscoursescom202112abriefhistoryofidentitymarxisma brief history identity marxisma appeared relnofollow hrefhttpsnewdiscoursescomnew discoursesap |
61a7f856353613f0736d618a | My NYT podcast on Meta and antitrust, with Sarah Miller | phosted by jane coaston of the argument she did a very good job a relnoopener hrefhttpswwwnytimescom20211201opiniontheargumentfacebookantitrusthtml target_blankhere it isap
pthe post a relnofollow hrefhttpmarginalrevolutioncommarginalrevolution202112mynytpodcastonmetaandantitrustwithsarahmillerhtmlmy nyt podcast on meta and antitrust with sarah millera appeared first on a relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap | phosted jane coaston argument good job relnoopener hrefhttpswwwnytimescom20211201opiniontheargumentfacebookantitrusthtml target_blankhere isap pthe post relnofollow hrefhttpmarginalrevolutioncommarginalrevolution202112mynytpodcastonmetaandantitrustwithsarahmillerhtmlmy nyt podcast meta antitrust sarah millera appeared relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap |
61a7f8a7353613f0736d618e | HG Wells and the human animal | poh emmon dieuem he is a terrible pessimist for many people dh lawrences verdict on hg wells made in a letter to a friend in 1909 will be surprising even perverse wells spent much of his life working to transform the human world into something better ordered and more beautiful than it had ever been before yet lawrences observation contains a neglected truth wells did not really believe in the future of humanity he could not banish the suspicion that humankind would remain incurably irrational until eventually it destroyed itselfp
pwellss view of the human animal is expressed in his early masterpieces of speculative fiction in emthe time machineem 1895 emthe island of dr moreauem 1896 emthe invisible manem 1897 and emthe war of the worldsem 1897 science had opened up vistas of progress wider than any hitherto conceived yet the end point of evolution would be a dying planet covered with lichen trying to turn animals into rational humans would produce a tormented hybrid the ancient dream of invisibility proved to be a curse and all the resources of modern civilisation were powerless against invasion by a more advanced species these visions which came to wells as revelations of his innermost doubts never left himp
pthere have been many lives of wells claire tomalins gives us a picture of the writer that is vividly compelling and freshly detailed she captures the young wellss vitality showing him battling against poverty and illness finding his way in british intellectual life and forming tangled relationships with a wide variety of womenp
pwells was born in 1866 in bromley kent the fourth child of joseph wells shopkeeper and cricketer and sarah wells a maid and then housekeeper at uppark a grand 17thcentury house on the south downs his schooling was erratic he learned most when he was bedridden as a result of illness or accident reading books his father brought from the local library in 1877 joseph had a bad fall ending his cricketing career with the family finances depleted wells was apprenticed in a drapers shop then a pharmacy positions he loathed in 1883 after briefly contemplating suicide he persuaded his mother and father he would do better as a pupilteacher in a grammar school he gained the post and without telling his parents applied for a scholarship at the normal school of science in south kensingtonp
pstrongem[see also a hrefhttpswwwnewstatesmancomuncategorized202008nsarchivehgwellsmaniknewfrom the ns archive hg wells the man i knewa]emstrongp
pby september 1884 not yet 18 wells had become the student of th huxley president of the royal society and the worlds leading darwinist living in london on a guinea a week a gaunt wells could barely keep body and soul together he watched as two fellow students fainted from hunger in the laboratory failing to get a degree he took up a position at a boys school disaster struck when he was injured in a rugby game he became an invalid and on more than one occasion nearly diedp
phe seized the catastrophe as an opportunity and began writing stories for magazines from his sickbed at the bottom of a list of his published work showing he had made a grand total of 1 he noted someday i will succeed but it is a weary game he never gave up for one thing he had no intention of dying a virginp
pin theory wells was a radical collectivist in practice he was an unabashed individualist nowhere was this truer than in his relations with women in the world of the future everyone would practice free love for wells others had to serve as instruments of his needsp
pwellss sexual career began when he married his cousin isabel mary wells in 1890 but it was not played out within his marriage after a sixyearlong engagement throughout which he had been faithful their wedding night was a fiasco wells launched himself into what he called an enterprising promiscuity in 1894 the couple separated and wells moved in with one of his students amy robbins later known as jane who became his wife in october 1895 wells treated jane abominably spending much of his time with lovers he returned to be with her only when she was dying from cancer even then leaving regularly to spend a few days in france where his current lover was livingp
pwells was desired by many clever and interesting women tomalin writes for his energy and charm for his reputation as a lover as well as his fame and for some his riches but as tomalin goes on to show his most serious lovers were outstandingly gifted women whose personalities he found compelling amber reeves with whom wells fathered a daughter was a brilliant cambridge student founder of the universitys fabian society and later a feminist author rebecca west with whom he had a son was a celebrated writer elizabeth von arnim was a bestselling novelist odette keun a prominent dutch socialist margaret sanger a world leader in the campaign for birth control and dorothy richardson a noted critic and author of the 13volume empilgrimageem a modernist classicp
pwellss last and greatest love was moura budberg the most extraordinary of them all tomalin writesp
pshe had lived a life of spectacular difficulty and danger and saved herself and her children by courage charm and ruthlessness whatever wells knew or worried about in her past marriages love affairs imprisonment and spying in russia berlin estonia and italy he did not waver in his determination to keep herp
pall of this is true but hardly does justice to moura or the pivotal role she played in wellss life tomalin sets out to present wells up to the age of 40 but follows him well into his fifth decade while her books final chapter takes us up to his death in august 1946 it is a pity that she fails to explore wellss relationship with moura more fully for it posed the severest challenge he ever faced to his view of the world and himselfp
pmany who knew her commented on mouras serene fatalism others on her unyielding determination born in 1892 the daughter of a tsarist nobleman she faced becoming a former person after her husband was shot dead on the family estate in 1919 many of her papers were destroyed in a fire in italy where she died in 1974 much about her remains obscurep
pwells met moura when she was maxim gorkys secretary she was also his lover a relationship she had been encouraged to develop by the cheka the soviet secret police she eventually confessed this to gorky and years later made a similar confession to wells when he discovered she was secretly visiting gorky in russia she had been planted on wells too collaborating with the cheka she explained was the price of life in soviet russia in an exchange tomalin does not mention reported by wellss son anthony west in emhg wells aspects of a lifeem 1984 moura mocked wellss surprise at what she had done had he not studied biology did he not know survival was the first law of evolution for the species wells replied not the conscious individual laughing lightly moura let the matter gop
pmouras attraction to wells may have been real enough she told somerset maugham that wellss skin smelt deliciously of honey but it was intermixed with selfpreservation calculation and deception when they became lovers in gorkys apartment wells writes he believed every word she said to me now he found he could no longer believe in her at all yet nor could he live without her he asked her to marry him and she calmly declined he begged her to live with him and she refused she remained his companion a comforting presence in his despairing last years on her own termsp
pin his relationship with moura wells realised he was no more a conscious individual than were the deluded masses the rational elite to which he imagined he belonged which could direct the future course of human evolution did not existp
ptomalin quotes george orwell as writing wells is too sane to understand the modern world it is a remarkably obtuse judgement it would be truer to say that wells was possessed by the madness of his times his early fictions and the utopias he later promoted are two sides of the same divided mind if anything wellss schemes of worldtransformation are more horrifying than his nightmares of human decline and extinctionp
preferring to his nonfiction bestseller emanticipationsem 1901 tomalin cites wellss assertion that in the new republic the coming worldstate those who could not keep up with higher types would have to die out she does not share with us what wells actually wrotep
pthe new ethics will hold life to be a privilege and a responsibility and the alternative in right conduct between living fully beautifully and efficiently will be to die for a multitude of silly and contemptible creatures feardriven and helpless and useless unhappy or hatefully happy in the midst of squalid dishonour feeble ugly inefficient born of unrestrained lusts and increasing and multiplying through sheer incompetence and stupidity [they] will have little pity and less benevolence the jew will cease to be a physically distinct element in human affairs and for the rest those swarms of black and brown and dirtywhite and yellow people who do not come into the new needs of efficiency i take it they will have to go it is their portion to die out and disappearp
ptomalin claims wells was soon retreating from this racist position altogether but in a talk to a liberal summer school in oxford in 1932 wells declared i am looking for liberal fascisti enlightened nazis as late as 1939 in emthe fate of homo sapiensem wells felt it necessary to include a chapter on the jewish influence in which while condemning the treatment of jews in nazi germany he managed to convey the impression that it arose from a hostility that was in some ways quite understandablep
pwells was not of course a nazi his books were burned along with those of stefan zweig and sigmund freud and he was near the top of the ss execution list if britain was invaded but like much of the progressive intelligentsia of his time he was gripped by ideas eugenics racism a cult of efficiency that the nazis took to their genocidal conclusions george bernard shaw who wrote to wells thanking him for emanticipationsem discussed an extensive use of the lethal chambers as a part of eugenic politics in a 1910 lecture to the eugenics education society some have suggested shaw was satirising eugenics but it is interesting that his name does not appear on the nazi death listp
plike shaw wells was enchanted by tyrants seeing them as engineers of souls who could remould the wayward human animal following an interview with stalin in 1934 published in this magazine wells wrote i have never met a man more candid fair and honest and to those qualities it is and to nothing occult and sinister that he owes his tremendous undisputed ascendancy in russiap
pstrongem[see also a hrefhttpswwwnewstatesmancomculturebooks202001howhgwellsinventedmodernworldhow hg wells invented the modern worlda]emstrongp
ptomalin passes quickly over wellss hideous new republic and spends much of two chapters considering his relations with the fabians there are moments of interest beatrice webb prissily cutting wells off because of his racy private life for example but on the whole it is a dull tale she also spends too long on wellss novels of social commentary emlove and mr lewishamem 1899 emkippsem 1905 emann veronica em1909 and emthe history of mr polly em1910 quaint relics of a world that has faded from memoryp
pin contrast wellss speculative fictions have become popular myths emthe war of the worldsem and emthe invisible manem are part of everyones imagination emthe time machineem is a potent reminder that darwinian evolution is not an upward spiral towards ever more conscious forms of life but an aimless process that could end with lichen emthe island of doctor moreau em an upsetting story i still hesitate before returning to it writes tomalin who gives it a single paragraph concerns an experiment in vivisection designed to remake animals as rational beings what emerged was not a reasonable creature but only an animal tormented with some strange disorder in its brain the story reads today as a premonition of the attempts to remould the human animal that wells foresaw and in some moods supported in the 20th centuryp
pin his last book emmind at the end of its tetherem published in december 1945 wells noted that in the past there was always the assumption of an ultimate restoration of rationality only to conclude there is no pattern of things to come by then he was mortally sick with cancer and diabetes the vitality that had sustained him was gone his hopes for the future had come to nothing but the myths he created will endure as long as modern civilisation survivesp
pemjohn gray is a new statesman contributing writer his most recent book is feline philosophy allen laneemp
pstrongthe young hg wells changing the worldstrongbrclaire tomalinbremviking 272pp 20emp | poh emmon dieuem terrible pessimist people dh lawrences verdict hg wells letter friend 1909 surprising perverse wells spent life working transform human world better ordered beautiful lawrences observation contains neglected truth wells believe future humanity banish suspicion humankind remain incurably irrational eventually destroyed itselfp pwellss view human animal expressed early masterpieces speculative fiction emthe time machineem 1895 emthe island dr moreauem 1896 emthe invisible manem 1897 emthe war worldsem 1897 science opened vistas progress wider hitherto conceived end point evolution dying planet covered lichen trying turn animals rational humans produce tormented hybrid ancient dream invisibility proved curse resources modern civilisation powerless invasion advanced species visions came wells revelations innermost doubts left himp pthere lives wells claire tomalins gives picture writer vividly compelling freshly detailed captures young wellss vitality showing battling poverty illness finding way british intellectual life forming tangled relationships wide variety womenp pwells born 1866 bromley kent fourth child joseph wells shopkeeper cricketer sarah wells maid housekeeper uppark grand 17thcentury house south downs schooling erratic learned bedridden result illness accident reading books father brought local library 1877 joseph bad fall ending cricketing career family finances depleted wells apprenticed drapers shop pharmacy positions loathed 1883 briefly contemplating suicide persuaded mother father better pupilteacher grammar school gained post telling parents applied scholarship normal school science south kensingtonp pstrongem[see hrefhttpswwwnewstatesmancomuncategorized202008nsarchivehgwellsmaniknewfrom ns archive hg wells man knewa]emstrongp pby september 1884 18 wells student th huxley president royal society worlds leading darwinist living london guinea week gaunt wells barely body soul watched fellow students fainted hunger laboratory failing degree took position boys school disaster struck injured rugby game invalid occasion nearly diedp phe seized catastrophe opportunity began writing stories magazines sickbed list published work showing grand total 1 noted someday succeed weary game gave thing intention dying virginp pin theory wells radical collectivist practice unabashed individualist truer relations women world future practice free love wells serve instruments needsp pwellss sexual career began married cousin isabel mary wells 1890 played marriage sixyearlong engagement faithful wedding night fiasco wells launched called enterprising promiscuity 1894 couple separated wells moved students amy robbins later known jane wife october 1895 wells treated jane abominably spending time lovers returned dying cancer leaving regularly spend days france current lover livingp pwells desired clever interesting women tomalin writes energy charm reputation lover fame riches tomalin goes lovers outstandingly gifted women personalities found compelling amber reeves wells fathered daughter brilliant cambridge student founder universitys fabian society later feminist author rebecca west son celebrated writer elizabeth von arnim bestselling novelist odette keun prominent dutch socialist margaret sanger world leader campaign birth control dorothy richardson noted critic author 13volume empilgrimageem modernist classicp pwellss greatest love moura budberg extraordinary tomalin writesp pshe lived life spectacular difficulty danger saved children courage charm ruthlessness wells knew worried past marriages love affairs imprisonment spying russia berlin estonia italy waver determination herp pall true hardly justice moura pivotal role played wellss life tomalin sets present wells age 40 follows fifth decade books final chapter takes death august 1946 pity fails explore wellss relationship moura fully posed severest challenge faced view world himselfp pmany knew commented mouras serene fatalism unyielding determination born 1892 daughter tsarist nobleman faced person husband shot dead family estate 1919 papers destroyed fire italy died 1974 remains obscurep pwells met moura maxim gorkys secretary lover relationship encouraged develop cheka soviet secret police eventually confessed gorky years later similar confession wells discovered secretly visiting gorky russia planted wells collaborating cheka explained price life soviet russia exchange tomalin mention reported wellss son anthony west emhg wells aspects lifeem 1984 moura mocked wellss surprise studied biology know survival law evolution species wells replied conscious individual laughing lightly moura let matter gop pmouras attraction wells real told somerset maugham wellss skin smelt deliciously honey intermixed selfpreservation calculation deception lovers gorkys apartment wells writes believed word said found longer believe live asked marry calmly declined begged live refused remained companion comforting presence despairing years termsp pin relationship moura wells realised conscious individual deluded masses rational elite imagined belonged direct future course human evolution existp ptomalin quotes george orwell writing wells sane understand modern world remarkably obtuse judgement truer wells possessed madness times early fictions utopias later promoted sides divided mind wellss schemes worldtransformation horrifying nightmares human decline extinctionp preferring nonfiction bestseller emanticipationsem 1901 tomalin cites wellss assertion new republic coming worldstate higher types die share wells actually wrotep pthe new ethics hold life privilege responsibility alternative right conduct living fully beautifully efficiently die multitude silly contemptible creatures feardriven helpless useless unhappy hatefully happy midst squalid dishonour feeble ugly inefficient born unrestrained lusts increasing multiplying sheer incompetence stupidity [they] little pity benevolence jew cease physically distinct element human affairs rest swarms black brown dirtywhite yellow people come new needs efficiency portion die disappearp ptomalin claims wells soon retreating racist position altogether talk liberal summer school oxford 1932 wells declared looking liberal fascisti enlightened nazis late 1939 emthe fate homo sapiensem wells felt necessary include chapter jewish influence condemning treatment jews nazi germany managed convey impression arose hostility ways understandablep pwells course nazi books burned stefan zweig sigmund freud near ss execution list britain invaded like progressive intelligentsia time gripped ideas eugenics racism cult efficiency nazis took genocidal conclusions george bernard shaw wrote wells thanking emanticipationsem discussed extensive use lethal chambers eugenic politics 1910 lecture eugenics education society suggested shaw satirising eugenics interesting appear nazi death listp plike shaw wells enchanted tyrants seeing engineers souls remould wayward human animal following interview stalin 1934 published magazine wells wrote met man candid fair honest qualities occult sinister owes tremendous undisputed ascendancy russiap pstrongem[see hrefhttpswwwnewstatesmancomculturebooks202001howhgwellsinventedmodernworldhow hg wells invented modern worlda]emstrongp ptomalin passes quickly wellss hideous new republic spends chapters considering relations fabians moments interest beatrice webb prissily cutting wells racy private life example dull tale spends long wellss novels social commentary emlove mr lewishamem 1899 emkippsem 1905 emann veronica em1909 emthe history mr polly em1910 quaint relics world faded memoryp pin contrast wellss speculative fictions popular myths emthe war worldsem emthe invisible manem everyones imagination emthe time machineem potent reminder darwinian evolution upward spiral conscious forms life aimless process end lichen emthe island doctor moreau em upsetting story hesitate returning writes tomalin gives single paragraph concerns experiment vivisection designed remake animals rational beings emerged reasonable creature animal tormented strange disorder brain story reads today premonition attempts remould human animal wells foresaw moods supported 20th centuryp pin book emmind end tetherem published december 1945 wells noted past assumption ultimate restoration rationality conclude pattern things come mortally sick cancer diabetes vitality sustained gone hopes future come myths created endure long modern civilisation survivesp pemjohn gray new statesman contributing writer recent book feline philosophy allen laneemp pstrongthe young hg wells changing worldstrongbrclaire tomalinbremviking 272pp 20emp |
61a7f8bb353613f0736d6194 | It’s not your doctor’s fault you can’t get an appointment | pit was alright as long as you didnt get illp
pmy stepgrandfather used to say this to me when reminiscing about life growing up in the welsh valleys in the 1930s prewar britain could be a cruel place especially if you were from a poor family which he was it could be crueller still if you had the bad luck to be poor emandem sick a cursed combination a visit to the doctor could set you back half a weeks wagesp
pwe have come a long way as a country since then we have the nhs for starters founded by the former labour health secretary aneurin bevan who grew up in tredegar a few miles down the road from where my grandfather lived yet today in pandemic britain access to adequate healthcare feels once again out of reach to many who fall illp
panecdotes about the difficulty of getting a doctors appointment in 2021 are ubiquitous you phone up your local surgery and wait on hold for half an hour you are told to call back at 8 oclock the next morning then the process begins all over again if you manage to get through to a receptionist you are sometimes told that a facetoface appointment is unavailable instead the doctor will call you back perhaps in a weeks time at what time you ask we cant guarantee a specific time comes the replyp
pthis was my own recent experience for the more assertive among us its usually possible eventually to navigate the kafkaesque booking system and obtain an appointment but many simply give up the most recent gp people survey a relnoreferrer noopener hrefhttpswwwstandardcouknewsukpeoplenhsenglandrainbowgovernmentb944781html target_blankfounda that 42 per cent of people have avoided making a gp appointment in the past 12 monthsp
pthe governments national covid policy last year instructed gps to conduct appointments remotely switching back is proving a challenge in august just 58 per cent of appointments were a relnoreferrer noopener hrefhttpswwwstandardcouknewsuksajidjavidgpsenglandnhsdigitalgovernmentb958110html target_blankconducteda facetoface compared to a prepandemic figure of 80 per cent in light of this certain media outlets have been campaigning for more facetoface gp appointments the corresponding stories have frequently been coloured by depictions of gps as lazy entitled and obstinately uncooperative gps still ignoring orders to allow patients facetoface appointments a relnoreferrer noopener hrefhttpswwwtelegraphcouknews20210820exclusivegpsstillignoringordersallowpatientsfacetoface target_blankboomeda a recent headline in the emdaily telegraphem the emspectatorem has a hrefhttpswwwspectatorcoukarticlewhyaregpsstillnotseeingpatientsinpersonaccuseda doctors of hiding behind zoom screens the health secretary sajid javid a relnoreferrer noopener hrefhttpswwwdailyadventcomnews9de99a1ffd8e99f4450256557a576e7dthenewfacetofacerevolutionsajidjavidlaunchesoverhaulingpaccesssoallpatientscanseeadoctorinpersonwithleaguetablesandhitsquadsforthosethatfail target_blankrespondeda to the negative press coverage by announcing league tables and hit squads for those that fail to offer facetoface appointmentsp
pstrongem[see also a hrefhttpswwwnewstatesmancompoliticshealth202110ifyourestrugglingtoseeyourgpitdoesntmeantheyarehidingfromyouif youre struggling to see your gp it doesnt mean they are hiding from youa]emstrongp
phealthcare workers have frequently been on the receiving end of public ire during the pandemic we clapped for nhs staff last year but since then many nhs workers have had to endure verbal abuse from covid deniers and antivaxxers including a relnoreferrer noopener hrefhttpswwwwalesonlinecouknewsuknewshealthcarebodiesdemandendabuse21219916 target_blankcomparisonsa to nazi war criminals others have been a relnoreferrer noopener hrefhttpsrcnicomnursingstandardnewsroomnewsafterbeingspatgrabbedandhitnurseurgesnhsstafftoreportattacksdatix177171 target_blankspat ata and subjected to physical violence in november a member of staff at lewisham university hospital was a relnoreferrer noopener hrefhttpswwwnursingtimesnetnewshospitalstaffmemberstabbedatlondonhospitalamidrisinglevelsofviolence29112021 target_blankstabbeda by a patient a hospital in norfolk has even a relnoreferrer noopener hrefhttpswwwtheguardiancomuknews2021oct10nhsstafffacerisingtideofabusefrompatientsprovokedbylongwaits target_blankstationeda private security at its main entrance overnight following increasing incidents of rude and abusive behaviour against staffp
pis it any wonder some gps are reluctant to return to giving inperson consultations amidst a climate of such animosity another recent survey found that a relnoreferrer noopener hrefhttpswwwbmaorgukbmamediacentrebmaurgespublictobekindassurveyrevealsworryinglevelsofabuseagainstdoctorsandcolleaguesutm_sourcethe20british20medical20associationutm_mediumemailutm_campaign12585831_gp20enewsletter20120821utm_contentbma20statement20gp20surveydm_ijvx7hrafwy8fowugvne1 target_blankmore than halfa 51 per cent of gps experienced abuse in the month of july this yearp
pof course its easy to rail at doctors when youve just wasted an hour on the phone only to be informed that regrettably there are no appointments i know because ive felt this emotion welling up inside me too if it really is our nhs as the mawkish slogan has it then why does getting a gp appointment feel like such a big askp
pyet the fault probably doesnt lie with your local doctor the health service is dealing with record numbers of patients and there simply arent enough gps to take up the slack it is this simple equation rather than the purported indolence of gps that is causing patient frustrationsp
pthe previous government acknowledged as much back in 2015 when it promised to hire 5000 extra gps within five years a target it subsequently failed to meet indeed a recent a relnoreferrer noopener hrefhttpsnewsskycomstorythenumberofdoctorsisfallingandappointmentsaregoingupbutthatsonlypartoftheproblem12431982 target_blankanalysisa by sky news found that the number of fully qualified gps had fallen in four out of five areas of england since march 2016 in the lead up to the 2019 general election the then health secretary matt hancock acknowledged this the incoming government sought to cushion the failure with a fresh pledge to recruit 6000 gps by 2025p
pthis too has failed to materialise a relnoreferrer noopener hrefhttpswwwtheguardiancomsociety2021sep10gpsenglandfindingincreasinglyhardguaranteesafecaredoctors target_blankaccording to the royal college of gpsa the number of practicing gps fell by 1307 to 28096 between september 2015 and march 2021 as of september 2021 there were a hrefhttpswwwbmaorgukadviceandsupportnhsdeliveryandworkforcepressurespressuresingeneralpractice1704 afewer fully qualified fulltime gps compared to 2015p
ptoday england a relnoreferrer noopener hrefhttpswwwbmaorgukbmamediacentreenglandhasanunforgiveablenhsworkforcecrisisthatthreatensfuturepatientsafetybmaresearchfinds target_blankrequiresa around 50000 extra doctors to meet the countrys health needs at present there are just 28 doctors per 1000 people compared to 37 in similarly developed eu countries much as in the bad old days access to healthcare is significantly worse for the poor according to recent a relnoreferrer noopener hrefhttpsnewsskycomstorythenumberofdoctorsisfallingandappointmentsaregoingupbutthatsonlypartoftheproblem12431982 target_blankanalysisa deprived areas have fewer gps than wealthier ones and this gap has been widening over timep
pstrongem[see also a hrefhttpswwwnewstatesmancompoliticshealth202111intheconsultingroomthedoctorisntalwaystheonegivingthereassurancein the consulting room the doctor isnt always the one giving the reassurancea]emstrongp
pthis dwindling band of doctors is having to cater to a record number of patients there were 4 per cent a relnoreferrer noopener hrefhttpsnewsskycomstorythenumberofdoctorsisfallingandappointmentsaregoingupbutthatsonlypartoftheproblem12431982 target_blankmorea gp sessions in 2021 than in the same period in 2019 the typical gp practice has a hrefhttpswwwbmaorgukadviceandsupportnhsdeliveryandworkforcepressurespressuresingeneralpractice1849 amore patients today than six years ago and there were 73 million a relnoreferrer noopener hrefhttpswwwbmjcomcontent374bmjn2234 target_blankmorea appointments or 31 million more if you exclude covid vaccinations in june of 2021 compared to the same period in 2019p
punsurprisingly against this backdrop many gps are struggling under the pressures of increased workloads according to a a relnoreferrer noopener hrefhttpscommitteesparliamentukpublications6158documents68766default target_blanksurveya by the british medical association nearly half of doctors said they were suffering from depression anxiety stress burnout emotional distress or another mental health condition some gps are looking to exit the health service altogether compounding the problem of staff shortages more than one in 10 gps questioned in a a hrefhttpswwwmanchesteracukdiscovernewsnumbersofgpswantingtoleavealreadyhighbeforecovidfindssurveysurvey asaid they planned to leave the nhsp
pmore patients and fewer increasingly frazzled gps its easy to see why many of us are crashing up against answerphone messages when we call the local surgery though it might feel emotionally gratifying to take out those frustrations on doctors our anger would be better directed elsewhere if we have a primary care system that increasingly resembles the bad old days it is down to the governments longstanding failure to solve the nhs recruitment crisisp | pit alright long didnt illp pmy stepgrandfather reminiscing life growing welsh valleys 1930s prewar britain cruel place especially poor family crueller bad luck poor emandem sick cursed combination visit doctor set half weeks wagesp pwe come long way country nhs starters founded labour health secretary aneurin bevan grew tredegar miles road grandfather lived today pandemic britain access adequate healthcare feels reach fall illp panecdotes difficulty getting doctors appointment 2021 ubiquitous phone local surgery wait hold half hour told 8 oclock morning process begins manage receptionist told facetoface appointment unavailable instead doctor weeks time time ask cant guarantee specific time comes replyp pthis recent experience assertive usually possible eventually navigate kafkaesque booking system obtain appointment simply recent gp people survey relnoreferrer noopener hrefhttpswwwstandardcouknewsukpeoplenhsenglandrainbowgovernmentb944781html target_blankfounda 42 cent people avoided making gp appointment past 12 monthsp pthe governments national covid policy year instructed gps conduct appointments remotely switching proving challenge august 58 cent appointments relnoreferrer noopener hrefhttpswwwstandardcouknewsuksajidjavidgpsenglandnhsdigitalgovernmentb958110html target_blankconducteda facetoface compared prepandemic figure 80 cent light certain media outlets campaigning facetoface gp appointments corresponding stories frequently coloured depictions gps lazy entitled obstinately uncooperative gps ignoring orders allow patients facetoface appointments relnoreferrer noopener hrefhttpswwwtelegraphcouknews20210820exclusivegpsstillignoringordersallowpatientsfacetoface target_blankboomeda recent headline emdaily telegraphem emspectatorem hrefhttpswwwspectatorcoukarticlewhyaregpsstillnotseeingpatientsinpersonaccuseda doctors hiding zoom screens health secretary sajid javid relnoreferrer noopener hrefhttpswwwdailyadventcomnews9de99a1ffd8e99f4450256557a576e7dthenewfacetofacerevolutionsajidjavidlaunchesoverhaulingpaccesssoallpatientscanseeadoctorinpersonwithleaguetablesandhitsquadsforthosethatfail target_blankrespondeda negative press coverage announcing league tables hit squads fail offer facetoface appointmentsp pstrongem[see hrefhttpswwwnewstatesmancompoliticshealth202110ifyourestrugglingtoseeyourgpitdoesntmeantheyarehidingfromyouif youre struggling gp doesnt mean hiding youa]emstrongp phealthcare workers frequently receiving end public ire pandemic clapped nhs staff year nhs workers endure verbal abuse covid deniers antivaxxers including relnoreferrer noopener hrefhttpswwwwalesonlinecouknewsuknewshealthcarebodiesdemandendabuse21219916 target_blankcomparisonsa nazi war criminals relnoreferrer noopener hrefhttpsrcnicomnursingstandardnewsroomnewsafterbeingspatgrabbedandhitnurseurgesnhsstafftoreportattacksdatix177171 target_blankspat ata subjected physical violence november member staff lewisham university hospital relnoreferrer noopener hrefhttpswwwnursingtimesnetnewshospitalstaffmemberstabbedatlondonhospitalamidrisinglevelsofviolence29112021 target_blankstabbeda patient hospital norfolk relnoreferrer noopener hrefhttpswwwtheguardiancomuknews2021oct10nhsstafffacerisingtideofabusefrompatientsprovokedbylongwaits target_blankstationeda private security main entrance overnight following increasing incidents rude abusive behaviour staffp pis wonder gps reluctant return giving inperson consultations amidst climate animosity recent survey found relnoreferrer noopener hrefhttpswwwbmaorgukbmamediacentrebmaurgespublictobekindassurveyrevealsworryinglevelsofabuseagainstdoctorsandcolleaguesutm_sourcethe20british20medical20associationutm_mediumemailutm_campaign12585831_gp20enewsletter20120821utm_contentbma20statement20gp20surveydm_ijvx7hrafwy8fowugvne1 target_blankmore halfa 51 cent gps experienced abuse month july yearp pof course easy rail doctors youve wasted hour phone informed regrettably appointments know ive felt emotion welling inside nhs mawkish slogan getting gp appointment feel like big askp pyet fault probably doesnt lie local doctor health service dealing record numbers patients simply arent gps slack simple equation purported indolence gps causing patient frustrationsp pthe previous government acknowledged 2015 promised hire 5000 extra gps years target subsequently failed meet recent relnoreferrer noopener hrefhttpsnewsskycomstorythenumberofdoctorsisfallingandappointmentsaregoingupbutthatsonlypartoftheproblem12431982 target_blankanalysisa sky news found number fully qualified gps fallen areas england march 2016 lead 2019 general election health secretary matt hancock acknowledged incoming government sought cushion failure fresh pledge recruit 6000 gps 2025p pthis failed materialise relnoreferrer noopener hrefhttpswwwtheguardiancomsociety2021sep10gpsenglandfindingincreasinglyhardguaranteesafecaredoctors target_blankaccording royal college gpsa number practicing gps fell 1307 28096 september 2015 march 2021 september 2021 hrefhttpswwwbmaorgukadviceandsupportnhsdeliveryandworkforcepressurespressuresingeneralpractice1704 afewer fully qualified fulltime gps compared 2015p ptoday england relnoreferrer noopener hrefhttpswwwbmaorgukbmamediacentreenglandhasanunforgiveablenhsworkforcecrisisthatthreatensfuturepatientsafetybmaresearchfinds target_blankrequiresa 50000 extra doctors meet countrys health needs present 28 doctors 1000 people compared 37 similarly developed eu countries bad old days access healthcare significantly worse poor according recent relnoreferrer noopener hrefhttpsnewsskycomstorythenumberofdoctorsisfallingandappointmentsaregoingupbutthatsonlypartoftheproblem12431982 target_blankanalysisa deprived areas fewer gps wealthier ones gap widening timep pstrongem[see hrefhttpswwwnewstatesmancompoliticshealth202111intheconsultingroomthedoctorisntalwaystheonegivingthereassurancein consulting room doctor isnt giving reassurancea]emstrongp pthis dwindling band doctors having cater record number patients 4 cent relnoreferrer noopener hrefhttpsnewsskycomstorythenumberofdoctorsisfallingandappointmentsaregoingupbutthatsonlypartoftheproblem12431982 target_blankmorea gp sessions 2021 period 2019 typical gp practice hrefhttpswwwbmaorgukadviceandsupportnhsdeliveryandworkforcepressurespressuresingeneralpractice1849 amore patients today years ago 73 million relnoreferrer noopener hrefhttpswwwbmjcomcontent374bmjn2234 target_blankmorea appointments 31 million exclude covid vaccinations june 2021 compared period 2019p punsurprisingly backdrop gps struggling pressures increased workloads according relnoreferrer noopener hrefhttpscommitteesparliamentukpublications6158documents68766default target_blanksurveya british medical association nearly half doctors said suffering depression anxiety stress burnout emotional distress mental health condition gps looking exit health service altogether compounding problem staff shortages 10 gps questioned hrefhttpswwwmanchesteracukdiscovernewsnumbersofgpswantingtoleavealreadyhighbeforecovidfindssurveysurvey asaid planned leave nhsp pmore patients fewer increasingly frazzled gps easy crashing answerphone messages local surgery feel emotionally gratifying frustrations doctors anger better directed primary care system increasingly resembles bad old days governments longstanding failure solve nhs recruitment crisisp |
61a7f8c7353613f0736d6196 | Controversial Researcher Driven from Campus at Old Dominion University | pprofessor allyn walker was a sociologist at old dominion university walkers research included quotminor attracted individualsquot which was the topic of walkers new book recently published by a wellrespected university press when walkers research came to public attention it generated immediate controversy including threats against walker and the campus and calls for walkers immediate termination the university a hrefhttpswwwwtkrcomnewsodureleasesstatementafterassistantprofessorgivescontroversialinterviewdefendingpeopleattractedtochildreninitiallya defended its commitment to academic freedom but soon placed walker on a hrefhttpswwwinsidehigheredcomnews20211118olddominionputsscholarpedophilialeaveadministrative leavea walker has now a hrefhttpswwwinsidehigheredcomnews20211129controversialscholarpedophiliaresignsolddominionresigneda from the facultyp
pcathy young has recently called quotthe allyn walker story is a hrefhttpscathyarcdigitalmediaptheprofessorandthepedophilesa test casea for both progressives and conservativesquot and shes right old dominion seems to have failed its testp
pwhen walker was suspended the a hrefhttpsacademicfreedomorgacademic freedom alliancea warned old dominion university that it was caving under pressure and sending a chilling message to every member of the faculty who might be engaged in controversial research unfortunately the university continued down that path and allowed the mob to drive a professor from the campus although the walker case has now been resolved with the professors departure from campus the issues raised by the controversy remain all too relevantp
pthe afa has a hrefhttpsacademicfreedomorgafacaseupdatesnow released publiclya the letter that it sent to the administration of odu as always the afa is not concerned with the substance or merits of a professors work or ideas but with the principle that universities should be places that tolerate controversial ideas and that allow free inquiry and debate not public opinion or political pressure to separate error from truth universities should not allow threats and intimidation to shortcircuit that process of critical inquiry and should not allow ideas to be suppressed and scholars defenestrated simply because they are perceived to be heretical or even dangerousp
pfrom the letterp
blockquotepit cannot be consistent with academic freedom for a university to cave in to hostile reaction on and off campus to a professors scholarly work the fact that students or members of the public might be offended or disturbed by a professors research agenda arguments or terminology is no basis for sanctioning the professor the fact that they might express their outrage by making threats to the professor or to the campus only heightens the responsibility of the university to ensure that the professor is capable of continuing to perform their academic duties unmolested for a university to validate such a quothecklers vetoquot by suspending rather than protecting the faculty member will only encourage such campaigns of threats and intimidation there are far more appropriate steps for a university to take in response to credible threats of violence or disruption that would be compatible with rather than contrary to academic freedom and the university has a responsibility to take such stepsp
p p
pthere is no doubt that the questions being examined by professor walker are important ones academia should be a place where such difficult questions can be boldly and honestly investigated if a scholars analysis is mistaken then it should be rebutted or ignored but the scholar should not be driven from campus for daring to ask such difficult questions or for reaching the wrong or unpopular answerspblockquote
pa hrefhttpsacademicfreedomorgwpcontentuploads202111afalettertoolddominionunversityregardingallynwalkerpdfread the whole thing hereap
pthe post a relnofollow hrefhttpsreasoncomvolokh20211201controversialresearcherdrivenfromcampusatolddominionuniversitycontroversial researcher driven from campus at old dominion universitya appeared first on a relnofollow hrefhttpsreasoncomreasoncomap | pprofessor allyn walker sociologist old dominion university walkers research included quotminor attracted individualsquot topic walkers new book recently published wellrespected university press walkers research came public attention generated immediate controversy including threats walker campus calls walkers immediate termination university hrefhttpswwwwtkrcomnewsodureleasesstatementafterassistantprofessorgivescontroversialinterviewdefendingpeopleattractedtochildreninitiallya defended commitment academic freedom soon placed walker hrefhttpswwwinsidehigheredcomnews20211118olddominionputsscholarpedophilialeaveadministrative leavea walker hrefhttpswwwinsidehigheredcomnews20211129controversialscholarpedophiliaresignsolddominionresigneda facultyp pcathy young recently called quotthe allyn walker story hrefhttpscathyarcdigitalmediaptheprofessorandthepedophilesa test casea progressives conservativesquot shes right old dominion failed testp pwhen walker suspended hrefhttpsacademicfreedomorgacademic freedom alliancea warned old dominion university caving pressure sending chilling message member faculty engaged controversial research unfortunately university continued path allowed mob drive professor campus walker case resolved professors departure campus issues raised controversy remain relevantp pthe afa hrefhttpsacademicfreedomorgafacaseupdatesnow released publiclya letter sent administration odu afa concerned substance merits professors work ideas principle universities places tolerate controversial ideas allow free inquiry debate public opinion political pressure separate error truth universities allow threats intimidation shortcircuit process critical inquiry allow ideas suppressed scholars defenestrated simply perceived heretical dangerousp pfrom letterp blockquotepit consistent academic freedom university cave hostile reaction campus professors scholarly work fact students members public offended disturbed professors research agenda arguments terminology basis sanctioning professor fact express outrage making threats professor campus heightens responsibility university ensure professor capable continuing perform academic duties unmolested university validate quothecklers vetoquot suspending protecting faculty member encourage campaigns threats intimidation far appropriate steps university response credible threats violence disruption compatible contrary academic freedom university responsibility stepsp p p pthere doubt questions examined professor walker important ones academia place difficult questions boldly honestly investigated scholars analysis mistaken rebutted ignored scholar driven campus daring ask difficult questions reaching wrong unpopular answerspblockquote pa hrefhttpsacademicfreedomorgwpcontentuploads202111afalettertoolddominionunversityregardingallynwalkerpdfread thing hereap pthe post relnofollow hrefhttpsreasoncomvolokh20211201controversialresearcherdrivenfromcampusatolddominionuniversitycontroversial researcher driven campus old dominion universitya appeared relnofollow hrefhttpsreasoncomreasoncomap |
61a7f8e5353613f0736d6198 | A "Witch Hunt" at the University of Illinois at Chicago | pnearly a year ago university of illinois at chicago law professor jason kilborn came under criticism from students administrators and colleagues for including a hypothetical on his a hrefhttpsreasoncomvolokh20210115tenuredlawprofapparentlysuspendedforracialharassmentlawsuitproblemonacivilprocedureexamcivil procedure exama involving an individual telling an investigating lawyer that former coworkers quotexpressed their anger at plaintiff calling her a quotn____quot and quotb____quot profane expressions for african americans and women and vowed to get rid of herquot once complaints surfaced a hrefhttpsabovethelawcom202101lawschoolnwordcontroversyismorecomplicatedthanitappearsatfirstglancekilborn apologizeda but the controversy and allegations only grew students eventually brought in a hrefhttpswwwinsidehigheredcomnews20211110whensuspendingprofessorisntenoughjesse jacksona to bolster their demands that kilborn be fired a hrefhttpswwwthefireorgfirewarnsuniversityofillinoisatchicagooverinvestigationintolawprofessorsexamquestionkilborn was suspended and investigateda he eventually reached a settlement with the university that would allow him to return to his teaching duties but the university has a hrefhttpswwwthefireorguniversityofillinoisatchicagorenegesonagreementwithlawprofessorjasonkilbornsubsequently reneged on that agreementa it continues to single him out for opprobrium discipline and reeducation the chancellor of uic has now a hrefhttpstodayuiceduuiclawmatterdug in his heels on the mattera northwestern university law professor andy koppelman has written about this case a hrefhttpswwwchroniclecomarticleisthislawprofessorreallyahomicidalthreatfrom the beginninga and has appropriately decried the universitys actions as a quota hrefhttpsbalkinblogspotcom202111thewitchhuntatjohnmarshalllawhtmlwitch huntaquotp
pthe a hrefhttpsacademicfreedomorgacademic freedom alliancea has a hrefhttpsacademicfreedomorgafacaseupdatesreleased the lettera that it sent to law school dean at uic from the letterp
blockquotepfor the university of illinois at chicago to retaliate against and sanction professor kilborn for constitutionally and contractually protected classroom speech would be a grave violation of academic freedom the academic freedom alliance stands firmly behind professor kilborn in this matter calls on the university of illinois at chicago to adhere to its academic freedom principles and to abandon any conditions on his full return to his academic duties and to publicly and emphatically reaffirm that professors at the university are free to conduct classroom discussions and to draft class exams that engage relevant but controversial language and materialspblockquote
pa hrefhttpsacademicfreedomorgwpcontentuploads202111afalettertouniversityofillinoisregardingjasonkilbornpdfread the whole thing hereap
pthe post a relnofollow hrefhttpsreasoncomvolokh20211201awitchhuntattheuniversityofillinoisatchicagoa quotwitch huntquot at the university of illinois at chicagoa appeared first on a relnofollow hrefhttpsreasoncomreasoncomap | pnearly year ago university illinois chicago law professor jason kilborn came criticism students administrators colleagues including hypothetical hrefhttpsreasoncomvolokh20210115tenuredlawprofapparentlysuspendedforracialharassmentlawsuitproblemonacivilprocedureexamcivil procedure exama involving individual telling investigating lawyer coworkers quotexpressed anger plaintiff calling quotn____quot quotb____quot profane expressions african americans women vowed rid herquot complaints surfaced hrefhttpsabovethelawcom202101lawschoolnwordcontroversyismorecomplicatedthanitappearsatfirstglancekilborn apologizeda controversy allegations grew students eventually brought hrefhttpswwwinsidehigheredcomnews20211110whensuspendingprofessorisntenoughjesse jacksona bolster demands kilborn fired hrefhttpswwwthefireorgfirewarnsuniversityofillinoisatchicagooverinvestigationintolawprofessorsexamquestionkilborn suspended investigateda eventually reached settlement university allow return teaching duties university hrefhttpswwwthefireorguniversityofillinoisatchicagorenegesonagreementwithlawprofessorjasonkilbornsubsequently reneged agreementa continues single opprobrium discipline reeducation chancellor uic hrefhttpstodayuiceduuiclawmatterdug heels mattera northwestern university law professor andy koppelman written case hrefhttpswwwchroniclecomarticleisthislawprofessorreallyahomicidalthreatfrom beginninga appropriately decried universitys actions quota hrefhttpsbalkinblogspotcom202111thewitchhuntatjohnmarshalllawhtmlwitch huntaquotp pthe hrefhttpsacademicfreedomorgacademic freedom alliancea hrefhttpsacademicfreedomorgafacaseupdatesreleased lettera sent law school dean uic letterp blockquotepfor university illinois chicago retaliate sanction professor kilborn constitutionally contractually protected classroom speech grave violation academic freedom academic freedom alliance stands firmly professor kilborn matter calls university illinois chicago adhere academic freedom principles abandon conditions return academic duties publicly emphatically reaffirm professors university free conduct classroom discussions draft class exams engage relevant controversial language materialspblockquote pa hrefhttpsacademicfreedomorgwpcontentuploads202111afalettertouniversityofillinoisregardingjasonkilbornpdfread thing hereap pthe post relnofollow hrefhttpsreasoncomvolokh20211201awitchhuntattheuniversityofillinoisatchicagoa quotwitch huntquot university illinois chicagoa appeared relnofollow hrefhttpsreasoncomreasoncomap |
61a949732ac52792067f2c36 | Canadian Profits and Nuclear Armageddon Pt 1 | a relnofollow hrefhttpstheanalysisnewscanadianprofitsandnucleararmageddonpt1 titlecanadian profits and nuclear armageddon pt 1img sizesmaxwidth 1024px 100vw 1024px srchttpstheanalysisnewswpcontentuploads202112webcanadianprofitsandnucleararmageddon1024x603jpg width1024 alt srcsethttpstheanalysisnewswpcontentuploads202112webcanadianprofitsandnucleararmageddon1024x603jpg 1024w httpstheanalysisnewswpcontentuploads202112webcanadianprofitsandnucleararmageddon300x177jpg 300w httpstheanalysisnewswpcontentuploads202112webcanadianprofitsandnucleararmageddon768x452jpg 768w httpstheanalysisnewswpcontentuploads202112webcanadianprofitsandnucleararmageddonjpg 1100w classwebfeedsfeaturedvisual wppostimage height603aparve error src mismatch url httpswwwyoutubecomwatchvue9qhsngcbs src in httpswwwyoutubecomembedue9qhsngcbsfeatureoembedampenablejsapi1amporiginhttpstheanalysisnews src gen httpswwwyoutubecomembedue9qhsngcbsactual comparison url httpswwwyoutubecomwatchvue9qhsngcbs src in httpswwwyoutubecomembedue9qhsngcbsenablejsapi1amporiginhttps3a2f2ftheanalysisp
pa relnofollow hrefhttpstheanalysisnewscanadianprofitsandnucleararmageddonpt1sourceap | relnofollow hrefhttpstheanalysisnewscanadianprofitsandnucleararmageddonpt1 titlecanadian profits nuclear armageddon pt 1img sizesmaxwidth 1024px 100vw 1024px srchttpstheanalysisnewswpcontentuploads202112webcanadianprofitsandnucleararmageddon1024x603jpg width1024 alt srcsethttpstheanalysisnewswpcontentuploads202112webcanadianprofitsandnucleararmageddon1024x603jpg 1024w httpstheanalysisnewswpcontentuploads202112webcanadianprofitsandnucleararmageddon300x177jpg 300w httpstheanalysisnewswpcontentuploads202112webcanadianprofitsandnucleararmageddon768x452jpg 768w httpstheanalysisnewswpcontentuploads202112webcanadianprofitsandnucleararmageddonjpg 1100w classwebfeedsfeaturedvisual wppostimage height603aparve error src mismatch url httpswwwyoutubecomwatchvue9qhsngcbs src httpswwwyoutubecomembedue9qhsngcbsfeatureoembedampenablejsapi1amporiginhttpstheanalysisnews src gen httpswwwyoutubecomembedue9qhsngcbsactual comparison url httpswwwyoutubecomwatchvue9qhsngcbs src httpswwwyoutubecomembedue9qhsngcbsenablejsapi1amporiginhttps3a2f2ftheanalysisp pa relnofollow hrefhttpstheanalysisnewscanadianprofitsandnucleararmageddonpt1sourceap |
61a9499b2ac52792067f2c3a | *Where is My Flying Car?* | pengineer j storrs hall is the author of a relnoopener hrefhttpswwwamazoncomwhereflyingcarstorrshalldp1953953182 target_blankthis new stripe press booka lets be honest you might think this is just the usual blah blah blah heard it a thousand times since 2011 kind of treatment but no it is a detailed and nuanced and original treatment at times obsessively so of why various pending new physical technologies such as nuclear power and nanotech never really came to pass and transform our world as they might havep
pa relattachment wpatt82488 hrefhttpsmarginalrevolutioncomattachment_id82488img sizesmaxwidth 438px 100vw 438px srchttpmarginalrevolutioncomwpcontentuploads202112zflyingcarjpg alt width438 srcsethttpmarginalrevolutioncomwpcontentuploads202112zflyingcarjpg 1752w httpmarginalrevolutioncomwpcontentuploads202112zflyingcar205x300jpg 205w httpmarginalrevolutioncomwpcontentuploads202112zflyingcar701x1024jpg 701w httpmarginalrevolutioncomwpcontentuploads202112zflyingcar768x1122jpg 768w httpmarginalrevolutioncomwpcontentuploads202112zflyingcar1051x1536jpg 1051w httpmarginalrevolutioncomwpcontentuploads202112zflyingcar1402x2048jpg 1402w classwpimage82488 height640ap
pdefinitely recommended worthy of a relnoopener hrefhttpsmarginalrevolutioncommarginalrevolution202111bestnonfictionbooksof2021html target_blankthe best nonfiction of the year lista here is a relnoopener hrefhttpspressstripecomwhereismyflyingcar target_blankthe stripe press website for the bookap
pthe post a relnofollow hrefhttpmarginalrevolutioncommarginalrevolution202112whereismyflyingcaramemoiroffuturepasthtmlwhere is my flying cara appeared first on a relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap | pengineer j storrs hall author relnoopener hrefhttpswwwamazoncomwhereflyingcarstorrshalldp1953953182 target_blankthis new stripe press booka lets honest think usual blah blah blah heard thousand times 2011 kind treatment detailed nuanced original treatment times obsessively pending new physical technologies nuclear power nanotech came pass transform world havep pa relattachment wpatt82488 hrefhttpsmarginalrevolutioncomattachment_id82488img sizesmaxwidth 438px 100vw 438px srchttpmarginalrevolutioncomwpcontentuploads202112zflyingcarjpg alt width438 srcsethttpmarginalrevolutioncomwpcontentuploads202112zflyingcarjpg 1752w httpmarginalrevolutioncomwpcontentuploads202112zflyingcar205x300jpg 205w httpmarginalrevolutioncomwpcontentuploads202112zflyingcar701x1024jpg 701w httpmarginalrevolutioncomwpcontentuploads202112zflyingcar768x1122jpg 768w httpmarginalrevolutioncomwpcontentuploads202112zflyingcar1051x1536jpg 1051w httpmarginalrevolutioncomwpcontentuploads202112zflyingcar1402x2048jpg 1402w classwpimage82488 height640ap pdefinitely recommended worthy relnoopener hrefhttpsmarginalrevolutioncommarginalrevolution202111bestnonfictionbooksof2021html target_blankthe best nonfiction year lista relnoopener hrefhttpspressstripecomwhereismyflyingcar target_blankthe stripe press website bookap pthe post relnofollow hrefhttpmarginalrevolutioncommarginalrevolution202112whereismyflyingcaramemoiroffuturepasthtmlwhere flying cara appeared relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap |
61a94a1b2ac52792067f2c44 | How America Can Become a “Can Do” Country Again, with Philip Zelikow | pphilip zelikows eminent career has spanned academia and public service in a way that makes him a modernday counterpart to the wise men who created the postworld war ii global order he has served at all levels of american government from holding positions in the white house the state department and the pentagon to winning election to his towns school board he has taught for the navy worked as a career diplomat in the foreign service directed the 911 commission and served as a member of the presidents intelligence advisory board for both presidents bush and obama he has taught and directed research programs at harvards kennedy school of government and is now the white burkett miller professor of history at the university of virginia where he has also been dean of the graduate school of arts and sciences and directed the miller center of public affairsp
pzelikows engagement with both academia and public service has given him unique insights into the successes and failures of government in his most recent book emthe road less traveled the secret battle to end the great war 191617em he overturns a century of conventional historical thinking to show how us president woodrow wilson missed the opportunity to broker an early peace between the european combatants in world war i which zelikow judges to be the most consequential diplomatic failure in the history of the united states at the same time his scholarship on the policymaking successes that allowed the us and the allies to win world war ii has given him a highly critical view of the quality of current us policy engineeringp
pin this interview philip zelikow discusses his experiences in and out of government that inform his diagnosis of declining us state capacity he describes the leadership failures of woodrow wilson the strengths and limitations of the moderate perspective in politics and government and the essence of successful political problemsolving he explains the business and military cultures that contributed to the countrys successes during world war ii and over the following decades as well as the more recent deterioration in public service training and staff habits he talks about his current work as director of the covid commission planning group and suggests how americans can rebuild our national competency and regain our global image as the ultimate cando countryp
iframe srchttpsplayersimplecastcom1cf82f1aa1da4072a21a52afdfdf48eadarkfalse width100 height200pxiframe
h2transcripth2
pstrongphilip zelikowstrong politics is simply the matter of what do you do when you have to share power with other people it turns out when you get into it that just about anything important in american life involves sharing power with other people if you want to get anything done if you want to get anything done youve got to work with other people who have some stake or portion of the relevant powerp
pstronggeoff kabaservicestrong hello im geoff kabaservice for the niskanen center welcome to the vital center podcast where we try to sort through the problems of the muddled moderate majority of americans drawing upon history biography and current events im honored to be joined today by professor philip zelikow who is the white burkett miller professor of history at the university of virginia where he also has been dean of the graduate school of arts and sciences and director of the miller centerp
phe has served in multiple levels of government across five administrations his federal services included positions in the white house state department and the pentagon he also directed the 911 commission and the earlier privately organized carterford commission on federal election reform and other important commissions and committees he is the author of numerous books including most recently a book published just this spring a hrefhttpswwwamazoncomroadlesstraveledsecret19161917dp1541750950emthe road less traveled the secret battle to end the great war 19161917ema welcome philipp
pstrongphilip zelikowstrong thank you geoffp
pstronggeoff kabaservicestrong as i mentioned to you before theres really no way to cover your career as an author a historian an attorney a diplomat an administrator or in public service in any real depth in an hourlong interview but i would like to focus on aspects of your work that touch upon the niskanen centers emerging interests in addressing declining state capacity before we get to that however can you tell me something about your origins and what led you to pursue your particular pathp
pstrongphilip zelikowstrong sure i grew up in houston texas thats where im from did most of my schooling there finishing with a law degree i practiced trial and appellate law in texas and then disrupted what might have been a promising career as a litigator in criminal and civil rights stuff mostly to see if i could make a career in foreign affairs and i went back to graduate school went to the fletcher school did well there and started my career in foreign affairsp
pafter teaching for the navy for a year i joined the foreign service at the entry level and that turned into a very interesting career in the service that led me to the white house and then became abbreviated when i was offered a teaching position at harvard in 1991 which eventually led me to resign from the service at first i went to harvard on leave to see if because i liked the service and i wanted to see if that would work out it turned out that it did and so since then ive had kind of a mixed career largely in academic posts but alternating with periods of government and public servicep
pstronggeoff kabaservicestrong how would you describe yourself politically and it may not be in terms of republican versus democrat or liberal versus conservativep
pstrongphilip zelikowstrong yeah its hard i would describe myself as an independent i think in washington world im usually regarded as a republican because my most prominent service was in republican administrations but the only time ive really taken part on a partisan basis really actively in a political campaign was actually in 1992 when i did actively campaign for the reelection of george h w bush who as you may recall was not reelected was defeated by president clintonp
pbut in general i regard myself as a practical person with certain convictions about what one should try to achieve in america and the world but predominantly concerned with how to do it and then i have tended to align with parties that i thought or people who i thought were practical and competent and most likely to do constructive workp
pstronggeoff kabaservicestrong that description calls to mind one of the figures with whom i believe you worked early on in your foreign service career george shultzp
pstrongphilip zelikowstrong yes though i didnt really know shultz i did get to know him some later at the time i was a junior foreign service officer working for the secretary on the seventh floor but in staff jobs in the state departments 24hour crisis center and then in the department which is called the secretary of staff which staffs principals of the department and so i had a chance to see the way shultz and his team worked pretty well but i wasnt really part of the inner circle at allp
pi think a more powerful experience for me back then as a foreign service officer partly was a period of apprenticeship working for bob blackwill who was my first key boss as an ambassador at the arms control talks in vienna before i went back to the department and then i was quite impressed with jim baker and team during the bush 41 period even though at the time i was working at the white house for brent scowcroft and bob gates with whom i was also quite impressedp
pand so i think i was very fortunate early in my career in having a chance to closely observe and work on crucial issues where i was kind of at the center of things on the momentous issues of the day with as competent a group of practitioners as our government has ever deployedp
pstronggeoff kabaservicestrong you were detailed to join the national security agency during the george h w bushp
pstrongphilip zelikowstrong national security councilp
pstronggeoff kabaservicestrong national security council excuse me during the george h w bush administrationp
pstrongphilip zelikowstrong yeahp
pstronggeoff kabaservicestrong and you mentioned baker and scowcroftp
pstrongphilip zelikowstrong rightp
pstronggeoff kabaservicestrong and as i think about other positions youve heldp
pstrongphilip zelikowstrong incidentally just to interject geoff it was interesting and a comment on the times that even though i joined the nsc staff at the outset of the bush 41 administration no one in that group knew what political party i belonged to or even asked it simply was not even an issue that arosep
pstronggeoff kabaservicestrong well on that subject it seems that a lot of the people whom you worked with particularly on things like the 911 commission were moderate republicans and moderate democrats and im thinking about tom kean who was the chairman of that commission he was the former governor of new jersey slade gorton the former republican senator from washington john lehman the former secretary of the navy jim thompson the former governor of illinois and then on the democratic side of course lee hamilton who was the cochair and max cleland who just died yesterdayp
pstrongphilip zelikowstrong cleland left the commission right away and was replaced by bob kerrey the former senator from nebraskap
pstronggeoff kabaservicestrong thats right and to this list we might actually also add linwood holton the former republican governor of virginia who was very instrumentalp
pstrongphilip zelikowstrong kind of my boss at the miller center of virginia but was not involved with the 911 commission yeah youre right it is worth speculating commenting a little bit about what is meant by moderate and among people who style themselves as moderates theres an assumption that moderate is simply naturally a positive adjective and one need not to say more one is moderate in their temperaments which implies a certain balance thats true as opposed to immoderates on either side and then you can ask oneself well really is moderation always a virtue and for people who feel quite strongly they regard moderates as temporizers compromisers unprincipled i think it turns out that one gets labeled as a moderate if one does not have an automatic reflexive position and actually listens to views across the spectrum and on both sides that does not mean that you end up coming down with a position that is invariably in the middle of the spectrum but it does mean that your position is a little less automatic and predictablep
pand it does imply receptiveness to arguments and evidence from people with whom on other things you may disagree and its worth commenting geoff its an aspect of my background i was involved in intercollegiate debate and then i was a trial lawyer a really good trial lawyer can make the arguments on the other side just about as well as they can a really good trial lawyer actually knows all the strengths and weaknesses of their own case and also knows all the strengths and weaknesses of the other sides case see youre not a good trial lawyer if you dont fully understand the other sides case and can make their case and understand their evidence just about as well as they canp
pbut you see that habit of mind being of that clinical empathy kind of forces a certain openness combined with rigorous attention to the relevant factual detail that ends up putting people in positions where they take stances that others then may call moderate and its a handy shorthand but its so important actually to many things that the niskanen center does that its worth calling that out and noticing it and noticing whats more important is what produces the socalled moderation not simply automatic applause for ones balanced temperamentp
pstronggeoff kabaservicestrong i am somewhat guilty of that i must confess but in terms of the various moderate republicans and democrats weve been mentioning here were there in fact some common threads that connected them allp
pstrongphilip zelikowstrong well the best of them and the 911 commission for example was selected on extremely political grounds by the respective party leaders in congress in both houses though the partisan atmosphere was bad then but not as bad as it is now what did distinguish them is a lot of these people were relatively secure in their own skin and confident and capable about their ability to try to work on the practical aspects now here its really and practical aspects and how to do things is really the focus on that is an important feature of my whole career and whatever it is i bring to my scholarship and my work and so here its very important to just distinguish really between sort of two families of people who comment and work in public affairsp
pmost mass politics is cultural its not really about policy it pretends to be about policy but usually what people are looking for are policy positions that are cultural signifiers and that allows this is not im not being pejorative people tend to want to support people whom they think share their beliefs and therefore they trust those people more that means theyre looking for cultural affinity and to find cultural affinity they judge on these cultural poses but therefore to work on a mass scale in politics and by the way ive run for elective office and was elected to a local school board once upon a time so i mean ive done grassroots electoral politics and understand that side of the world a tiny bitp
pbut to come back to what happens then is quite a lot of what passes for political debate in the public sphere is a matter of choosing poses and positions and a lot of what people do then is they work very hard on constructing their talking points or their statement thats meant to strike the suitable pose and for a lot of people that is the beall and endall of politics choosing which pose to strike because youre choosing which cultural image you are going to project which affinities youre going to seekp
pthis should be distinguished from a family of people who try while balancing some of that if theyre in mass politics very hard actually to go about solving problems the world of problemsolving is really very different from the world of striking poses and im trying to be empathetic to the need to strike poses because thats an inevitable and necessary part of mass politics but if you actually want to work on problems and solve them you have to move into a different modep
pive often found actually that if you want to bring people together youre most likely to bring them together if you can bring them together around some practical problem that theyre joining in trying to solve whether its building a house or putting out a fire or figuring out whether or how to build a school after you get past sort of broad cultural identities and you really roll up your sleeves and get into the practical problems involved those tend to have some force and power of their own and people can rally around those and you can bring people togetherp
pso in some of these cases you mentioned about these people i worked with and were drawn to and slade gorton by the way the late slade gorton of washington state is a very good example of this and one of the best gorton by the way was regarded as quite conservative in many ways on the stump and he was but gorton had another side he was really a quite gifted person super smart and he juggled these different sides and he was also very deliberate purposeful and effective actually gorton commented somewhat scornfully bemusedly of another colleague that his colleague he said has never had an unexpressed thought gorton did have unexpressed thoughts but when it came to actually working problems he could be extremely effective and the work he did would then sometimes cross traditional party linesp
plet me give you a concrete illustration of what i mean you mentioned that i directed the carterford commission on federal election reform this commission which was after the florida debacle of the election of 2000 congress was so angry about that on both sides that they couldnt create a commission so it was created privately i was asked to direct it gorton was on the commission by the way carter and ford took an active role especially carterp
pin the course of this work it was gorton who suggested that the commission should recommend a new feature called provisional ballots and probably by this time almost everybody who knows anything about our election system has heard of provisional ballots back then no one did that was a brandnew innovation that had been pioneered in washington state gorton suggested this because there were all sorts of controversies over whether someone was registered in the right precinct or this or that and rather than get embroiled in all of that just take their vote and check it out later and if their vote could count you count it and then there are some ways to administer this gordon proposed that we should include provisional balloting in the commissions recommendation we did and it was adopted the last time actually we did meaningful national election reform which was a bill passed with bipartisan support in 2002 opposed by the extremes in both partiesp
pnow i call out this example because gorton had just lost his reelection campaign for the us senate in washington state in that same election of 2000 he had lost that election in part because of provisional ballots the provisional ballots had mainly gone against him thats why he had lost it but rather than being infuriated and frustrated by that example he still thought it was a goodgovernment innovation and one that we should recommendp
pstronggeoff kabaservicestrong interesting in your opinion maybe its just a hypothetical matter is it possible to have a highly ideological problemsolverp
pstrongphilip zelikowstrong of course it is from either side indeed a lot of the people who are most passionately drawn to trying to solve public problems draw that passion from some sort of set of powerful ideological convictions and you dont necessarily want to forfeit the passion in the process the challenge then is whether the ideological passion puts on blinders so that you just dont see some stubborn facts or cant deal with others it turns out in politics people tend to think of politics in negative terms its all politics and its usually a pejorative expressionp
preally look politics is simply the matter of what do you do when you have to share power with other people it turns out when you get into it that just about anything important in american life involves sharing power with other people if you want to get anything done if you want to get anything done youve got to work with other people who have some stake or portion of the relevant power so if you actually want to get things done in a situation where power is shared often shared in quite wide and complex ways well then youve got to actually listen and pay attention to a lot of other concerns and lots of facts and if your ideological passion disables you from being able to do that youre simply going to be less effective in getting things done except in the utopian vision in which you are the worlds dictator and you can just tell everybody what to do and by the way even in those cases its a little less likely that what you invent will lastp
pstronggeoff kabaservicestrong to return to the subject of moderation it is indeed a slippery term and i was reminded of this anew while reading your fantastic new book a hrefhttpswwwamazoncomroadlesstraveledsecret19161917dp1541750950emthe road less traveledema where president woodrow wilsons position prior to us entry into the great war was most often described as moderate that is to say he was intermediate between the interventionists and the noninterventionistsp
pand parenthetically i have to say that i found your book fascinating and i am at least as fascinated by the fact that with all of your responsibilities you somehow found time to produce and write a beautifully written and truly pathbreaking book on a subject of which historians had been almost entirely unaware namely the missed opportunity to broker a peace agreement to end world war ip
pstrongphilip zelikowstrong oh its a huge storyp
pstronggeoff kabaservicestrong in late 1916 or 1917 this sounds like this was actually a longgerminating subject for youp
pstrongphilip zelikowstrong it is i actually came on this in partnership with a historian who had himself written one of the foundational accounts of american entry into world war i the late ernest may in the 2000s not long before may died he and i were in involved in another project and we went back over this midwar period in world war i this is the period of the turning point of the war it turns out when you dig into it its a turning point of the war because the war was either going to widen or it was going to wind up and end in 191617 most people even most world war i scholars dont know this because they dont realize that the allied side was about to go bankrupt in the dollars that they needed to sustain the war effortp
pim not the only person who has discovered that point but it has not been fully absorbed by the bulk of scholars the war could not have continued so it either had to widen or actually probably come to an end a few key people in a number of capitals realized this and there was an intense peace process and the germans ended up declaring the uboat war because the peace process theyd been pursuing for five months they thought had failed although the chancellor actually had not given up on it right to the end and wilson botched it for reasons he himself never quite understood and then theres a fascinating british story which is a key to itp
pso may and i came across the emerging evidence about this story the problem was when may had first written on this in the 50s and actually for most scholars since then there had been some suggestive german evidence that some sort of peace moves had been underway but the standard britishamerican account after world war i had poohpoohed it said the germans were in bad faith it was all propaganda and it never had a chance anyway that account was false and a number of people involved knew it was falsep
pand that account was sustained because some evidence was actively concealed especially on the american side thats a more involved story and really all the relevant british evidence was publicly unavailable really until the 1970s at the earliest because the public records were secret and quite a lot of the key evidence was still in private hands like the diaries of some key figures and so on and the established accounts basically had a complete grip no one knew this narrative even existed because everyone had just kind of accepted the conclusion oh their peace process never had a chance and no one had understood these financial issues that i mentioned a minute agop
pall of that began to surface in the 70s and 80s but no one frankly put all the evidence together carefully from the british and american and german sources and may and i began to see this and start working on this may passed away in 2009 i kept chipping away at this then for the next 10 years first developing a really long paper which i started presenting at different places and then a bookp
pi want to call out because independently other scholars were beginning to notice some of this too im not the only one i think my book is the only one to put together the evidence from all the major archives on this and then analyze the diplomacy but i want to call out and give credit to dan larsen at cambridge whose book a hrefhttpswwwamazoncomplottingpeacepeacemakerscodebreakers19141917dp1108486681emplotting for peaceema is the outstanding treatment now of the british side which joins in revolutionizing our whole understanding of the british and allied position at this stage of the war including on these financial issues which larsen completely understands hes not the only one in britain actually the american historian john milton cooper started noticing some of this in the early 70s and kathleen burke did too then theres some terrific work thats been done on the german side and i call out for those who are interested the work of holger afflerbach which is the best on the midwar periodp
pbut the good news in a way is that it shows that and ive found this on a number of subjects people think a lot of these big historical questions are done and settled and the evidence is all in place and theres nothing new to add and on almost issue after issue ive looked at that is often not the case in the last 40 50 years we have significantly reinterpreted many of the major episodes on which the conventional wisdom still mostly lies undisturbed because people arent keeping track of the historical scholarshipp
pfor instance the whole history of the atomic bomb episode and the end of the war with japan really that that whole scholarship has been completely overhauled in the last 20 years and i think a lot of people are just not even aware of it i could go on and on the cuban missile crisis this world war i story actually the whole story of the origins of the american civil war and the secession crisis was completely redone and freshly understood in the 50s and 60s led by the work of david potterp
pill stop there but the larger point thats worth making is that on some really big stuff historical scholarship really does evolve and this world war i case which is a truly momentous case not just for the us but for the whole world its a world history story is an amazing story and i think its perhaps the most significant scholarly findings in my whole work my whole published work i think ive done some good work on other subjects but i think this may be the most significant of those findingsp
pstronggeoff kabaservicestrong you know grad students often think that every subject that could be covered has been covered which is why they try to go ever smaller in the hope of finding something that someone hasnt found but this missed chance for peace in 1916 and 17 is actually hugely momentous because we would live in an entirely different world if that effort had succeededp
pstrongphilip zelikowstrong right no bolshevik takeover in russia a revolution yes but i think every serious scholar would concede that if the war had ended theres no way the bolsheviks ever take over power and then theres no soviet union as we understand it i could go on and on theres just all sorts ofp
pstronggeoff kabaservicestrong the violent breakup of the habsburg empire or the downfall of the ottoman empire one could go on and on but again this is just one of the biggest subjects in history your verdict ultimately is harsh but fair you say that wilsons was the most consequential diplomatic failure in the history of the united states to what extent were his mistakes attributable to his qualities or rather maybe his missing qualitiesp
pstrongphilip zelikowstrong and you say that and youve quoted me correctly and you would think oh well he must just have this scathing polemical view of woodrow wilson but as you know having read the book in many ways wilson comes across in the book as a sympathetic character and i found him a very interesting figure because it would be easy if we could just cartoon him but in fact he was gifted in a number of ways and his broader strategic insight about the situation was profoundly right his sense of the importance of the moment right his sense of the broad approach of how this ought to come out right his sense of urgency about getting this done and americas role in it all correct he rather brilliantly orchestrated the move to effectively cut off american financing for the allies in november 1916 a move which by the way most historians still really dont quite notice or recognizep
pand he did this though it was only one plank in a whole series of things he put in motion entirely by himself by the way to try to get the mediation process going and then the story of how all this floundered and failed is part of the intricate story i try to retell in the book alongside the british and german stories so in many ways hes a sympathetic character and a deep point and one that relates in a way to your state capacity project is that its entirely possible to be realistic and even brilliant about diagnosing a problem yet be entirely incompetent in figuring out how to solve it and that in a way was wilsons problem and wilson through his own failings did not have a machinery to help him solve this problem did not even have the rudimentary machinery prior presidents like theodore roosevelt or william mckinley had used in the then still very rudimentary american setup he didnt even use that and he relied on this dilettantish private advisor edward house which turned out to be epically unfortunatep
pbut in a way it relates to the fact that wilsons broad position is fundamentally sound and in a way the great tragedy ensues from the incapacity to carry that position into practice to actually know how to do that although even though a lot of things from the germans and the british were all coming together to try to show him how to do it it just got flubbed in this particular way that i detail and thats one of the reasons i think the book is such a powerful lesson for today its a lesson about how much these practical skills of statecraft matter and by illustrating the incredibly tragic consequences of their neglect its a way of underscoring how much attention we need to focus on these practical skills rather than simply saying as long as someone more or less has the right position were goodp
pstronggeoff kabaservicestrong you do as i say draw out wilsons good qualities his extremely high intellect the fact that he was taking a moderate and pragmatic position prior to us entry into world war i which is inclined to strike someone like me as a good position to take but theres a number of factors that you also lay out that led to his failure as you say the absence of staff work which led to an absence of information his overreliance on edward house i by the way am one of the very few with you whos had the misfortune of having to get through a hrefhttpswwwamazoncomphilipdruadministratorstorytomorrowdp164594039xrefasc_df_164594039xtaghyprod20linkcodedf0hvadid475689874762hvposhvnetwghvrand9495811022519061243hvponehvptwohvqmthvdevchvdvcmdlhvlocinthvlocphy9011819hvtargidpla996365519697psc1emphilip dru administratoremap
pstrongphilip zelikowstrong you need to tell your audience what emphilip dru administratorem wasp
pstronggeoff kabaservicestrong oh dear yes colonel houses bizarre science fiction novel about a world dictatorp
pstrongphilip zelikowstrong published anonymously hardly anyone knew house had written itp
pstronggeoff kabaservicestrong thats truep
pstrongphilip zelikowstrong what on earth caused you to read that its a hard thing to readp
pstronggeoff kabaservicestrong yeah theres a yale connection to colonel house his papers ended up at yale because essentially his biographer and the editor of his diaries was charles seymour who then became president of yale and unfortunately seymour expurgated a lot of the more bizarre aspects of houses story which wouldve discredited him much earlier than he actually was discreditedp
pstrongphilip zelikowstrong yes and which turned out to be part of the reason that our knowledge of this whole episode was delayed for so long its seymours grip on the house papers which did not relinquish until seymours death in the early 60sp
pstronggeoff kabaservicestrong right and wilson massively overrelied on house who turned out to be a person of poor judgment until they actually broke during the 1919 peace negotiations after the warp
pstrongphilip zelikowstrong correctp
pstronggeoff kabaservicestrong but wilson also for example as you point out in the book failed to go to theodore roosevelt his predecessor to understand how roosevelt had brokered the 1905 armistice in the russojapanese warp
pstrongphilip zelikowstrong right which is unfortunate now understandable at one level because theodore roosevelt by that time was americas leading wilsonhater so theres no way he goes to roosevelt personally for any advice about anything but he might have then just puzzled over how did he do that and it wouldve been very easy for people to have given him some information on how this was done there were a number of people short of talking to roosevelt himself it would not have been hard to give wilson a 15minute reconstruction of how america mediated the end of the last great power war which would have inspired a lot of thoughts as to how wilson should proceed in mediating the end to this one but neither he nor anyone working in the us government bothered to do any of that work even though the precedent was known to everybody cited by many and had happened only 10 years earlier but no one checked if that serves as a little illustration of the problems of historical knowledge and institutional memory goodp
pstronggeoff kabaservicestrong yeah you in an echo of a donald rumsfeld saying point out that wilson didnt know what he didnt know and theres also an analogy you used that i liked which is that wilson was like a poker player who gets three kings in his hand and throws away one of those kings hoping to get something better thats great he just didnt know how to broker a peace conference ultimatelyp
pstrongphilip zelikowstrong yes thats right and the book actually at one point i pause and kind of map out for people who most of my readers dont know how to broker a peace conference eitherp
pstronggeoff kabaservicestrong truep
pstrongphilip zelikowstrong very few people having done things like that so actually at one point at a key point in the book i kind of stop and say okay folks heres how one would go about doing this it turns out if you know this you begin noticing a lot of things in the record because the british and germans understood this and a lot of things that theyre doing begin to make more sense to you as a scholar if you put them in that context and i kind of map it out like okay heres how you go about doing it step one you know and this was the professionals understood these things but wilson didnt have the benefit of any professional advice there were a couple he had a couple of very good younger diplomats in the american service and overseas one in particular in london named buckler and another very good one the young joseph grew in berlin but he didnt really use them to help with any of this and the people he had working for him in washington were either incompetent themselves or untrustworthyp
pstronggeoff kabaservicestrong the next world war world war ii was at the heart of another of your writings that ive been very taken with which is your emtexas national security reviewem article a hrefhttpstnsrorg201909toregainpolicycompetencethesoftwareofamericanpublicproblemsolvingto regain policy competence the software of american public problemsolvinga which came out in september of 2019 so moving from wilsons failures and the failure of the bureaucracy around him you wrote in the introduction of that article that the quality of us policy engineering is actually much much worse in recent decades than it was throughout much of the 20th century this is not a partisan observation the decline spans both republican and democratic administrations and you wrote that precovidp
pstrongphilip zelikowstrong yes thats right i am sorry to say that the covid crisis has been a vivid illustration of the arguments i made in that essay yesp
pstronggeoff kabaservicestrong so what were some of the things you had in mind from your vantage as a historian and public servant when you were thinking about the decline in the quality of us policy engineering at that pointp
pstrongphilip zelikowstrong oh well the wars in iraq and afghanistan of course and actually the recent stuff with afghanistan is yet a further illustration but a lot of other things too and id had opportunities from different perspectives including economic some economic stuff because i work on a lot of domestic subjects as well as the foreign stuff and so ive had unusual opportunities to see a lot of contemporary staff work and also to see staff work in the archives over time over more than a hundred years and its really fascinating for those who can do that to compare and contrast the quality of the written staff work say in the 40s and 50s to the quality of the written staff work that i personally read in recent years on some of these subjectsp
pand that article you mentioned was really animated by two things first is just a historical puzzle i think its generally believed now with too much cause that our organs of government are relatively incompetent at executing stuff and that resources are inefficiently used and were bogged down by procedures and were not very competent at implementing and doing things there are admirable exceptions but i think thats a general view it animates what the niskanen center is doing in its planned state capacity project contrast that image which is widely held and even held outside of the united states now with the image the united states had of itself and the world had of us after world war ii we were the cando countryp
pthe whole world i mean kind of like its a typical image americans land on an island and two days later they have a functioning airstrip they can build atomic bombs they can launch marshall plans they are unencumbered by ideology practical ingenious doers we were the quintessential cando country regarded and admired throughout the world for our pragmatic ability how did we get from that america mid20th century to the reputation and performance of today thats a very interesting questionp
pstronggeoff kabaservicestrong it is indeedp
pstrongphilip zelikowstrong and then the second part of that which i have as an educator is does academia have anything to do with this is it that we taught stuff really well back then and we dont teach that stuff now i think the quality of our education for public problemsolving now is mediocre to worse i know that from having been involved in some of the key institutions that did this and in the core of some of those institutions so its a firsthand observation and ive been struggling over how to improve this for some timep
pand then i wanted to look back so did they just have way way better training and teaching back then and so then that led me into trying to understand the historical question in order to then bring that into okay how do we fix the way we teach people and train people today and part of the answer to the historical question was that the skills that we had in mid20supthsup century did not come from academia and therefore they never migrated back to academiap
pwhere then did they come from one might say they came i believe from very strong cultures organizational cultures that had two large streams running into them one was a strong set of cultures in the business world the american business world of the first half of the 20th century this is a culture dominated by engineers and tinkerers of every kind and it was a culture dominated by the staff cultures of the engineering world which actually had a lot of positive attributes about problemsolving the way you wrote directions the precision of guidance careful reporting of what you were doing emphasis on all sorts of written staff work that had developed over a period of a couple of generations and was really at its peak in mid20th century america and the top leaders in the corporate world were the exemplars of this engineeringscientific ethosp
pmeanwhile on the military side in the war department there was a very strong culture that venerated highquality written staff work it had german origins in the 19th century then parroted and mimicked especially by the british which became paragons at it and then we had had a lot of exposure to british practices especially in the war and admired and tried to emulate them in many ways the highquality british staff work these streams all kind of came together plus we had a ton of trialanderror in the new deal periodp
pand people back then were very ruthless about firing people who screwed up and made mistakes and there were lots of screwups and lots of mistakes and in this winnowing process the people who were competent performers tended to get promoted and then they tended to promote these kinds of staffing habits george marshall dwight eisenhower were exemplars of these traditions but there were many many others and you can just see all sorts of evidence of this culture even in the official histories done of the second world war and their qualitiesp
pyou contrast that then 50 years later because these qualities did not migrate back into academia academia pursued other fashions of how to train people for public service that didnt really exemplify these qualities and these qualities essentially were lost they began getting just passed down through oral traditions and apprenticeship and effectively by the end of the 20th century the quality of training and staff habits in the american government had really kind of fallen apart to the point that lots of staff work simply consisted of whats our position what are our talking points and then telling people what we wantp
pand then youd have the quality of formal training is just terrible there are a few exceptions to this but generally just terrible i mean someone would go to work on the nsc staff with literally no training for that job at all i mean none not one day in how to do policy development and how to do systematic policy analysis no training there are some people in the military who would sometimes realize this and be aghastp
pnow there are brilliant improvisers and people who had learned through apprenticeships or on the job and that sometimes worked but increasingly when the quality of written staff work goes down what happens is that people tend to substitute more and more meetings and higher and higherlevel meetings because they cant get stuff done and then they talk more and more and then have to keep bumping it to higher levels which then puts more stress and pressure on the people at the apex of the pyramid and the things become more and more dysfunctional the agencies turn into functionaries instead of people with real delegated authorities and were now at a kind of a trough of this vicious spiral downward over a long period of timep
pthis is why actually im just so impressed and gratified that the niskanen center is taking on problem in a much broader context because im not the only person to notice facets of this a lot of other people have noticed different facets of it my perspective perhaps is a little more of the insider others kind of more political sciencey have noticed the external facets the symptoms of this frank fukiyama is a good example and im so grateful that people are going to try to spotlight this and work on itp
pstronggeoff kabaservicestrong well thank you i was struck by a number of things both in what you just said and also in your article one of which is that the allies won the war in part because we had better policymaking abilities than the germans and the japanesep
pstrongphilip zelikowstrong incidentally for those who dont follow world war ii literature who are interested in world war ii literature but dont follow it very closely theres a really important recent book on this and i didnt write it so i can phillips payson obrien has written a book on a hrefhttpswwwamazoncomgpproductb00vaovm2arefdbs_a_def_rwt_hsch_vapi_tkin_p1_i1emhow the war was wonema hes also written a biography of leahy which has some strengths but this emhow the war was wonem book is an idiosyncratic book but in that book is some very powerful stuff about the significance of the production work and the quality of the production work and the staff work especially on the air and sea power sides its one of the more important books written on the war in the last 20 yearsp
pstronggeoff kabaservicestrong i agree and one of the lessons from that book if im remembering correctly is that most of the united states military innovations were actually the product of multiple iterations none of them were firstgenerationp
pstrongphilip zelikowstrong right paul kennedy makes that point too in a recent book he did called a hrefhttpswwwamazoncomengineersvictoryproblemsolversturnedebookdpb004j4wnmgrefsr_1_1keywordspaulkennedyengineersofvictoryqid1638330935sdigitaltextsr11emengineers of victoryemaem emthat is excellent and that makes some of these same points from a different anglep
pstronggeoff kabaservicestrong there was also a certain humility to american policymakers in those days in that they were willing to borrow from the britishp
pstrongphilip zelikowstrong oh yes the famous p51 mustang and kennedy tells the story very well the p51 was a failed aircraft design until some brilliant brits and a british test pilot said lets try this airframe with the rollsroyce merlin engine this british aircraft engine which turned out to be a match made in heaven and then the p51 becomes this very important aircraft that changes the tide at the strategic bombing campaign over europe in 44 but thats a story of this angloamerican marriage again its a terrific storyp
pstronggeoff kabaservicestrong and of course the british had experience in staffing an empirep
pstrongphilip zelikowstrong yepp
pstronggeoff kabaservicestrong which we did not havep
pstrongphilip zelikowstrong yes and the origins of their good staff system and maurice hankey is a huge figure in the story in the 1910s and 1920s starts with their committee of imperial defence and those staffing practices moved into the war cabinet system they developed during world war ip
pstronggeoff kabaservicestrong when you talk about business contribution to the us war effort i think people are more likely to think of donald trump than they are to think of the dollarayear men but really what youre getting at is a kind of practical problemsolving approach and decentralized decisionmaking that characterized this engineering culturep
pstrongphilip zelikowstrong yes and actually one of the tragedies in the united states is the change in the business culture now theres some very good stuff thats been written on this and not by me but its commented that the american business culture itself began going through a profound change there are some very good books on this that begins picking up speed in the late 50s and into the 60s but then really gets going the fundamental shift from operations and production to basically financial engineering and the whole change in the culture of what was taught in business schools the change in the culture of what was prized in higherlevel executives and this change therefore in the overall culture of american businesses where businesses less and less emphasized the culture of doing stuff and building things we would then outsource the building of things to others and of course the chinesep
pit turns out though and others have pointed this out really well that when you outsource building things to others you outsource a lot of other stuff too with it and those american companies that are still in the business of making stuff a good example of this would be corning which outsources quite a lot of its fabrication but keeps quite a lot of it in the united states because they need that knowhow and they need to keep that knowhow in the company but the general fashion in a lot of american business was that you didnt need to know how all you needed to do was know how to manipulate the results of thatp
pstronggeoff kabaservicestrong i helped amo houghton write his autobiography he was thep
pstrongphilip zelikowstrong whop
pstronggeoff kabaservicestrong amo houghton was the longtime ceo of corning so i have some experiencep
pstrongphilip zelikowstrong so you may have heard these complaints beforep
pstronggeoff kabaservicestrong i have heard these complaints before shall we say you point out that one of the last gasps of this government culture of meticulous written staff work and efforts to go back and find the sources of problems was the pentagon papersp
pstrongphilip zelikowstrong yes ironically the culture that produces the pentagon papers is a very reflective professional culture the notion that mcnamara would commission a project to study the history of how we got into the war in vietnam was not a shocking controversial idea when mcnamara came up with it people thought that that was the kind of thing that you did back then if youll notice there were multiple studies of the bay of pigs catastrophe that were done internally john f kennedy asked dick neustadt to study one of his failures there was a culture in the us government of rigorous study of what went right and what went wrong at a highly professional level and the quality of the pentagon papers is in a way a symptom of what then was already beginning to be a dying culturep
pstronggeoff kabaservicestrong yeah if there is an effort underway to try to honestly and searchingly figure out what went wrong with our exit from afghanistan or our whole enterprise in afghanistan im not aware of itp
pstrongphilip zelikowstrong right there is currently tammy duckworth and others are proposing an afghanistan commission that theyre trying to get into the national defense authorization act right at this minutep
pstronggeoff kabaservicestrong but such a commission will actually run up against the demise of this kind of highquality written staff work partly because the pentagon papers cast a significant echo and people now are into cya mode they dont want to actually write down what happens in meetingsp
pstrongphilip zelikowstrong right and so then however what the commission might do is administer a really hard dopeslap that calls out the fact that when you quit doing serious written work and begin making policy by bloviating you get catastrophic results which might might contribute to people trying to do things differentlyp
pstronggeoff kabaservicestrong you and i actually met for the first time at the kennedy school at harvard back in the 90s ernest may was my advisor and i cant help but feel reading your emtexas national security reviewem article that theres actually a problem in harvards shift from the littauer school of public administration to the kennedy school of governmentp
pstrongphilip zelikowstrong well actually i have been close friends to the founders of kennedy school and i taught in the core curriculum of the kennedy school for a time which is probably the time in which we came across each other and so i was very well acquainted with a lot of the complaints and sadness of the people who had helped found the kennedy school about what the school had become i have some sympathy with what some of the schools strengths are but im very well aware of the disappointment many of those cofounders feel about what the school became because they effectively felt the school had been hijacked by a particular academic orthodoxy that ended up not being very helpful in training people for public problemsolvingp
pi get into this in the article and its basically a set of approaches to policy analytics that are drawn out of microeconomics by the way they are quite powerful tools for certain kinds of policy analysis but not for general policy development and the article gets into this a little bit more but youre quite right already by the 90s i was part of a movement even in the harvard kennedy school and which a number of other professors joined to try to change the core curriculum that movement failed it was a very close vote but it failed and i left the school and came to virginia shortly thereafter not for that reason for other reasons it was one opportunity but the opportunity is not yet lostp
pi think there are possibilities here and there to try to generate a movement to revamp the way we train people in public problemsolving in america we should use these failures afghanistan the pandemic crisis as a prompt to change our training we have to understand why we have the training we have that it comes out of these odd historical circumstances and then try to adopt different kinds of training and let this be part of a lot of general ferment and unease about the stultification of american higher education and american professional education but i think nothing is more important than this effort to rebuild our competency as a country nothing is more important than that causep
pstronggeoff kabaservicestrong i agree and this business of declining state capacity tends to put one in a pessimistic frame of mindp
pstrongphilip zelikowstrong it doesp
pstronggeoff kabaservicestrong and also to consider the related although not completely similar subject of american national decline but you ultimately end that emtexas national security reviewem on an optimistic notep
pstrongphilip zelikowstrong i dop
pstronggeoff kabaservicestrong you write in your last sentences americans can reflect on a proud heritage not far in the past when americans were notorious around the world for their practical cando skills in everything from fixing cars to tackling apparently insurmountable problems public as well as private these seemingly bygone skills were not in their genes or in the air they may not be consigned to wistful nostalgia the skills were specific they were cultural and they are teachablep
pstrongphilip zelikowstrong exactly and they can be taught again and i think there are a lot of things there are a lot of promising things in the society that are headed in this direction theres enormous interest all over the country actually in relearning how to build and make things in the liberating environment that the digital revolution is creating in many waysp
pactually the wide admiration for people like elon musk partly has some of this in it hes admired for being eccentric but hes also admired because hes an innovator who makes cool stuff and america in a way theyre gravitating to him as if he were the henry ford or the tom edison of the 21st century and its just noteworthy noting the cultural moment the supply chain problems and a lot of different problems are actually potentially opportunities to rethink a lot of the sinews of our economy and our culturep
pand as i say weve done this before a lot of the innovations we made in the progressive era and other people have called attention to this in the early 20th century came out of a period of terrible neglect terrible civil strife in the country huge social tensions and a sense that a lot of people were very pessimistic about the country but they responded to that and we have a chance to do that now its interesting what you can do too is go around the country and look for things that work by the way jim and deb fallows have done a little bit of this in their work and getting in their plane and hopping aroundp
pstronggeoff kabaservicestrong i really like their book a hrefhttpswwwamazoncomourtowns000milejourneyamericadp0525432442refasc_df_0525432442taghyprod20linkcodedf0hvadid316966985685hvposhvnetwghvrand17401824935805128077hvponehvptwohvqmthvdevchvdvcmdlhvlocinthvlocphy9011819hvtargidpla539761343999psc1emour townsemap
pstrongphilip zelikowstrong right their book emour townsem which is the hbo series and this project theyve got and what they did is find out you know what there are americans all over the country who are actually doing a lot of really neat stuff and are very ingenious and have all this native talent and mostly the national discourse doesnt notice them and so they want to try to call those people out and quite rightly so you can be sad and pessimistic about a lot of things but if you want to find reasons for optimism its not that hard to findp
pstronggeoff kabaservicestrong as promised you have way too much going on and that you have done to talk about in an hour but before we leave can you just tell me something about the covid commission planning group of which you are the director right nowp
pstrongphilip zelikowstrong sure about a year ago a group of funders led by eric schmidt thought it was obvious that coming out of this gigantic covid crisis which may be the most impactful crisis since 1945 in many ways surely there would be a national commission that would do a major investigation of just what did happen and why so that we could learn a lot of lessons from that it was obvious to them we would do that because it would be such a largescale investigation they thought they could help by getting the work done right away to start planning it and they recruited and hired me to lead a group to do that planning i then quickly gathered around me dozens of subject matter experts and others to help we have a website on this a hrefhttpswwwcovidcpgorgcovidcpgorga that stands for covid commission planning grouporg covidcpgorgp
pand for the better part of a year now weve been kind of planning how one would do a largescale commission of this kind organized around in our view four principal task forces and recruiting people to help lead those task forces and identifying what the issues would be and drafting launch work plans but right now there is no such commission congress is currently considering legislation that might create one the legislation has pros and cons which would be another subject to get into but if congress doesnt do it probably the only alternative is for a group of private philanthropies to band together to create an independent commission but then seek the help theyll need to get access to people and so forth from the biden white house and maybe some help from members of congress of both partiesp
pstronggeoff kabaservicestrong you a hrefhttpswwwwashingtonpostcomwashingtonpostlive20210902coronavirusfindinganswerswithphilipdzelikowtolda karen tumulty of the emwashington postem recently that tackling an understanding of this crisis is actually a harder problem than the 911 commission was why is thatp
pstrongphilip zelikowstrong 911 was hard the covid crisis harder the 911 crisis primarily involved the federal government so it was pretty washingtonfocused there was some attention to the foreign terrorist organizations and there were some of the first responder stuff in new york cityp
pthe scale and scope of this crisis is much larger youve really got to understand nationwide crisis management involving people all over america youve got an international picture having to do with the causes of the pandemic how you prevent pandemics how we get early warning thats very international youve got a challenge of medical countermeasures and how to harness the bio revolution that is also both national but also very international so intellectually from an investigative point of view in terms of the number of subject matter areas on which you need to have some competence its a sprawling problemp
pand then you have to ask yourself on which of all these things could a commission actually add value look if other people and the natural processes are going to do certain work well then just let them do that you dont need a commission to recapitulate what other people will do just fine and we do ask ourselves on what questions do we think a commission can really add insight by assembling a lot of horsepower and maybe some access to people or records and we think weve got a plan for how to proceed and now were waiting to see if the united states will create a suitable commissionp
pthe british have already announced theyre going to launch their public inquiry early next year and name its head before christmas others like sweden and so forth or brazil are already launching their inquiries but weve been reluctant to stand one up on our end and part of that is for some of the same cultural reasons that wed been discussing earlier in this podcastp
pstronggeoff kabaservicestrong yes youd mentioned earlier that the 911 commission was partisan certainly in terms of who served on it and the discussion around it but in comparison to todays polarization that seems like a veritable era of good feelings and we are talking also after congress refused to allow a commission to be created to look into the january 6th capitol invasionp
pstrongphilip zelikowstrong yes thats rightp
pstronggeoff kabaservicestrong so to what extent is this polarization impeding our ability to do the kind of work you have in mindp
pstrongphilip zelikowstrong oh its impeding it quite a lot were pretty familiar with views on capitol hill about this i mean thats why the commission hasnt been created yet as many republicans think the democrats just want to create such a commission so that they can pin the blame of the crisis on trump and make this all about another antitrump thing for their reasons they dont want to go along with thatp
pon the republican side they have a blame narrative that is focused on china or as rand paul might say some of chinas fellow travelers so youve got these blame narratives on both sides youve got culture war narratives on both sides lets say one side says we follow science one side says we protect americans liberties and livelihoods youve got all that and in this very polarized environment and a lot of mutual suspicion and the experience with the january 6th commission just as you saidp
pit is interesting though right now there is a possibility congress might create a commission there is a bill thats just been proposed and the basic bipartisan deal there is republicans insist on a commission to get to the bottom of the origins issues as best anyone can and democrats insist in turn that any commission needs to have a broad scope to examine a lot of facets of the crisis and that might be a basis for bipartisan agreement but because of the polarized environment im not sure itll get therep
pthen if that fails were left with whether or not philanthropies choose to try to create an independent commission and there the position of the biden white house and whether it will facilitate that will be instrumental the biden white house so far has been preoccupied and noncommittal they need to decide whether or not they want to remain in that stancep
pstronggeoff kabaservicestrong professor philip zelikow i wish you all the luck in the world with this enterprise congratulations on your wonderful new book and thank you for joining me here todayp
pstrongphilip zelikowstrong thank you geoff this has been delightfulp
pstronggeoff kabaservicestrong it really has and thank you all for listening to the vital center podcast please subscribe and rate us on your preferred podcasting platform and if you have any questions comments or other responses please include them along with your rating or send us an email at contactniskanencenterorg thanks as always to our technical director kristie eshelman our sound engineer ray ingegneri and the niskanen center in washington dcp
pphoto credit a hrefhttpswwwistockphotocomphotousaflagamericanflagamericanflagblowinginthewindgm923981666253601127istockap
pthe post a relnofollow hrefhttpswwwniskanencenterorghowamericacanbecomeacandocountryagainwithphilipzelikowhow america can become a can do country again with philip zelikowa appeared first on a relnofollow hrefhttpswwwniskanencenterorgniskanen centerap | pphilip zelikows eminent career spanned academia public service way makes modernday counterpart wise men created postworld war ii global order served levels american government holding positions white house state department pentagon winning election towns school board taught navy worked career diplomat foreign service directed 911 commission served member presidents intelligence advisory board presidents bush obama taught directed research programs harvards kennedy school government white burkett miller professor history university virginia dean graduate school arts sciences directed miller center public affairsp pzelikows engagement academia public service given unique insights successes failures government recent bookemthe road traveled secret battle end great war 191617em overturns century conventional historical thinking president woodrow wilson missed opportunity broker early peace european combatants world war zelikow judges consequential diplomatic failure history united states time scholarship policymaking successes allowed allies win world war ii given highly critical view quality current policy engineeringp pin interview philip zelikow discusses experiences government inform diagnosis declining state capacity describes leadership failures woodrow wilson strengths limitations moderate perspective politics government essence successful political problemsolving explains business military cultures contributed countrys successes world war ii following decades recent deterioration public service training staff habits talks current work director covid commission planning group suggests americans rebuild national competency regain global image ultimate cando countryp iframe srchttpsplayersimplecastcom1cf82f1aa1da4072a21a52afdfdf48eadarkfalse width100 height200pxiframe h2transcripth2 pstrongphilip zelikowstrong politics simply matter share power people turns important american life involves sharing power people want want youve got work people stake portion relevant powerp pstronggeoff kabaservicestrong hello im geoff kabaservice niskanen center welcome vital center podcast try sort problems muddled moderate majority americans drawing history biography current events im honored joined today professor philip zelikow white burkett miller professor history university virginia dean graduate school arts sciences director miller centerp phe served multiple levels government administrations federal services included positions white house state department pentagon directed 911 commission earlier privately organized carterford commission federal election reform important commissions committees author numerous books including recently book published spring hrefhttpswwwamazoncomroadlesstraveledsecret19161917dp1541750950emthe road traveled secret battle end great war 19161917ema welcome philipp pstrongphilip zelikowstrong thank geoffp pstronggeoff kabaservicestrong mentioned theres way cover career author historian attorney diplomat administrator public service real depth hourlong interview like focus aspects work touch niskanen centers emerging interests addressing declining state capacity tell origins led pursue particular pathp pstrongphilip zelikowstrong sure grew houston texas thats im schooling finishing law degree practiced trial appellate law texas disrupted promising career litigator criminal civil rights stuff career foreign affairs went graduate school went fletcher school started career foreign affairsp pafter teaching navy year joined foreign service entry level turned interesting career service led white house abbreviated offered teaching position harvard 1991 eventually led resign service went harvard leave liked service wanted work turned ive kind mixed career largely academic posts alternating periods government public servicep pstronggeoff kabaservicestrong describe politically terms republican versus democrat liberal versus conservativep pstrongphilip zelikowstrong yeah hard describe independent think washington world im usually regarded republican prominent service republican administrations time ive taken partisan basisreally actively political campaign actually 1992 actively campaign reelection george h w bush recall reelected defeated president clintonp pbut general regard practical person certain convictions try achieve america world predominantly concerned tended align parties thought people thought practical competent likely constructive workp pstronggeoff kabaservicestrong description calls mind figures believe worked early foreign service career george shultzp pstrongphilip zelikowstrong yes didnt know shultz know later time junior foreign service officer working secretary seventh floor staff jobs state departments 24hour crisis center department called secretary staff staffs principals department chance way shultz team worked pretty wasnt inner circle allp pi think powerful experience foreign service officer partly period apprenticeship working bob blackwill key boss ambassador arms control talks vienna went department impressed jim baker team bush 41 period time working white house brent scowcroft bob gates impressedp pand think fortunate early career having chance closely observe work crucial issues kind center things momentous issues day competent group practitioners government deployedp pstronggeoff kabaservicestrong detailed join national security agency george h w bushp pstrongphilip zelikowstrong national security councilp pstronggeoff kabaservicestrong national security council excuse george h w bush administrationp pstrongphilip zelikowstrong yeahp pstronggeoff kabaservicestrong mentioned baker scowcroftp pstrongphilip zelikowstrong rightp pstronggeoff kabaservicestrong think positions youve heldp pstrongphilip zelikowstrong incidentally interject geoff interesting comment times joined nsc staff outset bush 41 administration group knew political party belonged asked simply issue arosep pstronggeoff kabaservicestrong subject lot people worked particularly things like 911 commission moderate republicans moderate democrats im thinking tom kean chairman commission governor new jersey slade gorton republican senator washington john lehman secretary navy jim thompson governor illinois democratic course lee hamilton cochair max cleland died yesterdayp pstrongphilip zelikowstrong cleland left commission right away replaced bob kerrey senator nebraskap pstronggeoff kabaservicestrong thats right list actually add linwood holton republican governor virginia instrumentalp pstrongphilip zelikowstrong kind boss miller center virginia involved 911 commission yeah youre right worth speculating commenting little bit meant moderate people style moderates theres assumption moderate simply naturally positive adjective need moderate temperaments implies certain balance thats true opposed immoderates ask oneself moderation virtue people feel strongly regard moderates temporizers compromisers unprincipled think turns gets labeled moderate automatic reflexive position actually listens views spectrum sides mean end coming position invariably middle spectrum mean position little automatic predictablep pand imply receptiveness arguments evidence people things disagree worth commenting geoff aspect background involved intercollegiate debate trial lawyer good trial lawyer arguments good trial lawyer actually knows strengths weaknesses case knows strengths weaknesses sides case youre good trial lawyer dont fully understand sides case case understand evidence canp pbut habit mind clinical empathy kind forces certain openness combined rigorous attention relevant factual detail ends putting people positions stances moderate handy shorthand important actually things niskanen center worth calling noticing noticing whats important produces socalled moderationnot simply automatic applause ones balanced temperamentp pstronggeoff kabaservicestrong somewhat guilty confess terms moderate republicans democrats weve mentioning fact common threads connected allp pstrongphilip zelikowstrong best 911 commission example selected extremely political grounds respective party leaders congress houses partisan atmosphere bad bad distinguish lot people relatively secure skin confident capable ability try work practical aspects practical aspects things focus important feature career bring scholarship work important distinguish sort families people comment work public affairsp pmost mass politics cultural policy pretends policy usually people looking policy positions cultural signifiers allows im pejorative people tend want support people think share beliefs trust people means theyre looking cultural affinity find cultural affinity judge cultural poses work mass scale politics way ive run elective office elected local school board time mean ive grassroots electoral politics understand world tiny bitp pbut come happens lot passes political debate public sphere matter choosing poses positions lot people work hard constructing talking points statement thats meant strike suitable pose lot people beall endall politics choosing pose strike youre choosing cultural image going project affinities youre going seekp pthis distinguished family people try balancing theyre mass politics hard actually solving problems world problemsolving different world striking poses im trying empathetic need strike poses thats inevitable necessary mass politics actually want work problems solve different modep pive found actually want bring people youre likely bring bring practical problem theyre joining trying solve building house putting fire figuring build school past sort broad cultural identities roll sleeves practical problems involved tend force power people rally bring people togetherp pso cases mentioned people worked drawn slade gorton way late slade gorton washington state good example best gorton way regarded conservative ways stump gorton gifted person super smart juggled different sides deliberate purposeful effective actually gorton commented somewhat scornfully bemusedly colleague colleague said unexpressed thought gorton unexpressed thoughts came actually working problems extremely effective work cross traditional party linesp plet concrete illustration mean mentioned directed carterford commission federal election reform commission florida debacle election 2000 congress angry sides couldnt create commission created privately asked direct gorton commission way carter ford took active role especially carterp pin course work gorton suggested commission recommend new feature called provisional ballots probably time everybody knows election system heard provisional ballots brandnew innovation pioneered washington state gorton suggested sorts controversies registered right precinct embroiled vote andcheck later vote count count ways administer gordon proposed include provisional balloting commissions recommendation adopted time actually meaningful national election reform bill passed bipartisan support 2002 opposed extremes partiesp pnow example gorton lost reelection campaign senate washington state election 2000 lost election provisional ballots provisional ballots mainly gone thats lost infuriated frustrated example thought goodgovernment innovation recommendp pstronggeoff kabaservicestrong interesting opinion maybe hypothetical matter possible highly ideological problemsolverp pstrongphilip zelikowstrong course lot people passionately drawn trying solve public problems draw passion sort set powerful ideological convictions dont necessarily want forfeit passion process challenge ideological passion puts blinders dont stubborn facts cant deal turns politics people tend think politics negative terms politics usually pejorative expressionp preally look politics simply matter share power people turns important american life involves sharing power people want want youve got work people stake portion relevant power actually want things situation power shared shared wide complex ways youve got actually listen pay attention lot concerns lots facts ideological passion disables able youre simply going effective getting things utopian vision worlds dictator tell everybody way cases little likely invent lastp pstronggeoff kabaservicestrong return subject moderation slippery term reminded anew reading fantastic new book hrefhttpswwwamazoncomroadlesstraveledsecret19161917dp1541750950emthe road traveledema president woodrow wilsons position prior entry great war described moderate intermediate interventionists noninterventionistsp pand parenthetically found book fascinating fascinated fact responsibilities found time produce write beautifully written truly pathbreaking book subject historians entirely unaware missed opportunity broker peace agreement end world war ip pstrongphilip zelikowstrong oh huge storyp pstronggeoff kabaservicestrong late 1916 1917 sounds like actually longgerminating subject youp pstrongphilip zelikowstrong actually came partnership historian written foundational accounts american entry world war late ernest 2000s long died involved project went midwar period world war period turning point war turns dig turning point war war going widen going wind end 191617 people world war scholars dont know dont realize allied bankrupt dollars needed sustain war effortp pim person discovered point fully absorbed bulk scholars war continued widen actually probably come end key people number capitals realized intense peace process germans ended declaring uboat war peace process theyd pursuing months thought failed chancellor actually given right end wilson botched reasons understood theres fascinating british story key itp pso came emerging evidence story problem written 50s actually scholars suggestive german evidence sort peace moves underway standard britishamerican account world war poohpoohed said germans bad faith propaganda chance account false number people involved knew falsep pand account sustained evidence actively concealed especially american thats involved story relevant british evidence publicly unavailable 1970s earliest public records secret lot key evidence private hands like diaries key figures established accounts basically complete grip knew narrative existed kind accepted conclusion oh peace process chance understood financial issues mentioned minute agop pall began surface 70s 80s frankly evidence carefully british american german sources began start working passed away 2009 kept chipping away 10 years developing long paper started presenting different places bookp pi want independently scholars beginning notice im think book evidence major archives analyze diplomacy want credit dan larsen cambridge book hrefhttpswwwamazoncomplottingpeacepeacemakerscodebreakers19141917dp1108486681emplotting peaceema outstanding treatment british joins revolutionizing understanding british allied position stage war including financial issues larsen completely understands hes britain actually american historian john milton cooper started noticing early 70s kathleen burke theres terrific work thats german interested work holger afflerbach best midwar periodp pbut good news way shows ive found number subjects people think lot big historical questions settled evidence place theres new add issue issue ive looked case 40 50 years significantly reinterpreted major episodes conventional wisdom lies undisturbed people arent keeping track historical scholarshipp pfor instance history atomic bomb episode end war japan scholarship completely overhauled 20 years think lot people aware cuban missile crisis world war story actually story origins american civil war secession crisis completely redone freshly understood 50s 60s led work david potterp pill stop larger point thats worth making big stuff historical scholarship evolve world war case truly momentous case world world history story amazing story think significant scholarly findings work published work think ive good work subjects think significant findingsp pstronggeoff kabaservicestrong know grad students think subject covered covered try smaller hope finding hasnt found missed chance peace 1916 17 actually hugely momentous live entirely different world effort succeededp pstrongphilip zelikowstrong right bolshevik takeover russia revolution yes think scholar concede war ended theres way bolsheviks power theres soviet union understand theres sorts ofp pstronggeoff kabaservicestrong violent breakup habsburg empire downfall ottoman empire biggest subjects history verdict ultimately harsh fair wilsons consequential diplomatic failure history united states extent mistakes attributable qualities maybe missing qualitiesp pstrongphilip zelikowstrong youve quoted correctly think oh scathing polemical view woodrow wilson know having read book ways wilson comes book sympathetic character found interesting figure easy cartoon fact gifted number ways broader strategic insight situation profoundly right sense importance moment right sense broad approach ought come right sense urgency getting americas role correct brilliantly orchestrated effectively cut american financing allies november 1916 way historians dont notice recognizep pand plank series things motion entirely way try mediation process going story floundered failed intricate story try retell book alongside british german stories ways hes sympathetic character deep point relates way state capacity project entirely possible realistic brilliant diagnosing problem entirely incompetent figuring solve way wilsons problem wilson failings machinery help solve problem rudimentary machinery prior presidents like theodore roosevelt william mckinley rudimentary american setup didnt use relied dilettantish private advisor edward house turned epically unfortunatep pbut way relates fact wilsons broad position fundamentally sound way great tragedy ensues incapacity carry position practice actually know lot things germans british coming try got flubbed particular way detail thats reasons think book powerful lesson today lesson practical skills statecraft matter illustrating incredibly tragic consequences neglect way underscoring attention need focus practical skills simply saying long right position goodp pstronggeoff kabaservicestrong draw wilsons good qualities extremely high intellect fact taking moderate pragmatic position prior entry world war inclined strike like good position theres number factors lay led failure absence staff work led absence information overreliance edward house way whos misfortune having hrefhttpswwwamazoncomphilipdruadministratorstorytomorrowdp164594039xrefasc_df_164594039xtaghyprod20linkcodedf0hvadid475689874762hvposhvnetwghvrand9495811022519061243hvponehvptwohvqmthvdevchvdvcmdlhvlocinthvlocphy9011819hvtargidpla996365519697psc1emphilip dru administratoremap pstrongphilip zelikowstrong need tell audience emphilip dru administratorem wasp pstronggeoff kabaservicestrong oh dear yes colonel houses bizarre science fiction novel world dictatorp pstrongphilip zelikowstrong published anonymously hardly knew house written itp pstronggeoff kabaservicestrong thats truep pstrongphilip zelikowstrong earth caused read hard thing readp pstronggeoff kabaservicestrong yeah theres yale connection colonel house papers ended yale essentially biographer editor diaries charles seymour president yale unfortunately seymour expurgated lot bizarre aspects houses story wouldve discredited earlier actually discreditedp pstrongphilip zelikowstrong yes turned reason knowledge episode delayed long seymours grip house papers relinquish seymours death early 60sp pstronggeoff kabaservicestrong right wilson massively overrelied house turned person poor judgment actually broke 1919 peace negotiations warp pstrongphilip zelikowstrong correctp pstronggeoff kabaservicestrong wilson example point book failed theodore roosevelt predecessor understand roosevelt brokered 1905 armistice russojapanese warp pstrongphilip zelikowstrong right unfortunate understandable level theodore roosevelt time americas leading wilsonhater theres way goes roosevelt personally advice puzzled wouldve easy people given information number people short talking roosevelt hard wilson 15minute reconstruction america mediated end great power war inspired lot thoughts wilson proceed mediating end working government bothered work precedent known everybody cited happened 10 years earlier checked serves little illustration problems historical knowledge institutional memory goodp pstronggeoff kabaservicestrong yeah echo donald rumsfeld saying point wilson didnt know didnt know theres analogy liked wilson like poker player gets kings hand throws away kings hoping better thats great didnt know broker peace conference ultimatelyp pstrongphilip zelikowstrong yes thats right book actually point pause kind map people readers dont know broker peace conference eitherp pstronggeoff kabaservicestrong truep pstrongphilip zelikowstrong people having things like actually point key point book kind stop okay folks heres turns know begin noticing lot things record british germans understood lot things theyre begin sense scholar context kind map like okay heres step know professionals understood things wilson didnt benefit professional advice couple couple good younger diplomats american service overseas particular london named buckler good young joseph grew berlin didnt use help people working washington incompetent untrustworthyp pstronggeoff kabaservicestrong world war world war ii heart writings ive taken emtexas national security reviewem article hrefhttpstnsrorg201909toregainpolicycompetencethesoftwareofamericanpublicproblemsolvingto regain policy competence software american public problemsolvinga came september 2019 moving wilsons failures failure bureaucracy wrote introduction article quality policy engineering actually worse recent decades 20th century partisan observation decline spans republican democratic administrations wrote precovidp pstrongphilip zelikowstrong yes thats right sorry covid crisis vivid illustration arguments essay yesp pstronggeoff kabaservicestrong things mind vantage historian public servant thinking decline quality policy engineering pointp pstrongphilip zelikowstrong oh wars iraq afghanistan course actually recent stuff afghanistan illustration lot things id opportunities different perspectives including economic economic stuff work lot domestic subjects foreign stuff ive unusual opportunities lot contemporary staff work staff work archives time years fascinating compare contrast quality written staff work 40s 50s quality written staff work personally read recent years subjectsp pand article mentioned animated things historical puzzle think generally believed cause organs government relatively incompetent executing stuff resources inefficiently bogged procedures competent implementing things admirable exceptions think thats general view animates niskanen center planned state capacity project contrast image widely held held outside united states image united states world world war ii cando countryp pthe world mean kind like typical image americans land island days later functioning airstrip build atomic bombs launch marshall plans unencumbered ideology practical ingenious doers quintessential cando country regarded admired world pragmatic ability america mid20th century reputation performance today thats interesting questionp pstronggeoff kabaservicestrong indeedp pstrongphilip zelikowstrong second educator academia taught stuff dont teach stuff think quality education public problemsolving mediocre worse know having involved key institutions core institutions firsthand observation ive struggling improve timep pand wanted look way way better training teaching led trying understand historical question order bring okay fix way teach people train people today answer historical question skills mid20supthsup century come academia migrated academiap pwhere come came believe strong cultures organizational cultures large streams running strong set cultures business world american business world half 20th century culture dominated engineers tinkerers kind culture dominated staff cultures engineering world actually lot positive attributes problemsolving way wrote directions precision guidance careful reporting emphasis sorts written staff work developed period couple generations peak mid20th century america leaders corporate world exemplars engineeringscientific ethosp pmeanwhile military war department strong culture venerated highquality written staff work german origins 19th century parroted mimicked especially british paragons lot exposure british practices especially war admired tried emulate ways highquality british staff work streams kind came plus ton trialanderror new deal periodp pand people ruthless firing people screwed mistakes lots screwups lots mistakes winnowing process people competent performers tended promoted tended promote kinds staffing habits george marshall dwight eisenhower exemplars traditions sorts evidence culture official histories second world war qualitiesp pyou contrast 50 years later qualities migrate academia academia pursued fashions train people public service didnt exemplify qualities qualities essentially lost began getting passed oral traditions apprenticeship effectively end 20th century quality training staff habits american government kind fallen apart point lots staff work simply consisted whats position talking points telling people wantp pand youd quality formal training terrible exceptions generally terrible mean work nsc staff literally training job mean day policy development systematic policy analysis training people military realize aghastp pnow brilliant improvisers people learned apprenticeships job worked increasingly quality written staff work goes happens people tend substitute meetings higher higherlevel meetings cant stuff talk bumping higher levels puts stress pressure people apex pyramid things dysfunctional agencies turn functionaries instead people real delegated authorities kind trough vicious spiral downward long period timep pthis actually im impressed gratified niskanen center taking problem broader context im person notice facets lot people noticed different facets perspective little insider kind political sciencey noticed external facets symptoms frank fukiyama good example im grateful people going try spotlight work itp pstronggeoff kabaservicestrong thank struck number things said article allies won war better policymaking abilities germans japanesep pstrongphilip zelikowstrong incidentally dont follow world war ii literature interested world war ii literature dont follow closely theres important recent book didnt write phillips payson obrien written book hrefhttpswwwamazoncomgpproductb00vaovm2arefdbs_a_def_rwt_hsch_vapi_tkin_p1_i1emhow war wonema hes written biography leahy strengths emhow war wonem book idiosyncratic book book powerful stuff significance production work quality production work staff work especially air sea power sides important books written war 20 yearsp pstronggeoff kabaservicestrong agree lessons book im remembering correctly united states military innovations actually product multiple iterations firstgenerationp pstrongphilip zelikowstrong right paul kennedy makes point recent book called hrefhttpswwwamazoncomengineersvictoryproblemsolversturnedebookdpb004j4wnmgrefsr_1_1keywordspaulkennedyengineersofvictoryqid1638330935sdigitaltextsr11emengineers victoryemaem emthat excellent makes points different anglep pstronggeoff kabaservicestrong certain humility american policymakers days willing borrow britishp pstrongphilip zelikowstrong oh yes famous p51 mustang kennedy tells story p51 failed aircraft design brilliant brits british test pilot said lets try airframe rollsroyce merlin engine british aircraft engine turned match heaven p51 important aircraft changes tide strategic bombing campaign europe 44 thats story angloamerican marriage terrific storyp pstronggeoff kabaservicestrong course british experience staffing empirep pstrongphilip zelikowstrong yepp pstronggeoff kabaservicestrong havep pstrongphilip zelikowstrong yes origins good staff system maurice hankey huge figure story 1910s 1920s starts committee imperial defence staffing practices moved war cabinet system developed world war ip pstronggeoff kabaservicestrong talk business contribution war effort think people likely think donald trump think dollarayear men youre getting kind practical problemsolving approach decentralized decisionmaking characterized engineering culturep pstrongphilip zelikowstrong yes actually tragedies united states change business culture theres good stuff thats written commented american business culture began going profound change good books begins picking speed late 50s 60s gets going fundamental shift operations production basically financial engineering change culture taught business schools change culture prized higherlevel executives change overall culture american businesses businesses emphasized culture stuff building things outsource building things course chinesep pit turns pointed outsource building things outsource lot stuff american companies business making stuff good example corning outsources lot fabrication keeps lot united states need knowhow need knowhow company general fashion lot american business didnt need know needed know manipulate results thatp pstronggeoff kabaservicestrong helped amo houghton write autobiography thep pstrongphilip zelikowstrong whop pstronggeoff kabaservicestrong amo houghton longtime ceo corning experiencep pstrongphilip zelikowstrong heard complaints beforep pstronggeoff kabaservicestrong heard complaints shall point gasps government culture meticulous written staff work efforts find sources problems pentagon papersp pstrongphilip zelikowstrong yes ironically culture produces pentagon papers reflective professional culture notion mcnamara commission project study history got war vietnam shocking controversial idea mcnamara came people thought kind thing youll notice multiple studies bay pigs catastrophe internally john f kennedy asked dick neustadt study failures culture government rigorous study went right went wrong highly professional level quality pentagon papers way symptom beginning dying culturep pstronggeoff kabaservicestrong yeah effort underway try honestly searchingly figure went wrong exit afghanistan enterprise afghanistan im aware itp pstrongphilip zelikowstrong right currently tammy duckworth proposing afghanistan commission theyre trying national defense authorization act right minutep pstronggeoff kabaservicestrong commission actually run demise kind highquality written staff work partly pentagon papers cast significant echo people cya mode dont want actually write happens meetingsp pstrongphilip zelikowstrong right commission administer hard dopeslap calls fact quit written work begin making policy bloviating catastrophic results contribute people trying things differentlyp pstronggeoff kabaservicestrong actually met time kennedy school harvard 90s ernest advisor cant help feel reading emtexas national security reviewem article theres actually problem harvards shift littauer school public administration kennedy school governmentp pstrongphilip zelikowstrong actually close friends founders kennedy school taught core curriculum kennedy school time probably time came acquainted lot complaints sadness people helped found kennedy school school sympathy schools strengths im aware disappointment cofounders feel school effectively felt school hijacked particular academic orthodoxy ended helpful training people public problemsolvingp pi article basically set approaches policy analytics drawn microeconomics way powerful tools certain kinds policy analysis general policy development article gets little bit youre right 90s movement harvard kennedy school number professors joined try change core curriculum movement failed close vote failed left school came virginia shortly reason reasons opportunity opportunity lostp pi think possibilities try generate movement revamp way train people public problemsolving america use failures afghanistan pandemic crisis prompt change training understand training comes odd historical circumstances try adopt different kinds training let lot general ferment unease stultification american higher education american professional education think important effort rebuild competency country important causep pstronggeoff kabaservicestrong agree business declining state capacity tends pessimistic frame mindp pstrongphilip zelikowstrong doesp pstronggeoff kabaservicestrong consider related completely similar subject american national decline ultimately end emtexas national security reviewem optimistic notep pstrongphilip zelikowstrong dop pstronggeoff kabaservicestrong write sentences americans reflect proud heritage far past americans notorious world practical cando skills fixing cars tackling apparently insurmountable problems public private seemingly bygone skills genes air consigned wistful nostalgia skills specific cultural teachablep pstrongphilip zelikowstrong exactly taught think lot things lot promising things society headed direction theres enormous interest country actually relearning build things liberating environment digital revolution creating waysp pactually wide admiration people like elon musk partly hes admired eccentric hes admired hes innovator makes cool stuff america way theyre gravitating henry ford tom edison 21st century noteworthy noting cultural moment supply chain problems lot different problems actually potentially opportunities rethink lot sinews economy culturep pand weve lot innovations progressive era people called attention early 20th century came period terrible neglect terrible civil strife country huge social tensions sense lot people pessimistic country responded chance interesting country look things work way jim deb fallows little bit work getting plane hopping aroundp pstronggeoff kabaservicestrong like book hrefhttpswwwamazoncomourtowns000milejourneyamericadp0525432442refasc_df_0525432442taghyprod20linkcodedf0hvadid316966985685hvposhvnetwghvrand17401824935805128077hvponehvptwohvqmthvdevchvdvcmdlhvlocinthvlocphy9011819hvtargidpla539761343999psc1emour townsemap pstrongphilip zelikowstrong right book emour townsem hbo series project theyve got find know americans country actually lot neat stuff ingenious native talent national discourse doesnt notice want try people rightly sad pessimistic lot things want find reasons optimism hard findp pstronggeoff kabaservicestrong promised way going talk hour leave tell covid commission planning group director right nowp pstrongphilip zelikowstrong sure year ago group funders led eric schmidt thought obvious coming gigantic covid crisis impactful crisis 1945 ways surely national commission major investigation happen learn lot lessons obvious largescale investigation thought help getting work right away start planning recruited hired lead group planning quickly gathered dozens subject matter experts help website hrefhttpswwwcovidcpgorgcovidcpgorga stands covid commission planning grouporg covidcpgorgp pand better year weve kind planning largescale commission kind organized view principal task forces recruiting people help lead task forces identifying issues drafting launch work plans right commission congress currently considering legislation create legislation pros cons subject congress doesnt probably alternative group private philanthropies band create independent commission seek help theyll need access people forth biden white house maybe help members congress partiesp pstronggeoff kabaservicestrong hrefhttpswwwwashingtonpostcomwashingtonpostlive20210902coronavirusfindinganswerswithphilipdzelikowtolda karen tumulty emwashington postem recently tackling understanding crisis actually harder problem 911 commission thatp pstrongphilip zelikowstrong 911 hard covid crisis harder 911 crisis primarily involved federal government pretty washingtonfocused attention foreign terrorist organizations responder stuff new york cityp pthe scale scope crisis larger youve got understand nationwide crisis management involving people america youve got international picture having causes pandemic prevent pandemics early warning thats international youve got challenge medical countermeasures harness bio revolution national international intellectually investigative point view terms number subject matter areas need competence sprawling problemp pand ask things commission actually add value look people natural processes going certain work let dont need commission recapitulate people fine ask questions think commission add insight assembling lot horsepower maybe access people records think weve got plan proceed waiting united states create suitable commissionp pthe british announced theyre going launch public inquiry early year head christmas like sweden forth brazil launching inquiries weve reluctant stand end cultural reasons wed discussing earlier podcastp pstronggeoff kabaservicestrong yes youd mentioned earlier 911 commission partisan certainly terms served discussion comparison todays polarization like veritable era good feelings talking congress refused allow commission created look january 6th capitol invasionp pstrongphilip zelikowstrong yes thats rightp pstronggeoff kabaservicestrong extent polarization impeding ability kind work mindp pstrongphilip zelikowstrong oh impeding lot pretty familiar views capitol hill mean thats commission hasnt created republicans think democrats want create commission pin blame crisis trump antitrump thing reasons dont want thatp pon republican blame narrative focused china rand paul chinas fellow travelers youve got blame narratives sides youve got culture war narratives sides lets says follow science says protect americans liberties livelihoods youve got polarized environment lot mutual suspicion experience january 6th commission saidp pit interesting right possibility congress create commission bill thats proposed basic bipartisan deal republicans insist commission origins issues best democrats insist turn commission needs broad scope examine lot facets crisis basis bipartisan agreement polarized environment im sure itll therep pthen fails left philanthropies choose try create independent commission position biden white house facilitate instrumental biden white house far preoccupied noncommittal need decide want remain stancep pstronggeoff kabaservicestrong professor philip zelikow wish luck world enterprise congratulations wonderful new book thank joining todayp pstrongphilip zelikowstrong thank geoff delightfulp pstronggeoff kabaservicestrong thank listening vital center podcast subscribe rate preferred podcasting platform questions comments responses include rating send email contactniskanencenterorg thanks technical director kristie eshelman sound engineer ray ingegneri niskanen center washington dcp pphoto credit hrefhttpswwwistockphotocomphotousaflagamericanflagamericanflagblowinginthewindgm923981666253601127istockap pthe post relnofollow hrefhttpswwwniskanencenterorghowamericacanbecomeacandocountryagainwithphilipzelikowhow america country philip zelikowa appeared relnofollow hrefhttpswwwniskanencenterorgniskanen centerap |
61a94a482ac52792067f2c48 | Socialist Students Want Arizona State University To Expel 'Racist Murderer' Kyle Rittenhouse | div
picture
source sizesminwidth 600px 331px 100vw typeimagewebp srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202112screenshot20211201at92325pm2400x1350pngwebp 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202112screenshot20211201at92325pm1200x675pngwebp 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202112screenshot20211201at92325pm800x450pngwebp 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202112screenshot20211201at92325pm600x338pngwebp 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202112screenshot20211201at92325pm331x186pngwebp 331w
source sizesminwidth 600px 331px 100vw typeimagejpeg srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202112screenshot20211201at92325pm2400x1350png 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202112screenshot20211201at92325pm1200x675png 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202112screenshot20211201at92325pm800x450png 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202112screenshot20211201at92325pm600x338png 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202112screenshot20211201at92325pm331x186png 331w
img width1200 altscreen shot 20211201 at 92325 pm srchttpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202112screenshot20211201at92325pm800x450png height675
picture
div
pmany socialists believe that education is a universal human right but evidently not arizona state universitys asu students for socialism on wednesday they staged a protest to pressure campus administrators to expel kyle rittenhouse the recently acquitted kenosha shooterp
pquotjoin us and rally against racist murderer kyle rittenhouse being permitted on our campusquot a hrefhttpstwittercomsfsasustatus1464324758086959105saida the student group on twitterp
pif video footage of the event on social media is any indication it a hrefhttpstwittercomartvalley818_status1466217451511709698seemed sparsely attendeda in fact prorittenhouse counterdemonstrators a hrefhttpstwittercomartvalley818_status1466217451511709698appeareda to outnumber the socialists when a leader of the protestwho was equipped with a megaphonedenounced rittenhouse as a emwhite supremacistem killer spectators pointed out that all three of the people he shot were white a hrefhttpstwitchycombrettt313620211201watchasustudentsprotestracistmurdererkylerittenhousewhoisntenrolledtherebutwhoseancestorskilledblackandbrownpeoplethis did not deter the protestera who responded that rittenhouse was a descendant of white colonists who had murdered black and brown peoplep
pin any event there is little chance of rittenhouse setting foot at asu he is not currently enrolled as a student he was at one point a hrefhttpswwwdeseretcom2021113022810284kylerittenhousearizonastateuniversitysigned up to take online classes while awaiting admissiona but if he did the public university would have no reason to evict him and it should consider his hypothetical application as if he were any other student he is a free man who was deemed innocent by a jury of his peersa jury that agreed he acted in selfdefense when he shot three men a hrefhttpsreasoncom20211109theprosecutionhadaverybaddayinthekylerittenhousetrialafter each had allegedly attacked hima he is neither a murderer nor does he appear to be a racist he has publicly a hrefhttpsthehillcomhomenewsmedia582568kylerittenhouseisupporttheblmmovementdeclareda that he supports black lives matter and a hrefhttpswwwchicagotribunecomnewsctkylerittenhousetuckercarlson20211123bcpvfq3djverlcticfhcsidi6estoryhtmllamenteda that prosecutors can use their power to mistreat defendants of colorp
pleftist students have free speech rights and they can exercise those to protest rittenhouse if they wish but a great many university administrationswhose formal stances on public policy matters unrelated to education would be better left unsaidhave also taken sides against rittenhousep
pithe atlanticis conor friedersdorf a hrefhttpswwwtheatlanticcomideasarchive202111universitiesforcedconsensuskylerittenhouse620809noteda in a recent article that the universities of california at santa cruz and irvine as well as the new school in new york all released statements protesting the outcome of the trial and suggesting that rittenhouses notguilty verdict was evidence of the power of white supremacy in us societyp
pquotwe are disheartened and dismayed by this mornings not guilty verdict on all charges in the trial of kyle rittenhousequot a hrefhttpsnewsucscedu202111statementrittenhousehtmlwrotea uc santa cruz in a statement quotwe join in solidarity with all who are outraged by this failure of accountability trials such as these that have racerelated implications can cause our bipoc communities distress and harm this is harm that is endured everyday through acts of racism the pervasiveness of white supremacy and a flawed justice systemquotp
pat uc irvine the vice chancellor for equity diversity and inclusion and chief diversity officer said in his official capacity that quotthe conclusion of this trial does not end the reckoning about systemic racism in the united states if anything it has simply made it more legiblequotp
pits difficult to understand why the chief diversity officer of a school thousands of miles away from kenosha felt the need to weigh in on this matter on behalf of the school and in a manner that suggests any student who disagrees might be an accomplice to racism but weigh in he didp
pthe connecticut state colleges and universities system a hrefhttpswwwthecollegefixcombulletinboardreadthisprofessorsletterdefendingthekylerittenhouseverdictsaida the verdict was a reminder quotthat systems of inequity were not built in a day or a momentthey have been manufactured crafted and honed through generations of practice and reinforcementquot and fitchburg state universitys center for diversity and inclusiveness a hrefhttpstwittercomlibsoftiktokstatus1461852897679790085set up racially segregated safe spacesaseparate spaces for students of color and white studentsto process their trauma regarding the outcomep
pit would have been entirely proper for colleges and universities to foster vigorous debate on rittenhouses acquittal and to make it possible for students and professors dismayed by the verdict to speak up and explain their perspectives but when administrators treat the outcome as obviously and undeniably wrongand in fact racistthey are more likely to render such a discussion impossiblep
pasus administration to its credit did not join in a spokesperson a hrefhttpswwwfoxnewscomusarizonastateuniversitykylerittenhousenotenrolledstudentdemandsconfirmeda to the media that rittenhouse wasnt actually enrolled but said nothing about keeping him off campusto the disappointment of the socialists undoubtedlyp
psome conservative and libertarian students on the other hand said that they would welcome rittenhouse the student organization young americans for liberty yal released a statement chiding the left for hypocrisyp
pquothow ironic that the same socialists who call higher education a human right also want to deny rittenhouse that fundamental human rightquot said sean themea yals chief of staffp
piframe allowfullscreen srchttpswwwyoutubecomembedxzuxrv_eu9kfeatureoembed width500 titlerobby soave rittenhouse asu expulsion protests are laughable hes not even a student height281iframep
pthe post a relnofollow hrefhttpsreasoncom20211202socialiststudentswantarizonastateuniversitytoexpelracistmurdererkylerittenhousesocialist students want arizona state university to expel racist murderer kyle rittenhousea appeared first on a relnofollow hrefhttpsreasoncomreasoncomap | div picture source sizesminwidth 600px 331px 100vw typeimagewebp srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202112screenshot20211201at92325pm2400x1350pngwebp 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202112screenshot20211201at92325pm1200x675pngwebp 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202112screenshot20211201at92325pm800x450pngwebp 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202112screenshot20211201at92325pm600x338pngwebp 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202112screenshot20211201at92325pm331x186pngwebp 331w source sizesminwidth 600px 331px 100vw typeimagejpeg srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202112screenshot20211201at92325pm2400x1350png 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202112screenshot20211201at92325pm1200x675png 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202112screenshot20211201at92325pm800x450png 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202112screenshot20211201at92325pm600x338png 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202112screenshot20211201at92325pm331x186png 331w img width1200 altscreen shot 20211201 92325 pm srchttpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202112screenshot20211201at92325pm800x450png height675 picture div pmany socialists believe education universal human right evidently arizona state universitys asu students socialism wednesday staged protest pressure campus administrators expel kyle rittenhouse recently acquitted kenosha shooterp pquotjoin rally racist murderer kyle rittenhouse permitted campusquot hrefhttpstwittercomsfsasustatus1464324758086959105saida student group twitterp pif video footage event social media indication hrefhttpstwittercomartvalley818_status1466217451511709698seemed sparsely attendeda fact prorittenhouse counterdemonstrators hrefhttpstwittercomartvalley818_status1466217451511709698appeareda outnumber socialists leader protestwho equipped megaphonedenounced rittenhouse emwhite supremacistem killer spectators pointed people shot white hrefhttpstwitchycombrettt313620211201watchasustudentsprotestracistmurdererkylerittenhousewhoisntenrolledtherebutwhoseancestorskilledblackandbrownpeoplethis deter protestera responded rittenhouse descendant white colonists murdered black brown peoplep pin event little chance rittenhouse setting foot asu currently enrolled student point hrefhttpswwwdeseretcom2021113022810284kylerittenhousearizonastateuniversitysigned online classes awaiting admissiona public university reason evict consider hypothetical application student free man deemed innocent jury peersa jury agreed acted selfdefense shot men hrefhttpsreasoncom20211109theprosecutionhadaverybaddayinthekylerittenhousetrialafter allegedly attacked hima murderer appear racist publicly hrefhttpsthehillcomhomenewsmedia582568kylerittenhouseisupporttheblmmovementdeclareda supports black lives matter hrefhttpswwwchicagotribunecomnewsctkylerittenhousetuckercarlson20211123bcpvfq3djverlcticfhcsidi6estoryhtmllamenteda prosecutors use power mistreat defendants colorp pleftist students free speech rights exercise protest rittenhouse wish great university administrationswhose formal stances public policy matters unrelated education better left unsaidhave taken sides rittenhousep pithe atlanticis conor friedersdorf hrefhttpswwwtheatlanticcomideasarchive202111universitiesforcedconsensuskylerittenhouse620809noteda recent article universities california santa cruz irvine new school new york released statements protesting outcome trial suggesting rittenhouses notguilty verdict evidence power white supremacy societyp pquotwe disheartened dismayed mornings guilty verdict charges trial kyle rittenhousequot hrefhttpsnewsucscedu202111statementrittenhousehtmlwrotea uc santa cruz statement quotwe join solidarity outraged failure accountability trials racerelated implications cause bipoc communities distress harm harm endured everyday acts racism pervasiveness white supremacy flawed justice systemquotp pat uc irvine vice chancellor equity diversity inclusion chief diversity officer said official capacity quotthe conclusion trial end reckoning systemic racism united states simply legiblequotp pits difficult understand chief diversity officer school thousands miles away kenosha felt need weigh matter behalf school manner suggests student disagrees accomplice racism weigh didp pthe connecticut state colleges universities system hrefhttpswwwthecollegefixcombulletinboardreadthisprofessorsletterdefendingthekylerittenhouseverdictsaida verdict reminder quotthat systems inequity built day momentthey manufactured crafted honed generations practice reinforcementquot fitchburg state universitys center diversity inclusiveness hrefhttpstwittercomlibsoftiktokstatus1461852897679790085set racially segregated safe spacesaseparate spaces students color white studentsto process trauma outcomep pit entirely proper colleges universities foster vigorous debate rittenhouses acquittal possible students professors dismayed verdict speak explain perspectives administrators treat outcome obviously undeniably wrongand fact racistthey likely render discussion impossiblep pasus administration credit join spokesperson hrefhttpswwwfoxnewscomusarizonastateuniversitykylerittenhousenotenrolledstudentdemandsconfirmeda media rittenhouse wasnt actually enrolled said keeping campusto disappointment socialists undoubtedlyp psome conservative libertarian students hand said welcome rittenhouse student organization young americans liberty yal released statement chiding left hypocrisyp pquothow ironic socialists higher education human right want deny rittenhouse fundamental human rightquot said sean themea yals chief staffp piframe allowfullscreen srchttpswwwyoutubecomembedxzuxrv_eu9kfeatureoembed width500 titlerobby soave rittenhouse asu expulsion protests laughable hes student height281iframep pthe post relnofollow hrefhttpsreasoncom20211202socialiststudentswantarizonastateuniversitytoexpelracistmurdererkylerittenhousesocialist students want arizona state university expel racist murderer kyle rittenhousea appeared relnofollow hrefhttpsreasoncomreasoncomap |
61a94a512ac52792067f2c4a | The Academic Freedom Podcast #8 with Howard Gillman | pa new episode of a hrefhttpsacademicfreedomorgpodcaststhe academic freedom podcasta from the a hrefhttpsacademicfreedomorgacademic freedom alliancea is now available subscribe through your favorite platform so you dont miss an episodep
pin this episode i talk with a hrefhttpschancellorucieduabouthoward gillmana about the view from a university presidents office on the campus free speech situation today gillman is the chancellor of the university of california at irvine and a former dean at the university of southern california he is the coauthor of a hrefhttpswwwamazoncomexecobidosasin0300240015reasonmagazinea20emfree speech on campusema and advisory board cochair of the a hrefhttpsfreespeechcenteruniversityofcaliforniaedunational center for free speech and civic engagementap
pi hope this is the first of a few conversations with university leaders about how they think about academic freedom and the challenges they face in protecting it the conversation with gillman is particularly wide ranging and he has thought about these issues more deeply than your average university president given his own scholarly background in constitutional law there is a lot to learn herep
pa hrefhttpsacademicfreedompodbeancomehowuniversityadministratorscanfosteracultureoffreespeechlisten to the whole thing hereap
pthe post a relnofollow hrefhttpsreasoncomvolokh20211202theacademicfreedompodcast8withhowardgillmanthe academic freedom podcast 8 with howard gillmana appeared first on a relnofollow hrefhttpsreasoncomreasoncomap | pa new episode hrefhttpsacademicfreedomorgpodcaststhe academic freedom podcasta hrefhttpsacademicfreedomorgacademic freedom alliancea available subscribe favorite platform dont miss episodep pin episode talk hrefhttpschancellorucieduabouthoward gillmana view university presidents office campus free speech situation today gillman chancellor university california irvine dean university southern california coauthor hrefhttpswwwamazoncomexecobidosasin0300240015reasonmagazinea20emfree speech campusema advisory board cochair hrefhttpsfreespeechcenteruniversityofcaliforniaedunational center free speech civic engagementap pi hope conversations university leaders think academic freedom challenges face protecting conversation gillman particularly wide ranging thought issues deeply average university president given scholarly background constitutional law lot learn herep pa hrefhttpsacademicfreedompodbeancomehowuniversityadministratorscanfosteracultureoffreespeechlisten thing hereap pthe post relnofollow hrefhttpsreasoncomvolokh20211202theacademicfreedompodcast8withhowardgillmanthe academic freedom podcast 8 howard gillmana appeared relnofollow hrefhttpsreasoncomreasoncomap |
61a94a9f2ac52792067f2c54 | The great nudge | pthe post a relnofollow hrefhttpswwwspikedonlinecom20211202thegreatnudgethe great nudgea appeared first on a relnofollow hrefhttpswwwspikedonlinecomspikedap | pthe post relnofollow hrefhttpswwwspikedonlinecom20211202thegreatnudgethe great nudgea appeared relnofollow hrefhttpswwwspikedonlinecomspikedap |
61a94acb2ac52792067f2c5a | The expensive version of the flying car? | blockquotepblade air mobility the helicopter shuttle company backed by cathie wood and david zaslav has struck a 12m deal with a canadian helicopter operator betting that a wider network will give it a lead if electric air taxis become a realityp
pthe new yorkbased group which makes most of its money from trips to the citys airports and the hamptons has acquired exclusive rights to the scheduled passenger business of helijet a canadian company flying between vancouver victoria and nanaimo in british columbiap
pthe deal is part of a land grab for helipads routes and customers in expectation that a new generation of quieter loweremissions shorthop aircraft will need to use constrained existing infrastructure at least initially according to executivesp
pjpmorgan predicted in september that the total market could be worth hundreds of billions of dollars by the 2030s but cautioned that only a handful of eva companies were on track for regulatory certification by 2025 and several planned to compete with bladepblockquote
phere is a relnoopener hrefhttpswwwftcomcontent61ccb3192fed4c799465af7100cf65f3 target_blankthe full ft storya and i presume a private car picks you up after you landp
pthe post a relnofollow hrefhttpmarginalrevolutioncommarginalrevolution202112theexpensiveversionoftheflyingcarhtmlthe expensive version of the flying cara appeared first on a relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap | blockquotepblade air mobility helicopter shuttle company backed cathie wood david zaslav struck 12m deal canadian helicopter operator betting wider network lead electric air taxis realityp pthe new yorkbased group makes money trips citys airports hamptons acquired exclusive rights scheduled passenger business helijet canadian company flying vancouver victoria nanaimo british columbiap pthe deal land grab helipads routes customers expectation new generation quieter loweremissions shorthop aircraft need use constrained existing infrastructure initially according executivesp pjpmorgan predicted september total market worth hundreds billions dollars 2030s cautioned handful eva companies track regulatory certification 2025 planned compete bladepblockquote phere relnoopener hrefhttpswwwftcomcontent61ccb3192fed4c799465af7100cf65f3 target_blankthe ft storya presume private car picks landp pthe post relnofollow hrefhttpmarginalrevolutioncommarginalrevolution202112theexpensiveversionoftheflyingcarhtmlthe expensive version flying cara appeared relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap |
61a94b702ac52792067f2c66 | My Conversation with the excellent Ruth Scurr | pa fine discourse all around here is a relnoopener hrefhttpsconversationswithtylercomepisodesruthscurr target_blankthe transcript and audioa here is part of the cwt summaryp
blockquotepruth joined tyler to discuss why she considers danton the hero of the french revolution why the jacobins were so maleobsessed the wit behind condorcets idea of a mechanical king the influence of adam smiths emtheory of moral sentiments emduring and after the reign of terror why 18thcentury french thinkers were obsessed with finding forms of government that would fit with emerging market forces whether hayeks critique of french enlightenment theorists is correct the relationship between the french revolution and todays woke culture the truth about napoleons diplomatic skills the poor prospects for pitching biographies to publishers why montesquieus emspirit of the lawsem would be her desert island read why cambridge is a better city than oxford why the emtimes literary supplementem remains important today what she loves about elena ferrantes writing how she stays open as a biographer and morepblockquote
pand an excerptp
blockquote
pstrongcowenstrong is there a counterfactual path where the french revolution simply works out well as a liberal revolution if so what would have needed to have been differentp
pstrongscurrstrong in terms of counterfactuals the one i thought most about was what would have happened if robespierre hadnt a relnoopener hrefhttpswwwbritannicacomeventthermidorianreaction target_blank datahrefhttpswwwbritannicacomeventthermidorianreactionfallen at thermidora and the relationship between him and a relnoopener hrefhttpswwwbritannicacombiographylouisdesaintjust target_blank datahrefhttpswwwbritannicacombiographylouisdesaintjust[louis antoine lon de] saintjusta had continued but thats not the triumph of the liberal revolution that would have merely been a continuation of the point they had gotten to for a triumph of the liberal revolution that would have needed to be much much earlierp
pi think that it was almost impossible for them to get a liberal constitution in place in time to make that a possibility what you have is 1789 the liberal aspirations the hopes the a relnoopener hrefhttpsavalonlawyaleedu18th_centuryrightsofasp target_blank datahrefhttpsavalonlawyaleedu18th_centuryrightsofaspdeclaration of rightsa and then there is almost a hiatus period in which they are struggling to design the institutions and that is the period which if it could have been compressed if there could have been more quickly a stability introduced p
psome of the people im most interested in in that period were very interested in what has to be true about the society in order for it to have a stable constitution obviously when youre in the middle of a revolution and youre struggling to come up with those solutions then there is the opening to chaosp
blockquote
pdefinitely recommended and i am again happy to recommend ruths new book a relnoopener hrefhttpswwwamazoncomnapoleonlifetoldgardensshadowsebookdpb08l6xwzy1refsr_1_2keywordsruthscurrqid1638398972sr82 target_blanknapoleon a life told in gardens and shadowsap
pthe post a relnofollow hrefhttpmarginalrevolutioncommarginalrevolution202112myconversationwiththeexcellentruthscurrhtmlmy conversation with the excellent ruth scurra appeared first on a relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap | pa fine discourse relnoopener hrefhttpsconversationswithtylercomepisodesruthscurr target_blankthe transcript audioa cwt summaryp blockquotepruth joined tyler discuss considers danton hero french revolution jacobins maleobsessed wit condorcets idea mechanical king influence adam smithsemtheory moral sentimentsemduring reign terror 18thcentury french thinkers obsessed finding forms government fit emerging market forces hayeks critique french enlightenment theorists correct relationship french revolution todays woke culture truth napoleons diplomatic skills poor prospects pitching biographies publishers montesquieusemspirit lawsemwould desert island read cambridge better city oxford theemtimes literary supplementemremains important today loves elena ferrantes writing stays open biographer morepblockquote pand excerptp blockquote pstrongcowenstrongis counterfactual path french revolution simply works liberal revolution needed differentp pstrongscurrstrongin terms counterfactuals thought happened robespierre hadnta relnoopener hrefhttpswwwbritannicacomeventthermidorianreaction target_blank datahrefhttpswwwbritannicacomeventthermidorianreactionfallen thermidoraand relationship anda relnoopener hrefhttpswwwbritannicacombiographylouisdesaintjust target_blank datahrefhttpswwwbritannicacombiographylouisdesaintjust[louis antoine lon de] saintjustahad continued thats triumph liberal revolution merely continuation point gotten triumph liberal revolution needed earlierp pi think impossible liberal constitution place time possibility 1789 liberal aspirations hopes thea relnoopener hrefhttpsavalonlawyaleedu18th_centuryrightsofasp target_blank datahrefhttpsavalonlawyaleedu18th_centuryrightsofaspdeclaration rightsa hiatus period struggling design institutions period compressed quickly stability introducedp psome people im interested period interested true society order stable constitution obviously youre middle revolution youre struggling come solutions opening chaosp blockquote pdefinitely recommended happy recommend ruths new book relnoopener hrefhttpswwwamazoncomnapoleonlifetoldgardensshadowsebookdpb08l6xwzy1refsr_1_2keywordsruthscurrqid1638398972sr82 target_blanknapoleon life told gardens shadowsap pthe post relnofollow hrefhttpmarginalrevolutioncommarginalrevolution202112myconversationwiththeexcellentruthscurrhtmlmy conversation excellent ruth scurra appeared relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap |
61a94bde2ac52792067f2c70 | The end of American moral wars | pspanto have been a war reporter over the past ten years is to have worked under the shadow of the modern american way of war from libya a decade ago to my last reporting trip in syria in 2019 the outcome of the wars that followed the arab spring have been decided by the presence or absence of american air power spanp
pspani owe my life no doubt to an american pilot ive never met who dropped a bomb a couple of years ago on isis fighters in the garden of the surrounded farmhouse in rural deir ezzor spana relnoopener hrefhttpswwwyoutubecomwatchvbnqnx_xk0dq target_blankspanwhere i and sdf fighters huddledspanaspan waiting to be overrun in these modern wars the bombs that come hurtling out of the sky rending the air like a bolt of lightning land with pinpoint accuracy transforming the course of a battle in an instant like the judgment of an angry and invisible godspanp
pspanover the years in battles across northeastern syria i watched the us air force rain down death on isis fighters and then wandered hours or days later through the carnage that ensued mangled bodies in their dozens grey with cement dust or black with putrefaction hurled by the explosion into all manner of strange and inhuman shapesspanp
divdiv
pspanin raqqa five years ago i embedded with arab fighters of the sdf as they called in airstrikes against isis militants which would level entire apartment blocks to dislodge one sniper a year later i followed local volunteers as they dragged the shrivelled stinking bodies of airstrike victims from the citys rubble isis wives or local civilians identifiable only by the detritus of a life suddenly cut short passport photos purses makeup bags and soft toys spanp
pspanthe devastation of raqqa after the battle its apartment blocks crushed by the pinpoint precision of american military technology looked hardly less total than that of rebelheld eastern aleppo levelled by the wantonly imprecise barrel bombing of the syrian regime whose helicopters hovered unbearably over the city like flies over a dining table disgorging their bombs at random yet even if the effect in destroyed buildings spana relnoopener hrefhttpswwwnewyorkercommagazine20201221americaswaronsyriancivilians target_blankspanseemed much the samespanaspan surely the morality of the two approaches was different spanp
diva hrefhttpsunherdcom202111whyiamfleeingtothehillsrefinnara hrefhttpsunherdcom202111whyiamfleeingtothehillsrefinnarimg srchttpsunherdcomwpcontentuploads2021112gettyimages921405462scaled1300x200jpgadiva hrefhttpsunherdcom202111whyiamfleeingtothehillsrefinnarspanmore from this authorspanaa hrefhttpsunherdcom202111whyiamfleeingtothehillsrefinnarh5why i am fleeing to the hillsh5apa hrefhttpsunherdcom202111whyiamfleeingtothehillsrefinnarspanbyspan aris roussinosapdivadiv
pspanby emphasising precision and at least making a concerted effort to avoid civilian casualties surely the american way of bombing is an act morally distinct from the indiscriminate punishment dealt out by the syrian regime if the intentions are good can the results be evilspanp
pspanit is in part to answer this question that the yale legal scholar samuel moyn has written the new book spana relnoopener hrefhttpsusmacmillancombooks9780374173708humane target_blankispanhumanespaniaspan an exploration of how the wests effort to conduct wars while minimising harm has had the unintended consequence of creating a world of forever war he takes his cue from a speech tolstoy puts into the mouth of his character prince andrei in spanispanwar and peacespanispan in which the russian aristocrat notes that war should be kept as brutal as possible otherwise the temptation to keep waging it will become too great as moyn notes humanitarianism led advocates to compromise in pursuit of humane war and publics to feel good enough about themselves in the bargain to permit it to go on and on with the result that endless war has become part of the way americans live nowspanp
pspanrattling through the twin strands of the initially european effort to impose humanitarian rules on war and the parallel american effort to abolish war altogether moyn assembles the evidence for his thesis that from the clinton era onwards the mantra of never again has led the united states into an endless mission to bomb more and more of the earth in pursuit of global harmony as he observes of all the peoples in the annals of warfare americans are the ones who have invented a form of war righteously pursued as superior precisely for being more humane and one tolerated by audiences for that very reasonspanp
pspana noninterventionist of a strain once dominant in american politics and only now slowly becoming the hegemonic worldview once again moyn is a critic of the process by which the postwar american empire legitimated itself through war for humanitarian ends after world war two as he notesspan spanselfstyled internationalists insisted that america had to commit to a globalised peace scheme yet it would only emerge slowly that this option meant committing the country to global war spanp
pspanvictory in world war two and then in the cold war both stood for moyn as roads not taken as american leaders refused to give up the prospect of global domination following the vietnam war as american military elites committed themselves to eliminating its indiscriminate bombing and targeted war crimes the new discipline of international humanitarian law fused with the fact of americas sudden global preeminence to create the logic for liberal interventionismspanp
pspanas moyn notes in the decades following vietnam the western popular memory recentred the holocaust into the wars retrospective justification peripheral in moral consciousness before ethnic cleansing culminating in genocide became the defining evil of war past and present coupled with unchallenged american hegemony the new holocaust memory coincided with the aftermath of decolonisation and a skepticism along with it that others were up to the challenge of ruling themselves the result was not a demand for peace but for interventionist justice spanp
pspanwith the postwar taboo on initiating wars obscured america was now morally entitled encouraged even to launch its own wars in contravention of international law as long as it could be argued that they prevented genocides yet noone asked at the time whether that implied that war itself especially if it could be purged of its cruelty was not that bad for moyn as for realist scholars the two notionally distinct strands of interventionist thought foreign policy neoconservatism and liberal internationalism found themselves closer to each other than their followers liked to admitspanp
diva hrefhttpsunherdcom202111thisishowcivilisationscollapserefinnara hrefhttpsunherdcom202111thisishowcivilisationscollapserefinnarimg srchttpsunherdcomwpcontentuploads2021112gettyimages1172305331scalede1637162794528300x171jpgadiva hrefhttpsunherdcom202111thisishowcivilisationscollapserefinnarspanmore from this authorspanaa hrefhttpsunherdcom202111thisishowcivilisationscollapserefinnarh5this is how civilisations collapseh5apa hrefhttpsunherdcom202111thisishowcivilisationscollapserefinnarspanbyspan aris roussinosapdivadiv
pspanfrom the clinton era which did the most to drive the drift into militarism no matter the legality of the wars involved through to the advice of scholars like john yoo who famously provided legal cover for the bush administrations use of torture against captives in the war on terror moyn traces the humanitarian and legal steps by which the american empire committed itself to endless global war yet it was the obama administration which really committed america to constant war in a process by which the president elected on a peace platform became a permanent if humane war president the architect of a massive expansion of drone strikes a means to avoid the moral cloud of torture by instead simply assassinating perceived wrongdoers and of special forces operations on the ground spanp
pspanmoyns central thesis is that the wellintentioned humanisation of war functioned as a spoonful of sugar intended to help the medicine of endless war go down and that the push to forever war was driven by the liberal interventionist pressures of activists and human rights activists who demanded even more humane war than the good guys were willing to offer it is a neat argument but surely an incomplete onespanp
pspanit is primarily the vast disparity of power and the almost total absence of risk to american pilots and drone operators that allows these wars to rumble on forever not the minimising of harm to foreign civilians it is only if american casualties were higher and not civilian ones that we would sooner see an end to americas wars of choice the pinpoint accuracy with which a missile can be sent to its chosen target does not mean that in the fog of war the target was well chosen in the first place spanp
pspanthe recent extermination by drone of spana relnoopener hrefhttpswwwtheguardiancomworld2021nov04usafghanistanstrikekilledcivilianslegalpentagon target_blankspana blameless family in central kabulspanaspan only hit the headlines because it happened in the capital if it had happened in the countryside as has happened thousands of times in the past two decades it is doubtful that anyone would know about it and fundamentally even in such a high profile case few people in america cared much even thenspanp
pspanas for the push moyn discerns by liberal interventionist commentators to drag american power into distant wars a more cynical interpretation would be that moral causes only initiate american wars when the potential targets are already american foes there was no clamour in washington for a campaign against saudi arabia for its bombing of yemen for example or against bahrain for its lethal suppression of demonstrations or against turkey for its scorched earth suppression of armed revolts in the kurdish east and invasions of northeastern syria or against azerbaijan for its aggression against armenia and beheading of captives when the human rights oppressor is a us ally advocates and journalists either tend not to make the case for intervention or it is ignoredspanp
pspanultimately for all his focus on the humanitisation of war it is empire that moyn is against if america were militarily incapable of intervening in tangled squabbles at the other end of the world it would feel no moral compulsion to do so that compulsion may be the moral justification for empire but fundamentally it is its product where there is no capacity to act there is no moral compulsion there will be no american war for the uighurs because it is not in americas power to launch or win one human rights abuses like xinjiang are deployed as a diplomatic tool to delegitimise china in the international sphere rather than as a call to armsspanp
diva hrefhttpsunherdcom202111shouldweforcechinaintowarrefinnara hrefhttpsunherdcom202111shouldweforcechinaintowarrefinnarimg srchttpsunherdcomwpcontentuploads202111gettyimages518133336scalede16363944946311300x175jpgadiva hrefhttpsunherdcom202111shouldweforcechinaintowarrefinnarspanmore from this authorspanaa hrefhttpsunherdcom202111shouldweforcechinaintowarrefinnarh5how america can save taiwanh5apa hrefhttpsunherdcom202111shouldweforcechinaintowarrefinnarspanbyspan aris roussinosapdivadiv
pspancivilians will always die in wars and moyn does observe that it is better on the whole that fewer die even if he is against wars in general and american wars in particular spanspanbut did unipolarity foist on america the moral obligation to intervene in distant wars for humanitarian ends slightly unsatisfyingly moyn evades answering this question but then it is perhaps an unresolvable one he observes that the initial humanitarian cause in libya morphed into an illegal regime change with deplorable consequences for that country spanspanyet the later intervention against isis improved the lives of many syrian and iraqi civilians even if it extinguished the lives of many others spanp
pspanbut at this point spanspanbalancingspanspan this difficult central dilemma may already be a historical question the 2015 russian intervention in syria marked the end of the unipolar moment by showing that a rival power by committing itself to a cause peripheral to the united statess core concerns can call the fading superpowers bluff and contrary to moyns assertion that we may be entering an era of total us global policing the rise of china has vastly accelerated the end of unchallenged unipolarityspanp
pspana war with china where the us may lose tens of thousands of personnel in the first day is a qualitatively different prospect from vaporising a defenceless presumed enemy at the push of a button and the biden administration does not seem in a hurry to enter into it americas spana relnoopener hrefhttpsenwikipediaorgwikiresponsibility_to_protect target_blankspanresponsibility to protectspana spanwas only ever a function of its capacity to do so now that capacity appears in doubt the question is already mootspanp
pspanwe are back to a world of wars of necessity for naked geopolitical advantage and not wars of choice driven by moral compulsion the results over the coming decades may yet answer moyns unanswered question of whether americas attempted humanisation of war was really so bad after allspanp
a hrefhttpsunherdcom202112theendofamericasmoralwarsappcommentsview 9 commentsa | pspanto war reporter past years worked shadow modern american way war libya decade ago reporting trip syria 2019 outcome wars followed arab spring decided presence absence american air powerspanp pspani owe life doubt american pilot ive met dropped bomb couple years ago isis fighters garden surrounded farmhouse rural deir ezzor spana relnoopener hrefhttpswwwyoutubecomwatchvbnqnx_xk0dq target_blankspanwhere sdf fighters huddledspanaspan waiting overrun modern wars bombs come hurtling sky rending air like bolt lightning land pinpoint accuracy transforming course battle instant like judgment angry invisible godspanp pspanover years battles northeastern syria watched air force rain death isis fighters wandered hours days later carnage ensued mangled bodies dozens grey cement dust black putrefaction hurled explosion manner strange inhuman shapesspanp divdiv pspanin raqqa years ago embedded arab fighters sdf called airstrikes isis militants level entire apartment blocks dislodge sniper year later followed local volunteers dragged shrivelled stinking bodies airstrike victims citys rubble isis wives local civilians identifiable detritus life suddenly cut short passport photos purses makeup bags soft toysspanp pspanthe devastation raqqa battle apartment blocks crushed pinpoint precision american military technology looked hardly total rebelheld eastern aleppo levelled wantonly imprecise barrel bombing syrian regime helicopters hovered unbearably city like flies dining table disgorging bombs random effect destroyed buildings spana relnoopener hrefhttpswwwnewyorkercommagazine20201221americaswaronsyriancivilians target_blankspanseemed samespanaspan surely morality approaches differentspanp diva hrefhttpsunherdcom202111whyiamfleeingtothehillsrefinnara hrefhttpsunherdcom202111whyiamfleeingtothehillsrefinnarimg srchttpsunherdcomwpcontentuploads2021112gettyimages921405462scaled1300x200jpgadiva hrefhttpsunherdcom202111whyiamfleeingtothehillsrefinnarspanmore authorspanaa hrefhttpsunherdcom202111whyiamfleeingtothehillsrefinnarh5why fleeing hillsh5apa hrefhttpsunherdcom202111whyiamfleeingtothehillsrefinnarspanbyspan aris roussinosapdivadiv pspanby emphasising precision making concerted effort avoid civilian casualties surely american way bombing act morally distinct indiscriminate punishment dealt syrian regime intentions good results evilspanp pspanit answer question yale legal scholar samuel moyn written new book spana relnoopener hrefhttpsusmacmillancombooks9780374173708humane target_blankispanhumanespaniaspan exploration wests effort conduct wars minimising harm unintended consequence creating world forever war takes cue speech tolstoy puts mouth character prince andrei spanispanwar peacespanispan russian aristocrat notes war kept brutal possible temptation waging great moyn notes humanitarianism led advocates compromise pursuit humane war publics feel good bargain permit result endless war way americans live nowspanp pspanrattling twin strands initially european effort impose humanitarian rules war parallel american effort abolish war altogether moyn assembles evidence thesis clinton era onwards mantra led united states endless mission bomb earth pursuit global harmony observes peoples annals warfare americans ones invented form war righteously pursued superior precisely humane tolerated audiences reasonspanp pspana noninterventionist strain dominant american politics slowly hegemonic worldview moyn critic process postwar american empire legitimated war humanitarian ends world war notesspan spanselfstyled internationalists insisted america commit globalised peace scheme emerge slowly option meant committing country global warspanp pspanvictory world war cold war stood moyn roads taken american leaders refused prospect global domination following vietnam war american military elites committed eliminating indiscriminate bombing targeted war crimes new discipline international humanitarian law fused fact americas sudden global preeminence create logic liberal interventionismspanp pspanas moyn notes decades following vietnam western popular memory recentred holocaust wars retrospective justification peripheral moral consciousness ethnic cleansing culminating genocide defining evil war past present coupled unchallenged american hegemony new holocaust memory coincided aftermath decolonisation skepticism challenge ruling result demand peace interventionist justicespanp pspanwith postwar taboo initiating wars obscured america morally entitled encouraged launch wars contravention international law long argued prevented genocides asked time implied war especially purged cruelty bad moyn realist scholars notionally distinct strands interventionist thought foreign policy neoconservatism liberal internationalism found closer followers liked admitspanp diva hrefhttpsunherdcom202111thisishowcivilisationscollapserefinnara hrefhttpsunherdcom202111thisishowcivilisationscollapserefinnarimg srchttpsunherdcomwpcontentuploads2021112gettyimages1172305331scalede1637162794528300x171jpgadiva hrefhttpsunherdcom202111thisishowcivilisationscollapserefinnarspanmore authorspanaa hrefhttpsunherdcom202111thisishowcivilisationscollapserefinnarh5this civilisations collapseh5apa hrefhttpsunherdcom202111thisishowcivilisationscollapserefinnarspanbyspan aris roussinosapdivadiv pspanfrom clinton era drive drift militarism matter legality wars involved advice scholars like john yoo famously provided legal cover bush administrations use torture captives war terror moyn traces humanitarian legal steps american empire committed endless global war obama administration committed america constant war process president elected peace platform permanent humane war president architect massive expansion drone strikes means avoid moral cloud torture instead simply assassinating perceived wrongdoers special forces operations groundspanp pspanmoyns central thesis wellintentioned humanisation war functioned spoonful sugar intended help medicine endless war push forever war driven liberal interventionist pressures activists human rights activists demanded humane war good guys willing offer neat argument surely incomplete onespanp pspanit primarily vast disparity power total absence risk american pilots drone operators allows wars rumble forever minimising harm foreign civilians american casualties higher civilian ones sooner end americas wars choice pinpoint accuracy missile sent chosen target mean fog war target chosen placespanp pspanthe recent extermination drone spana relnoopener hrefhttpswwwtheguardiancomworld2021nov04usafghanistanstrikekilledcivilianslegalpentagon target_blankspana blameless family central kabulspanaspan hit headlines happened capital happened countryside happened thousands times past decades doubtful know fundamentally high profile case people america cared thenspanp pspanas push moyn discerns liberal interventionist commentators drag american power distant wars cynical interpretation moral causes initiate american wars potential targets american foes clamour washington campaign saudi arabia bombing yemen example bahrain lethal suppression demonstrations turkey scorched earth suppression armed revolts kurdish east invasions northeastern syria azerbaijan aggression armenia beheading captives human rights oppressor ally advocates journalists tend case intervention ignoredspanp pspanultimately focus humanitisation war empire moyn america militarily incapable intervening tangled squabbles end world feel moral compulsion compulsion moral justification empire fundamentally product capacity act moral compulsion american war uighurs americas power launch win human rights abuses like xinjiang deployed diplomatic tool delegitimise china international sphere armsspanp diva hrefhttpsunherdcom202111shouldweforcechinaintowarrefinnara hrefhttpsunherdcom202111shouldweforcechinaintowarrefinnarimg srchttpsunherdcomwpcontentuploads202111gettyimages518133336scalede16363944946311300x175jpgadiva hrefhttpsunherdcom202111shouldweforcechinaintowarrefinnarspanmore authorspanaa hrefhttpsunherdcom202111shouldweforcechinaintowarrefinnarh5how america save taiwanh5apa hrefhttpsunherdcom202111shouldweforcechinaintowarrefinnarspanbyspan aris roussinosapdivadiv pspancivilians die wars moyn observe better fewer die wars general american wars particular spanspanbut unipolarity foist america moral obligation intervene distant wars humanitarian ends slightly unsatisfyingly moyn evades answering question unresolvable observes initial humanitarian cause libya morphed illegal regime change deplorable consequences country spanspanyet later intervention isis improved lives syrian iraqi civilians extinguished lives othersspanp pspanbut point spanspanbalancingspanspan difficult central dilemma historical question 2015 russian intervention syria marked end unipolar moment showing rival power committing cause peripheral united statess core concerns fading superpowers bluff contrary moyns assertion entering era total global policing rise china vastly accelerated end unchallenged unipolarityspanp pspana war china lose tens thousands personnel day qualitatively different prospect vaporising defenceless presumed enemy push button biden administration hurry enter americas spana relnoopener hrefhttpsenwikipediaorgwikiresponsibility_to_protect target_blankspanresponsibility protectspana spanwas function capacity capacity appears doubt question mootspanp pspanwe world wars necessity naked geopolitical advantage wars choice driven moral compulsion results coming decades answer moyns unanswered question americas attempted humanisation war bad allspanp hrefhttpsunherdcom202112theendofamericasmoralwarsappcommentsview 9 commentsa |
61a94be12ac52792067f2c72 | Andrew Mitchell’s friends in Rwanda | div
pearlier this year baroness kennedy was contacted by the two daughters of paul rusesabagina human rights campaigner winner of the us presidential medal of freedom and reallife hero of the film hotel rwanda the pair sought help with their fathers case he had been kidnapped and jailed by the regime of paul kagame the rwandan dictator infamous for his governments use of assassination imprisonment and smears to silence his criticsp
div
div
pafter investigating the charges of terrorism levelled against rusesabagina the labour peer and human rights lawyer concluded there were serious concerns over the rendition and the trial we expanded the commonwealth to include rwanda on grounds they would follow the rule of law and correct standards but the country has kidnapped a man in poor health who was illtreated in custody and denied a fair trial said kennedy who is also director of the international bar association human rights institutep
div
div
pher views are shared by other prominent human rights campaigners illegal rendition and false arrest are a travesty of justice that demand a response from the west said bill browder the financier who started pushing for worldwide imposition of magnitsky legislation to sanction despots killers and torturers after the murder of his lawyer in russia this law was meant for cases like this where a government goes so far beyond acceptable behaviourp
divdiv
div
div
pbrowder and kennedy hosted a meeting last week in parliament with carine and anaise kanimba to press for sanctions on the rwandan officials behind the illegal rendition and false imprisonment of their adoptive father kennedy however was contacted by former aid minister andrew mitchell whom she admires despite their party differences due to his usually robust stand on such issues who strongly objected to her stance i fear andrew has allowed his friendships to cloud his judgment she tells me i also celebrated the arrival of kagame after the genocide but he has not lived up to expectations it was the same with mugabe in zimbabwe unfortunately andrew seems to have locked in his hopesp
div
div
pmitchell has long been a strong and vocal supporter of the rwandan government indeed he even calls kagame a hero despite so much evidence of human rights abuses his crushing of democracy and disruptive meddling in neighbouring nations such is mitchells steadfast defence of the brutal central african regime that one colleague described him mockingly to me as their mp for kigali now as the government slides in polls over its handling of sleaze the veteran tory politician is facing uncomfortable questions after taking a lucrative consultancy from a bank run by close allies of kagamep
div
div
pmitchell is being paid 39600 a year by southbridge for just nine days advice on african matters this fee working out at an impressive 4400 a day is one of six consultancies that earn him 182600 annually more than double his salary as mp for sutton coldfield intriguingly the investment bank based in rwanda france and ivory coast is run by a former rwandan finance minister while the managing director of its operations in the countrys capital previously oversaw the ruling partys sprawling commercial interestsp
div
div
pdetails of mitchells starring role in what has been branded the tories secondjobs gravy train particularly alarms human rights activists because the 65yearold mp who lost his cabinet post after allegations he called a downing street police officer a pleb chairs the all party parliamentary group on rwanda im amazed he cant see how bad this looks said michela wrong author of ido not disturbi an expose of the rwandan regime mitchells always been kagames most dogged british defender never missing a chance to justify the regimes actsp
diva hrefhttpsunherdcom202110howbritainwascorruptedrefinnara hrefhttpsunherdcom202110howbritainwascorruptedrefinnarimg srchttpsunherdcomwpcontentuploads2021102gettyimages578152957scalede1633431015922300x160jpgadiva hrefhttpsunherdcom202110howbritainwascorruptedrefinnarspansuggested readingspanaa hrefhttpsunherdcom202110howbritainwascorruptedrefinnarh5the corruption of britainh5apa hrefhttpsunherdcom202110howbritainwascorruptedrefinnarspanbyspan ian birrellapdivadiv
div
div
pwrong like some rwandan dissidents is particularly disturbed by the apparent conflict of interest when mitchell heads the allparty group while taking money from an institution so close to this truly sinister regime the tory mp who took up the post in march last year has told friends there is no institutional link to the rwandan state but wrong argues that his financial ties to southbridge with two of kagames most trusted former financial aides at its helm undermines claims of independence before he could at least assure his critics no money had changed hands that he was speaking purely from passionate personal conviction no morep
div
div
psouthbridge has two managing partners donald kaberuka who was rwandas finance minister for eight years before becoming president of the african development bank and lionel zinsou a former prime minister of benin based in paris kaberuka was a core member of the rwandan patriotic front rpf which took power after the genocide in 1994 when an estimated 800000 people were slaughtered and has since run the country he remained close to the rwandan dictator as a member of the presidential advisory panelp
div
div
pduring kaberukas time as finance minister the united nations accused rwanda of looting the democratic republic of congos vast mineral wealth to fund its armed forces after kagame sparked two wars that left millions dead rwandan troops were accused of slaughtering fleeing refugees among other atrocities one unusuallydamning un report said revenues from the systematic extraction of gold and diamonds by rwanda directly influence national decisionmaking and were hidden from the scrutiny of international organisations another un inquiry identified 617 separate incidents of war crimes committed by 21 rebel groups and eight foreign armies in the maelstrom of horrorp
div
div
psouthbridges managing director in kigali is john birungi former chief executive of a key rpfrun conglomerate with wide interests stretching from property to security it has been accused in the past of trading in conflict minerals while also leasing jets for kagame despite the impoverished nations dependence on foreign aid including about 900m from britain since kagame took control of this nation of 13m peoplep
diva hrefhttpsunherdcom202109isthisproofofalableakcoveruprefinnara hrefhttpsunherdcom202109isthisproofofalableakcoveruprefinnarimg srchttpsunherdcomwpcontentuploads202109gettyimages12309099121scalede16312069928901300x169jpgadiva hrefhttpsunherdcom202109isthisproofofalableakcoveruprefinnarspansuggested readingspanaa hrefhttpsunherdcom202109isthisproofofalableakcoveruprefinnarh5is this proof of lab leak liesh5apa hrefhttpsunherdcom202109isthisproofofalableakcoveruprefinnarspanbyspan ian birrellapdivadiv
div
div
pthe bank lists three offices on its website in abidjan paris and kigali curiously the telephone numbers given for abidjan and paris did not function when i called them while the line in rwanda went unanswered on several attempts the address given for the paris office turned out to be a fourstory building in an upmarket district near the arc de triomphe there were no signs on display for southbridge ive never heard of it being a bank said a neighbour there are flats at the top but im not aware of any offices or businesses insidep
div
div
pthe ivory coast office is in a threestorey building that looks empty on the top two storeys with a rental sign outside three nonsecurity staff were visible on the ground floor during a recent visit the office manager declined to discuss staff numbers but said they had also a paris officep
div
div
pmitchells support for rwanda dismays those fighting for democracy and the families of citizens falling foul of the regime david himbara kagames former economic adviser and now a prominent dissident describes mitchell as indifferent to the regimes atrocities and one of its diehard supporters another exile who has met him told me they were disgusted to hear mitchell echo regime propaganda even lecturing them on the need for stability in their own nation i felt so insulted like he was saying we were all animals who would devour each otherp
div
div
phis enthusiasm for this despotic regime has led mitchell into previous controversy on the mps last day as aid minister in 2012 he restored funding for rwanda after it had been suspended for supporting militia in congo engaged in mass murder rape and forcing almost half a million people from their homes the move was condemned by mps and overturned briefly by his successor although the uk remains a backer of kagame who is even hosting the next commonwealth summitp
div
div
pmitchell has registered his interests as required these show he also took a threeday trip in 2019 to visit rwandas army academy funded by its ministry of defence valued at 5092 for flights and hotels despite evidence that the military has been heavily involved in atrocities and the looting of neighbouring democratic republic of congo the mp says he spoke on human rights to senior military officers from across africa at a conferencep
pmitchell is also friends with emmanuel ndahiro the rwandan presidents former doctor and intelligence chief whose phone number was linked in court to an attempted assassination in south africa earlier this year freedom house the us human rights group cited rwanda alongside china russia saudi arabia iran and turkey as one of the worlds most prolific practitioners of transnational repression ndahiro was also named in the panama papers as onetime director of an offshore firm reported to own a private jetp
diva hrefhttpsunherdcom202105islabourdeadrefinnara hrefhttpsunherdcom202105islabourdeadrefinnarimg srchttpsunherdcomwpcontentuploads202105gettyimages1311928710300x169jpgadiva hrefhttpsunherdcom202105islabourdeadrefinnarspansuggested readingspanaa hrefhttpsunherdcom202105islabourdeadrefinnarh5is labour deadh5apa hrefhttpsunherdcom202105islabourdeadrefinnarspanbyspan ian birrellapdivadiv
div
div
psouthbridge meanwhile said it was a respected panafrican investment bank that operated in several countries on the continent we make sure that we are in compliance with all applicable legislation and regulations including rules that may concern our trusted external advisors said caroline ndirangu director of finance and administrationp
div
div
pmitchell insists his lucrative southbridge consultancy is not linked to his position on rwanda saying it involved a new and highlyrespected panafrican bank chaired by a distinguished former president of the african development bank although he declined to comment on commercially confidential matters he added that he was happy to give one example we advise on debt risk and how to minimise it my input is drawn from my experience as a former director of an insurance company and many years in investment banking as well as my knowledge of africap
div
div
pi have long disagreed with mitchell on aid yet respected his intentions and ideals despite our differences he says his support for rwandans is heartfelt and genuine although others would argue that there is a world of difference between supporting kagame and supporting the citizens of this blighted country regardless to take money from an institution run by people so close to a cruel dictator at the very least looks bad especially as he becomes an increasingly lonely voice defending this loathsome regimep
div
a hrefhttpsunherdcom202112andrewmitchellsfriendsinrwandaappcommentsview 1 commentsa | div pearlier year baroness kennedy contacted daughters paul rusesabagina human rights campaigner winner presidential medal freedom reallife hero film hotel rwanda pair sought help fathers case kidnapped jailed regime paul kagame rwandan dictator infamous governments use assassination imprisonment smears silence criticsp div div pafter investigating charges terrorism levelled rusesabagina labour peer human rights lawyer concluded concerns rendition trial expanded commonwealth include rwanda grounds follow rule law correct standards country kidnapped man poor health illtreated custody denied fair trial said kennedy director international bar association human rights institutep div div pher views shared prominent human rights campaigners illegal rendition false arrest travesty justice demand response west said bill browder financier started pushing worldwide imposition magnitsky legislation sanction despots killers torturers murder lawyer russia law meant cases like government goes far acceptable behaviourp divdiv div div pbrowder kennedy hosted meeting week parliament carine anaise kanimba press sanctions rwandan officials illegal rendition false imprisonment adoptive father kennedy contacted aid minister andrew mitchell admires despite party differences usually robust stand issues strongly objected stance fear andrew allowed friendships cloud judgment tells celebrated arrival kagame genocide lived expectations mugabe zimbabwe unfortunately andrew locked hopesp div div pmitchell long strong vocal supporter rwandan government calls kagame hero despite evidence human rights abuses crushing democracy disruptive meddling neighbouring nations mitchells steadfast defence brutal central african regime colleague described mockingly mp kigali government slides polls handling sleaze veteran tory politician facing uncomfortable questions taking lucrative consultancy bank run close allies kagamep div div pmitchell paid 39600 year southbridge days advice african matters fee working impressive 4400 day consultancies earn 182600 annually double salary mp sutton coldfieldintriguingly investment bank based rwanda france ivory coast run rwandan finance minister managing director operations countrys capital previously oversaw ruling partys sprawling commercial interestsp div div pdetails mitchells starring role branded tories secondjobs gravy train particularly alarms human rights activists 65yearold mp lost cabinet post allegations called downing street police officer pleb chairs party parliamentary group rwanda im amazed cant bad looks said michela wrong author ofido disturbi expose rwandan regime mitchells kagames dogged british defender missing chance justify regimes actsp diva hrefhttpsunherdcom202110howbritainwascorruptedrefinnara hrefhttpsunherdcom202110howbritainwascorruptedrefinnarimg srchttpsunherdcomwpcontentuploads2021102gettyimages578152957scalede1633431015922300x160jpgadiva hrefhttpsunherdcom202110howbritainwascorruptedrefinnarspansuggested readingspanaa hrefhttpsunherdcom202110howbritainwascorruptedrefinnarh5the corruption britainh5apa hrefhttpsunherdcom202110howbritainwascorruptedrefinnarspanbyspan ian birrellapdivadiv div div pwrong like rwandan dissidents particularly disturbed apparent conflict interest mitchell heads allparty group taking money institution close truly sinister regimethe tory mp took post march year told friends institutional link rwandan state wrong argues financial ties southbridge kagames trusted financial aides helm undermines claims independence assure critics money changed hands speaking purely passionate personal conviction morep div div psouthbridge managing partners donald kaberuka rwandas finance minister years president african development bank lionel zinsou prime minister benin based pariskaberuka core member rwandan patriotic rpf took power genocide 1994 estimated 800000 people slaughtered run country remained close rwandan dictator member presidential advisory panelp div div pduring kaberukas time finance minister united nations accused rwanda looting democratic republic congos vast mineral wealth fund armed forces kagame sparked wars left millions dead rwandan troops accused slaughtering fleeing refugees atrocitiesone unusuallydamning un report said revenues systematic extraction gold diamonds rwanda directly influence national decisionmaking hidden scrutiny international organisations un inquiry identified 617 separate incidents war crimes committed 21 rebel groups foreign armies maelstrom horrorp div div psouthbridges managing director kigali john birungi chief executive key rpfrun conglomerate wide interests stretching property security accused past trading conflict minerals leasing jets kagame despite impoverished nations dependence foreign aid including 900m britain kagame took control nation 13m peoplep diva hrefhttpsunherdcom202109isthisproofofalableakcoveruprefinnara hrefhttpsunherdcom202109isthisproofofalableakcoveruprefinnarimg srchttpsunherdcomwpcontentuploads202109gettyimages12309099121scalede16312069928901300x169jpgadiva hrefhttpsunherdcom202109isthisproofofalableakcoveruprefinnarspansuggested readingspanaa hrefhttpsunherdcom202109isthisproofofalableakcoveruprefinnarh5is proof lab leak liesh5apa hrefhttpsunherdcom202109isthisproofofalableakcoveruprefinnarspanbyspan ian birrellapdivadiv div div pthe bank lists offices website abidjan paris kigali curiously telephone numbers given abidjan paris function called line rwanda went unanswered attempts address given paris office turned fourstory building upmarket district near arc de triomphe signs display southbridge ive heard bank said neighbour flats im aware offices businesses insidep div div pthe ivory coast office threestorey building looks storeys rental sign outside nonsecurity staff visible ground floor recent visit office manager declined discuss staff numbers said paris officep div div pmitchells support rwanda dismays fighting democracy families citizens falling foul regime david himbara kagames economic adviser prominent dissident describes mitchell indifferent regimes atrocities diehard supporters exile met told disgusted hear mitchell echo regime propaganda lecturing need stability nation felt insulted like saying animals devour otherp div div phis enthusiasm despotic regime led mitchell previous controversy mps day aid minister 2012 restored funding rwanda suspended supporting militia congo engaged mass murder rape forcing half million people homes condemned mps overturned briefly successor uk remains backer kagame hosting commonwealth summitp div div pmitchell registered interests required took threeday trip 2019 visit rwandas army academy funded ministry defence valued 5092 flights hotels despite evidence military heavily involved atrocities looting neighbouring democratic republic congo mp says spoke human rights senior military officers africa conferencep pmitchell friends emmanuel ndahiro rwandan presidents doctor intelligence chief phone number linked court attempted assassination south africa earlier year freedom house human rights group cited rwanda alongside china russia saudi arabia iran turkey worlds prolific practitioners transnational repression ndahiro named panama papers onetime director offshore firm reported private jetp diva hrefhttpsunherdcom202105islabourdeadrefinnara hrefhttpsunherdcom202105islabourdeadrefinnarimg srchttpsunherdcomwpcontentuploads202105gettyimages1311928710300x169jpgadiva hrefhttpsunherdcom202105islabourdeadrefinnarspansuggested readingspanaa hrefhttpsunherdcom202105islabourdeadrefinnarh5is labour deadh5apa hrefhttpsunherdcom202105islabourdeadrefinnarspanbyspan ian birrellapdivadiv div div psouthbridge said respected panafrican investment bank operated countries continentwe sure compliance applicable legislation regulations including rules concern trusted external advisors said caroline ndirangu director finance administrationp div div pmitchell insists lucrative southbridge consultancy linked position rwanda saying involved new highlyrespected panafrican bank chaired distinguished president african development bank declined comment commercially confidential matters added happy example advise debt risk minimise input drawn experience director insurance company years investment banking knowledge africap div div pi long disagreed mitchell aid respected intentions ideals despite differences says support rwandans heartfelt genuine argue world difference supporting kagame supporting citizens blighted country regardless money institution run people close cruel dictator looks bad especially increasingly lonely voice defending loathsome regimep div hrefhttpsunherdcom202112andrewmitchellsfriendsinrwandaappcommentsview 1 commentsa |
61aa9ab9fed1d723bfb90cdc | Bari Weiss interviews me (pre-Omicron) | phere is a relnoopener hrefhttpstwittercomthehonestlypodstatus1466882127534956548 target_blankthe linka enjoyp
pthe post a relnofollow hrefhttpmarginalrevolutioncommarginalrevolution202112bariweissinterviewsmepreomicronhtmlbari weiss interviews me preomicrona appeared first on a relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap | phere relnoopener hrefhttpstwittercomthehonestlypodstatus1466882127534956548 target_blankthe linka enjoyp pthe post relnofollow hrefhttpmarginalrevolutioncommarginalrevolution202112bariweissinterviewsmepreomicronhtmlbari weiss interviews preomicrona appeared relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap |
61aa9abefed1d723bfb90cde | School Districts Are Using Their COVID-19 Relief Money on Vape Detectors, Tennis Courts | div
picture
source sizesminwidth 600px 331px 100vw typeimagewebp srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202112neonbrandzfso6bnzjtwunsplash12400x1350jpgwebp 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202112neonbrandzfso6bnzjtwunsplash11200x675jpgwebp 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202112neonbrandzfso6bnzjtwunsplash1800x450jpgwebp 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202112neonbrandzfso6bnzjtwunsplash1600x338jpgwebp 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202112neonbrandzfso6bnzjtwunsplash1331x186jpgwebp 331w
source sizesminwidth 600px 331px 100vw typeimagejpeg srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202112neonbrandzfso6bnzjtwunsplash12400x1350jpg 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202112neonbrandzfso6bnzjtwunsplash11200x675jpg 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202112neonbrandzfso6bnzjtwunsplash1800x450jpg 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202112neonbrandzfso6bnzjtwunsplash1600x338jpg 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202112neonbrandzfso6bnzjtwunsplash1331x186jpg 331w
img width1200 altneonbrandzfso6bnzjtwunsplash 1 srchttpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202112neonbrandzfso6bnzjtwunsplash1800x450jpg height675
picture
div
pearlier this year schools around the country received more than a hundred billion dollars from the federal governmentamerican taxpayers in truthin order to recover from the pandemic and finally get back to the task of teaching kidsp
pthe feds stipulated that 20 percent of that money be put toward addressing learning losses during the pandemic but the bulk of it can be spent at schools discretion which means of course that many schools are using this sudden injection of cash to make improvements that have nothing to do with keeping covid19 at bayp
pquotsome districts are investing big money in initiatives that dont appear at first glance strictly covidrelatedquot a hrefhttpswwwedweekorgpolicypoliticsschooldistrictsarestartingtospendcovidrelieffundsthehardpartisdecidinghow202112notesa emeducation weekem quotmiamidade schools plan to spend 30 million or 86 per student on cybersecurity raleigh county schools in west virginia lists a a relnoopener hrefhttpsp18cdn4staticsharpschoolcomuserfilesserversserver_23766376filehome20pagercs20public20announcementpdf target_blank9 million effortamore than 800 per studentto expand an elementary school adding nine classrooms upgrading the library expanding the kitchen and separating the cafeteria and the gym the newport news school district in virginia is a relnoopener hrefhttpsbonnk12vausbudgetarpesserplanpdf target_blankspending 840000a for a new student information system to help teachers catalog students academic progressquotp
pan unnamed school district will use some of its covid19 relief funds to install vape detection devices purchase new student id cards and build a tennis courtp
pindeed many districts seem to be spending significant chunks of money on upgrading athletic facilities and expanding stadiums according to emeducation weekem athletics can be an important part of many students lives and letting kids get back to sports was a good reason among many to move away from the soulcrushing farce of virtual learning and get everybody back in school but a slightly nicer football field probably isnt going to improve students test scores or make them safer from covid19 which after all are the two primary justifications for all the spendingp
pin october emreasonems brian doherty a hrefhttpsreasoncom20211022whatdidpublicschoolsdowithcovidreliefmoneywhatevertheywantednoteda a terrific report from a hrefhttpswwwpropublicaorgarticlethefederalgovernmentgavebillionstoamericasschoolsforcovid19reliefwheredidthemoneygopropublicaa that detailed one texas school districts plan quotto spend 4 million of its education pandemic relief funds to construct a 5acre outdoor learning environment connected to a local nature and birding center owned by the cityquot the project is not expected to be completed until 2024 at which point it will no longer be necessaryhopefullyto hold classes outdoorsp
pthe american public education systems grand reopening which largely took place this fall a hrefhttpswwwtheatlanticcomideasarchive202112weopenedschoolsanditwasfine620824has not produced severe outbreaks of covid19 in schoolsa given this it might actually make some sense for schools to spend the money on things that dont involve pandemic mitigation of course if they spend the money on personnel they could eventually end up with a shortfall once the pile runs out districts certainly wont want to lower salaries or fire staff once that happensp
pin any event the decision on how to spend the money rests with state and local officials the federal government has asked states to pay attention to where the money is going but theres little incentive for districts to report responsibly in north carolina several colleges with fewer students received significantly more money than other colleges that enroll more students a hrefhttpswwwwralcomsmallschoolsseewindfallfromcovidreliefmoney20014108wrala a local station asked dozens of the schools to explain how they planned to spend the money not a single one repliedp
pthe post a relnofollow hrefhttpsreasoncom20211203schooldistrictscovidreliefmoneyvapedetectorsschool districts are using their covid19 relief money on vape detectors tennis courtsa appeared first on a relnofollow hrefhttpsreasoncomreasoncomap | div picture source sizesminwidth 600px 331px 100vw typeimagewebp srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202112neonbrandzfso6bnzjtwunsplash12400x1350jpgwebp 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202112neonbrandzfso6bnzjtwunsplash11200x675jpgwebp 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202112neonbrandzfso6bnzjtwunsplash1800x450jpgwebp 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202112neonbrandzfso6bnzjtwunsplash1600x338jpgwebp 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202112neonbrandzfso6bnzjtwunsplash1331x186jpgwebp 331w source sizesminwidth 600px 331px 100vw typeimagejpeg srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202112neonbrandzfso6bnzjtwunsplash12400x1350jpg 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202112neonbrandzfso6bnzjtwunsplash11200x675jpg 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202112neonbrandzfso6bnzjtwunsplash1800x450jpg 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202112neonbrandzfso6bnzjtwunsplash1600x338jpg 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202112neonbrandzfso6bnzjtwunsplash1331x186jpg 331w img width1200 altneonbrandzfso6bnzjtwunsplash 1 srchttpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202112neonbrandzfso6bnzjtwunsplash1800x450jpg height675 picture div pearlier year schools country received billion dollars federal governmentamerican taxpayers truthin order recover pandemic finally task teaching kidsp pthe feds stipulated 20 percent money addressing learning losses pandemic bulk spent schools discretion means course schools sudden injection cash improvements keeping covid19 bayp pquotsome districts investing big money initiatives dont appear glance strictly covidrelatedquot hrefhttpswwwedweekorgpolicypoliticsschooldistrictsarestartingtospendcovidrelieffundsthehardpartisdecidinghow202112notesaemeducation weekem quotmiamidade schools plan spend 30 million 86 student cybersecurity raleigh county schools west virginia lists relnoopener hrefhttpsp18cdn4staticsharpschoolcomuserfilesserversserver_23766376filehome20pagercs20public20announcementpdf target_blank9 million effortamore 800 studentto expand elementary school adding classrooms upgrading library expanding kitchen separating cafeteria gym newport news school district virginia isa relnoopener hrefhttpsbonnk12vausbudgetarpesserplanpdf target_blankspending 840000a new student information system help teachers catalog students academic progressquotp pan unnamed school district use covid19 relief funds install vape detection devices purchase new student id cards build tennis courtp pindeed districts spending significant chunks money upgrading athletic facilities expanding stadiums according toemeducation weekem athletics important students lives letting kids sports good reason away soulcrushing farce virtual learning everybody school slightly nicer football field probably isnt going improve students test scores safer covid19 primary justifications spendingp pin octoberemreasonems brian doherty hrefhttpsreasoncom20211022whatdidpublicschoolsdowithcovidreliefmoneywhatevertheywantednoteda terrific report froma hrefhttpswwwpropublicaorgarticlethefederalgovernmentgavebillionstoamericasschoolsforcovid19reliefwheredidthemoneygopropublicaa detailed texas school districts plan quotto spend 4 million education pandemic relief funds construct 5acre outdoor learning environment connected local nature birding center owned cityquot project expected completed 2024 point longer necessaryhopefullyto hold classes outdoorsp pthe american public education systems grand reopening largely took place fall hrefhttpswwwtheatlanticcomideasarchive202112weopenedschoolsanditwasfine620824has produced severe outbreaks covid19 schoolsa given actually sense schools spend money things dont involve pandemic mitigation course spend money personnel eventually end shortfall pile runs districts certainly wont want lower salaries fire staff happensp pin event decision spend money rests state local officials federal government asked states pay attention money going theres little incentive districts report responsibly north carolina colleges fewer students received significantly money colleges enroll students hrefhttpswwwwralcomsmallschoolsseewindfallfromcovidreliefmoney20014108wrala local station asked dozens schools explain planned spend money single repliedp pthe post relnofollow hrefhttpsreasoncom20211203schooldistrictscovidreliefmoneyvapedetectorsschool districts covid19 relief money vape detectors tennis courtsa appeared relnofollow hrefhttpsreasoncomreasoncomap |
61aa9b03fed1d723bfb90ce2 | Claims I can’t quite bring myself to believe | pit doesnt seem this is a partisan issue but could this possibly be fake news it does not fit with my underlying model of the world not even for british peoplep
blockquote
pa leading music teacher has said the popularity of the ukulele is threatening classical guitar playingp
pmore than one in ten musical schoolchildren now play the ukulele the largest proportion ever a study by the music exam board abrsm found it said the instruments popularity grew from 1 per cent of school music students in 1997 to 15 per cent last yearp
pthe ukulele was cited as a cause of the a hrefhttpswwwthetimescoukarticleukuleleouststherecorderasschoolschangetheirtunemakingmusic2021reportfindstgp5h9q8pdecline of the recordera in schools but a hrefhttpswwwthetimescoukarticletimeslettersmigrantquotasandcooperationwithfrancelmxgwtj39in a lettera to ithe timesi graham wade former head of guitar teaching at leeds college of music said the popularity of the fourstringedspan ukulele was threatening its sixstringed unclespanp
pthe ukulele is more likely to oust the guitar whether classical or otherwise from early instrumental tuition than the recorder he said i have been a classical guitar teacher in schools and colleges for 50 years and the subtext of your headline is the demise of a worthy musical traditionp
blockquote
pthere is perhaps more sanity on this side of the oceanp
blockquotepspanthe latest data from america suggests that demand has fallen with sales of ukuleles declining 15 per cent between 2018 and 2020 although the lockdown provided a boost to salesspanpblockquote
phere is a relnoopener hrefhttpswwwthetimescoukarticle5ae0ba42516011ec8d72b8ab431649b1sharetoken65666f4c68c349446752a9402cd616df target_blankmore from the times of londonap
pthe post a relnofollow hrefhttpmarginalrevolutioncommarginalrevolution202112claimsicantquitebringmyselftobelievehtmlclaims i cant quite bring myself to believea appeared first on a relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap | pit doesnt partisan issue possibly fake news fit underlying model world british peoplep blockquote pa leading music teacher said popularity ukulele threatening classical guitar playingp pmore musical schoolchildren play ukulele largest proportion study music exam board abrsm found said instruments popularity grew 1 cent school music students 1997 15 cent yearp pthe ukulele cited cause hrefhttpswwwthetimescoukarticleukuleleouststherecorderasschoolschangetheirtunemakingmusic2021reportfindstgp5h9q8pdecline recordera schools hrefhttpswwwthetimescoukarticletimeslettersmigrantquotasandcooperationwithfrancelmxgwtj39in lettera ithe timesi graham wade head guitar teaching leeds college music said popularity fourstringedspan ukulele threatening sixstringed unclespanp pthe ukulele likely oust guitar classical early instrumental tuition recorder said classical guitar teacher schools colleges 50 years subtext headline demise worthy musical traditionp blockquote pthere sanity oceanp blockquotepspanthe latest data america suggests demand fallen sales ukuleles declining 15 cent 2018 2020 lockdown provided boost salesspanpblockquote phere relnoopener hrefhttpswwwthetimescoukarticle5ae0ba42516011ec8d72b8ab431649b1sharetoken65666f4c68c349446752a9402cd616df target_blankmore times londonap pthe post relnofollow hrefhttpmarginalrevolutioncommarginalrevolution202112claimsicantquitebringmyselftobelievehtmlclaims cant bring believea appeared relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap |
61aa9b43fed1d723bfb90ce6 | Marginalized Workers Facing Labor Market Discrimination See Largest Jobs Gains | a hrefhttpstruthoutorgarticlesmarginalizedworkersfacinglabormarketdiscriminationseelargestjobsgainsimg sizesmaxwidth 200px 100vw 200px srchttpstruthoutorgwpcontentuploads2021122021_1203nowhiring200x131jpg width200 alta pedestrian walks by a quotnow hiringquot sign outside a store on august 16 2021 in arlington virginia srcsethttpstruthoutorgwpcontentuploads2021122021_1203nowhiring200x131jpg 200w httpstruthoutorgwpcontentuploads2021122021_1203nowhiring400x263jpg 400w httpstruthoutorgwpcontentuploads2021122021_1203nowhiring1200x789jpg 1200w httpstruthoutorgwpcontentuploads2021122021_1203nowhiring800x526jpg 800w httpstruthoutorgwpcontentuploads2021122021_1203nowhiring1536x1010jpg 1536w httpstruthoutorgwpcontentuploads2021122021_1203nowhiring2048x1346jpg 2048w httpstruthoutorgwpcontentuploads2021122021_1203nowhiring2400x1578jpg 2400w classwppostimage height131apthe unemployment rate fell 04 percentage points in november even though the economy added just 210000 jobs the drop in the unemployment rate went along with an increase in the employmenttopopulation ratio epop of 04 percentage points corresponding to a rise in employment of more than 11 million in the household survey the unemployment rate had not fallen this low following the great recession until september 2017p
pthe 210000 job growth in the establishment survey is slower than generally expected but it is important to note that it went along with an increase in the average workweek the index of aggregate hours in the private sector increased by 05 percent in november this would be the equivalent of more than 630000 new jobs with no change in the workweekp
pthis fits a story where employers are increasing hours since they are unable to hire new workers we are seeing a reshuffling of the labor market where workers are looking for better jobs and employers are competing to attract workers especially in lower paying sectorsp
h2bdeclines in unemployment largest for disadvantaged groupsbh2
pnearly every demographic group saw a drop in unemployment in november but the falls were largest for the groups that face labor market discrimination the unemployment rate for blacks fell by 12 percentage points to 67 percent a level not reached following the great recession until march 2018 and never prior to that time for hispanics the decline was 07 percentage points to 52 percentp
pthe unemployment rate for workers without a high school degree fell by 17 percentage points to 57 percent by contrast the unemployment rate for college grads fell by just 01 percentage points to 23 percent 04 percentage points above its prepandemic low the 57 percent rate for workers without a high school degree is 07 percentage points above the prepandemic low although the monthly data are highly erraticp
pthe unemployment rate for people with a disability fell by 14 percentage points to 77 percent while the epop rose by 11 percentage points to 215 percent the latter figure is almost 20 percentage points above prepandemic peaks indicating that the pandemic may have created new opportunities for people with a disabilityp
h2bshare of longterm unemployment edges upbh2
pthe share of workers reporting they have been unemployed more than 26 weeks edged up slightly to 321 percent it had been falling rapidly from a peak of 434 percent in march it was under 200 percent before the pandemic hit on the plus side the share of unemployment due to voluntary quits increased by 10 percentage points to 125 percent this share is still low for a 42 percent unemployment rate but the high share of longterm unemployed depresses the share attributable to quitsp
h2bwage growth still strong for lower paid workersbh2
pthe average hourly pay of production workers is up 59 percent yearoveryear it has risen at a 66 percent annual rate comparing the last three months september to november with the prior three months june to august for restaurant workers the gains have been even larger with the average hourly wage for production workers up 134 percent yearoveryear although the annual rate of growth slowed to 57 percent comparing the last three months with prior three months wages for the lowest paid workers are far outpacing inflationp
divdiv classfeedlynoscripta hrefhttpswwwceprnetimg alt srchttpspublictableaucomstaticimagesgrgrowthinrealhourlywagesproductionandnonsupervisoryworkersgraph1_rsspngadivdiv
pp
h2bmanufacturing and construction both add 31000 jobs in novemberbh2
pthis continues a pattern of strong job growth in these sectors employment in construction is now down 15 percent from prepandemic levels while manufacturing employment is down 20 percentp
h2b datastringifytypeboldemployment lagging in hardhit sectorsbh2
pby contrast employment is still lagging in the hardest hit sectors the motion picture industry shed 3400 jobs in november it is now down 219 percent from prepandemic levelp
plowwage sectors are clearly having trouble attracting workers nursing and residential care facilities shed 11000 jobs in november employment is now down 423700 jobs 125 percent from prerecession level accounting for most of the drop in health care employment childcare lost 2100 in november while home health care lost 300 jobsp
pretail lost 20400 jobs in november employment in the sector is now down 11 percent from prepandemic levels although the index of aggregate hours is up 11 percentp
prestaurants added just 11000 workers while hotels added 6600 however the index of aggregate hours for the leisure and hospitality sector which comprises the two industries rose 06 percent this corresponds to a gain of almost 800000 jobs with no change in the length of the workweekp
h2bstate and local governments shed another 27000 jobsbh2
pstate and local government employment is now down 951000 or 48 percent from prepandemic levels this is almost certainly a supply side story where these governments cannot easily raise pay to compete with the private sector in attracting workersp
h2boverwhelmingly positive reportbh2
pthis is another overwhelmingly positive report the unemployment rate is more than a full percentage point lower than what cbo had projected before the passage of the american recovery plan the most disadvantaged workers are seeing the greatest benefits in pay and employment opportunities the economy looks to be very strong as long as another surge in the pandemic doesnt derail itp | hrefhttpstruthoutorgarticlesmarginalizedworkersfacinglabormarketdiscriminationseelargestjobsgainsimg sizesmaxwidth 200px 100vw 200px srchttpstruthoutorgwpcontentuploads2021122021_1203nowhiring200x131jpg width200 alta pedestrian walks quotnow hiringquot sign outside store august 16 2021 arlington virginia srcsethttpstruthoutorgwpcontentuploads2021122021_1203nowhiring200x131jpg 200w httpstruthoutorgwpcontentuploads2021122021_1203nowhiring400x263jpg 400w httpstruthoutorgwpcontentuploads2021122021_1203nowhiring1200x789jpg 1200w httpstruthoutorgwpcontentuploads2021122021_1203nowhiring800x526jpg 800w httpstruthoutorgwpcontentuploads2021122021_1203nowhiring1536x1010jpg 1536w httpstruthoutorgwpcontentuploads2021122021_1203nowhiring2048x1346jpg 2048w httpstruthoutorgwpcontentuploads2021122021_1203nowhiring2400x1578jpg 2400w classwppostimage height131apthe unemployment rate fell 04 percentage points november economy added 210000 jobs drop unemployment rate went increase employmenttopopulation ratio epop 04 percentage points corresponding rise employment 11 million household survey unemployment rate fallen low following great recession september 2017p pthe 210000 job growth establishment survey slower generally expected important note went increase average workweek index aggregate hours private sector increased 05 percent november equivalent 630000 new jobs change workweekp pthis fits story employers increasing hours unable hire new workers seeing reshuffling labor market workers looking better jobs employers competing attract workers especially lower paying sectorsp h2bdeclines unemployment largest disadvantaged groupsbh2 pnearly demographic group saw drop unemployment november falls largest groups face labor market discrimination unemployment rate blacks fell 12 percentage points 67 percent level reached following great recession march 2018 prior time hispanics decline 07 percentage points 52 percentp pthe unemployment rate workers high school degree fell 17 percentage points 57 percent contrast unemployment rate college grads fell 01 percentage points 23 percent 04 percentage points prepandemic low 57 percent rate workers high school degree 07 percentage points prepandemic low monthly data highly erraticp pthe unemployment rate people disability fell 14 percentage points 77 percent epop rose 11 percentage points 215 percent figure 20 percentage points prepandemic peaks indicating pandemic created new opportunities people disabilityp h2bshare longterm unemployment edges upbh2 pthe share workers reporting unemployed 26 weeks edged slightly 321 percent falling rapidly peak 434 percent march 200 percent pandemic hit plus share unemployment voluntary quits increased 10 percentage points 125 percent share low 42 percent unemployment rate high share longterm unemployed depresses share attributable quitsp h2bwage growth strong lower paid workersbh2 pthe average hourly pay production workers 59 percent yearoveryear risen 66 percent annual rate comparing months september november prior months june august restaurant workers gains larger average hourly wage production workers 134 percent yearoveryear annual rate growth slowed 57 percent comparing months prior months wages lowest paid workers far outpacing inflationp divdiv classfeedlynoscripta hrefhttpswwwceprnetimg alt srchttpspublictableaucomstaticimagesgrgrowthinrealhourlywagesproductionandnonsupervisoryworkersgraph1_rsspngadivdiv pp h2bmanufacturing construction add 31000 jobs novemberbh2 pthis continues pattern strong job growth sectors employment construction 15 percent prepandemic levels manufacturing employment 20 percentp h2b datastringifytypeboldemployment lagging hardhit sectorsbh2 pby contrast employment lagging hardest hit sectors motion picture industry shed 3400 jobs november 219 percent prepandemic levelp plowwage sectors clearly having trouble attracting workers nursing residential care facilities shed 11000 jobs november employment 423700 jobs 125 percent prerecession level accounting drop health care employment childcare lost 2100 november home health care lost 300 jobsp pretail lost 20400 jobs november employment sector 11 percent prepandemic levels index aggregate hours 11 percentp prestaurants added 11000 workers hotels added 6600 index aggregate hours leisure hospitality sector comprises industries rose 06 percent corresponds gain 800000 jobs change length workweekp h2bstate local governments shed 27000 jobsbh2 pstate local government employment 951000 48 percent prepandemic levels certainly supply story governments easily raise pay compete private sector attracting workersp h2boverwhelmingly positive reportbh2 pthis overwhelmingly positive report unemployment rate percentage point lower cbo projected passage american recovery plan disadvantaged workers seeing greatest benefits pay employment opportunities economy looks strong long surge pandemic doesnt derail itp |
61aa9bf3fed1d723bfb90cfe | 110 Days After the Fall of Kabul | hraudio controls
source srchttpschrtfmtrackgg6ba9trafficlibsyncomsecurewisdomofcrowdswocomarandjen_mixdown_track_4__3mp3
img alt110 days after the fall of kabul srchttpswisdomofcrowdslivecontentimages202112brokenbridgejpegpyour browser doesnt support html audio a hrefhttpschrtfmtrackgg6ba9trafficlibsyncomsecurewisdomofcrowdswocomarandjen_mixdown_track_4__3mp3herea is a link to the filep
audiopwhat was it like to live through the fall of kabul how should we think about the american withdrawal from afghanistan and with famine enveloping the country amid an unprecedentedly severe state collapse how should we approachand deal withthe ruling taliban authorities ppthis week we are joined by dr jennifer brick murtazashvili and dr omar sadr both of the newlylaunched afghanistan project at the university of pittsburghs center for governance and markets to talk about what lies ahead for the longsuffering afghan peoplepp a hrefhttpswisdomofcrowdslive110daysafterthefallofkabulportalsignup target_blankaphrpemrecommended readingempulliquota hrefhttpsonlinelibrarywileycomdoi101111gove12195afghanistan a vicious cycle of state failureaquot by jennifer brick murtazashvilililia hrefhttpswwwpittedupittwirefeaturesarticlespitteffortaimsrelocateafghanscholarsusthe afghanistan projecta center for governance and markets university of pittsburgliliquota hrefhttpswwwtheguardiancomglobaldevelopment2021sep09afghansrisknearuniversalpovertyunafghans at risk of nearuniversal poverty un report warnsaquot by peter beaumont the guardianliliquota hrefhttpswwwnprorg202111101054428157inafghanistanthethreatofwidespreadfamineloomsasdroughtandhungercontiin afghanistan the threat of widespread famine looms as drought and hunger continuesaquot by all things considered nprliulpppppp | hraudio controls source srchttpschrtfmtrackgg6ba9trafficlibsyncomsecurewisdomofcrowdswocomarandjen_mixdown_track_4__3mp3 img alt110 days fall kabul srchttpswisdomofcrowdslivecontentimages202112brokenbridgejpegpyour browser doesnt support html audio hrefhttpschrtfmtrackgg6ba9trafficlibsyncomsecurewisdomofcrowdswocomarandjen_mixdown_track_4__3mp3herea link filep audiopwhat like live fall kabul think american withdrawal afghanistan famine enveloping country amid unprecedentedly severe state collapse approachand deal withthe ruling taliban authorities ppthis week joined dr jennifer brick murtazashvili dr omar sadr newlylaunched afghanistan project university pittsburghs center governance markets talk lies ahead longsuffering afghan peoplepp hrefhttpswisdomofcrowdslive110daysafterthefallofkabulportalsignup target_blankaphrpemrecommended readingempulliquota hrefhttpsonlinelibrarywileycomdoi101111gove12195afghanistan vicious cycle state failureaquot jennifer brick murtazashvilililia hrefhttpswwwpittedupittwirefeaturesarticlespitteffortaimsrelocateafghanscholarsusthe afghanistan projecta center governance markets university pittsburgliliquota hrefhttpswwwtheguardiancomglobaldevelopment2021sep09afghansrisknearuniversalpovertyunafghans risk nearuniversal poverty un report warnsaquot peter beaumont guardianliliquota hrefhttpswwwnprorg202111101054428157inafghanistanthethreatofwidespreadfamineloomsasdroughtandhungercontiin afghanistan threat widespread famine looms drought hunger continuesaquot things considered nprliulpppppp |
61aa9c6cfed1d723bfb90d08 | The Role of Mental Shortcuts in the Delivery Room | div dataelementorsettings[] dataelementortypewppost dataelementorid15661
div
div
section dataidcc19324 dataelement_typesection datasettingsquotbackground_backgroundquotquotclassicquot
divdiv
div
div
div dataid2eaa26e dataelement_typecolumn
div
div
div dataid3db117b datawidget_typeheadingdefault dataelement_typewidget
div
h1the role of mental shortcuts in the delivery roomh1 div
div
div dataidc80959b datawidget_typeheadingdefault dataelement_typewidget
div
h5by bapu jena md phdh5 div
div
div dataid4b65f57 datawidget_typeheadingdefault dataelement_typewidget
div
h5december 3 2021h5 div
div
div
div
div
div
div
section
section dataid1c03cf5 dataelement_typesection
div
div
div dataidb9358ab dataelement_typecolumn
div
div
div dataidbe5c263 datawidget_typehtmldefault dataelement_typewidget
div
div
div
div
div
div
div
div
section
section dataid96bcf40 dataelement_typesection
div
div
div dataidc9b46ee dataelement_typecolumn
div
div
div dataid635cb27 datawidget_typetexteditordefault dataelement_typewidget
div
div
pema relnoopener hrefhttpshcphmsharvardedupeopleanupambjena datasaferedirecturlhttpswwwgooglecomurlqhttpshcphmsharvardedupeopleanupambjenaampsourcegmailampust1617303513907000ampusgafqjcnhzfsocalew6byqhheyvlp05za2za datackesavedhrefhttpshcphmsharvardedupeopleanupambjena target_blankbapu jenaa is an associate professor of health care policy at harvard medical school a physician in the department of medicine at massachusetts general hospital and a member of the 2021 tradeoffs research council his research interests include the economics of physician behavior and the physician workforce emppphysicians regularly have to make quick decisions in highpressure situations ideally these decisions are based on years of experience and evidence but a number of studies have shown that physicians often rely on simple mental shortcuts known as a datackesavedhrefhttpswwwverywellmindcomwhatisaheuristic2795235 hrefhttpswwwverywellmindcomwhatisaheuristic2795235heuristicsa to make these lifeordeath calls a new study looks at whether these mental shortcuts influence one of the most important medical events childbirthppin a a datackesavedhrefhttpswwwscienceorgdoi101126scienceabc9818 hrefhttpswwwscienceorgdoi101126scienceabc9818papera published in the journal emscienceem university of massachusetts amherst professor manasvini singh used electronic health record data on more than 80000 births to see whether one of the most critical choices obstetricians make when choosing how to deliver a baby cesarean section or vaginal birth is susceptible to whats known as the a datackesavedhrefhttpsenwikipediaorgwikiwine28093stay_losee28093switch hrefhttpsenwikipediaorgwikiwine28093stay_losee28093switchwinstay loseswitcha heuristic ppshe found obstetricians were more likely to switch delivery modes after having a complication in the previous delivery in other words if there were complications with a vaginal birth obstetricians were less likely to attempt a vaginal birth in the next patient and viceversa for csections even though switching may not have been appropriate clinically the effect was only statistically significant for the birth immediately following the complicationppthere are some important limitations to this study it only uses data from two academic hospitals in one state and it cannot definitively tell us whether the complication was the reason the obstetrician switched delivery modes since it cant tell us what the original birth plan was but singhs rigorous analysis is pretty convincing ppthe results are interesting to me for two reasons first they suggest that in a highstakes environment like childbirth where we might think or hope that mental shortcuts are used less they still occur this could have troubling implications if these heuristics reinforce physician biases andor lead to suboptimal decisions singh suggests a datackesavedhrefhttpstradeoffsorg20210326howtechcanshrinkracialdisparitiesinmedicine hrefhttpstradeoffsorg20210326howtechcanshrinkracialdisparitiesinmedicinealgorithmsa could help guide physician decision making but algorithms can also a datackesavedhrefhttpswwwscienceorgdoi101126scienceaax2342 hrefhttpswwwscienceorgdoi101126scienceaax2342reinforce biasesappsecond i think this study a datackesavedhrefhttpswwwnejmorgdoifull101056nejmc1911289 hrefhttpswwwnejmorgdoifull101056nejmc1911289alonga with a datackesavedhrefhttpswwwsciencedirectcomsciencearticleabspiis0196064421005126 hrefhttpswwwsciencedirectcomsciencearticleabspiis0196064421005126othersa like it illustrate a way to use behavioral economics to answer other questions in health care heuristics like the one in this paper could create natural experiments for comparing the effectiveness of different forms of care in this case the heuristic could be seen as effectively randomizing which patients got a csection or vaginal delivery which could allow researchers to compare which delivery mode works best in different scenarios while there is a datackesavedhrefhttpswwwnprorgsectionsgoatsandsoda20181012656198429rateofcsectionsisrisingatanalarmingrate hrefhttpswwwnprorgsectionsgoatsandsoda20181012656198429rateofcsectionsisrisingatanalarmingrategood evidencea that csections are overused there are many other areas of medicine like oncology surgery and nearly every medical specialty where we often lack high quality data on how various treatments or services compare to one anotherp div
div
div
div
div
div
div
div
section
section dataid991a617 dataelement_typesection
div
div
div dataid47f6773 dataelement_typecolumn datasettingsquotbackground_backgroundquotquotclassicquot
div
div
div dataidc022843 datawidget_typeheadingdefault dataelement_typewidget
div
h2want research corner delivered to your inbox every friday sign up for our weekly newsletterh2 div
div
div dataidf9d932f datawidget_typeshortcodedefault dataelement_typewidget
div
divdiv
div
div
div
div
div
div
div
section
section dataid966dbb4 dataelement_typesection
div
div
div dataidc04afb3 dataelement_typecolumn
div
div
div dataid5a8dde1 datawidget_typespacerdefault dataelement_typewidget
div
div
divdiv
div
div
div
div
div
div
div
div
section
div
div
div
pthe post a relnofollow hrefhttpstradeoffsorg20211203heuristicschildbirthphysciandecisionmakingthe role of mental shortcuts in the delivery rooma appeared first on a relnofollow hrefhttpstradeoffsorgtradeoffsap | div dataelementorsettings[] dataelementortypewppost dataelementorid15661 div div section dataidcc19324 dataelement_typesection datasettingsquotbackground_backgroundquotquotclassicquot divdiv div div div dataid2eaa26e dataelement_typecolumn div div div dataid3db117b datawidget_typeheadingdefault dataelement_typewidget div h1the role mental shortcuts delivery roomh1 div div div dataidc80959b datawidget_typeheadingdefault dataelement_typewidget div h5by bapu jena md phdh5 div div div dataid4b65f57 datawidget_typeheadingdefault dataelement_typewidget div h5december 3 2021h5 div div div div div div div section section dataid1c03cf5 dataelement_typesection div div div dataidb9358ab dataelement_typecolumn div div div dataidbe5c263 datawidget_typehtmldefault dataelement_typewidget div div div div div div div div section section dataid96bcf40 dataelement_typesection div div div dataidc9b46ee dataelement_typecolumn div div div dataid635cb27 datawidget_typetexteditordefault dataelement_typewidget div div pema relnoopener hrefhttpshcphmsharvardedupeopleanupambjena datasaferedirecturlhttpswwwgooglecomurlqhttpshcphmsharvardedupeopleanupambjenaampsourcegmailampust1617303513907000ampusgafqjcnhzfsocalew6byqhheyvlp05za2za datackesavedhrefhttpshcphmsharvardedupeopleanupambjena target_blankbapu jenaa associate professor health care policy harvard medical school physician department medicine massachusetts general hospital member 2021 tradeoffs research council research interests include economics physician behavior physician workforceemppphysicians regularly quick decisions highpressure situations ideally decisions based years experience evidence number studies shown physicians rely simple mental shortcuts known datackesavedhrefhttpswwwverywellmindcomwhatisaheuristic2795235 hrefhttpswwwverywellmindcomwhatisaheuristic2795235heuristicsa lifeordeath calls new study looks mental shortcuts influence important medical events childbirthppin datackesavedhrefhttpswwwscienceorgdoi101126scienceabc9818 hrefhttpswwwscienceorgdoi101126scienceabc9818papera published journal emscienceem university massachusetts amherst professor manasvini singh electronic health record data 80000 births critical choices obstetricians choosing deliver baby cesarean section vaginal birth susceptible whats known datackesavedhrefhttpsenwikipediaorgwikiwine28093stay_losee28093switch hrefhttpsenwikipediaorgwikiwine28093stay_losee28093switchwinstay loseswitcha heuristicppshe found obstetricians likely switch delivery modes having complication previous delivery words complications vaginal birth obstetricians likely attempt vaginal birth patient viceversa csections switching appropriate clinically effect statistically significant birth immediately following complicationppthere important limitations study uses data academic hospitals state definitively tell complication reason obstetrician switched delivery modes cant tell original birth plan singhs rigorous analysis pretty convincingppthe results interesting reasons suggest highstakes environment like childbirth think hope mental shortcuts occur troubling implications heuristics reinforce physician biases andor lead suboptimal decisions singh suggests datackesavedhrefhttpstradeoffsorg20210326howtechcanshrinkracialdisparitiesinmedicine hrefhttpstradeoffsorg20210326howtechcanshrinkracialdisparitiesinmedicinealgorithmsa help guide physician decision making algorithms datackesavedhrefhttpswwwscienceorgdoi101126scienceaax2342 hrefhttpswwwscienceorgdoi101126scienceaax2342reinforce biasesappsecond think study datackesavedhrefhttpswwwnejmorgdoifull101056nejmc1911289 hrefhttpswwwnejmorgdoifull101056nejmc1911289alonga datackesavedhrefhttpswwwsciencedirectcomsciencearticleabspiis0196064421005126 hrefhttpswwwsciencedirectcomsciencearticleabspiis0196064421005126othersa like itillustrate way use behavioral economics answer questions health care heuristics like paper create natural experiments comparing effectiveness different forms care case heuristic seen effectively randomizing patients got csection vaginal delivery allow researchers compare delivery mode works best different scenarios datackesavedhrefhttpswwwnprorgsectionsgoatsandsoda20181012656198429rateofcsectionsisrisingatanalarmingrate hrefhttpswwwnprorgsectionsgoatsandsoda20181012656198429rateofcsectionsisrisingatanalarmingrategood evidencea csections overused areas medicine like oncology surgery nearly medical specialty lack high quality data treatments services compare anotherp div div div div div div div div section section dataid991a617 dataelement_typesection div div div dataid47f6773 dataelement_typecolumn datasettingsquotbackground_backgroundquotquotclassicquot div div div dataidc022843 datawidget_typeheadingdefault dataelement_typewidget div h2want research corner delivered inbox friday sign weekly newsletterh2 div div div dataidf9d932f datawidget_typeshortcodedefault dataelement_typewidget div divdiv div div div div div div div section section dataid966dbb4 dataelement_typesection div div div dataidc04afb3 dataelement_typecolumn div div div dataid5a8dde1 datawidget_typespacerdefault dataelement_typewidget div div divdiv div div div div div div div div section div div div pthe post relnofollow hrefhttpstradeoffsorg20211203heuristicschildbirthphysciandecisionmakingthe role mental shortcuts delivery rooma appeared relnofollow hrefhttpstradeoffsorgtradeoffsap |
61aa9c90fed1d723bfb90d0c | Claims about placebos | blockquotepthe placebo effect in the united states has actually become quite a lot stronger over time meaning that drugs that once would have been approved may not be now because their performance relative to that of placebo is less convincing this a relnofollow ugc noopener hrefhttpsjournalslwwcompainabstract201512000increasing_placebo_responses_over_time_in_u_s_27aspxstudya makes the point clearly by 2013 drugs produced 89 more pain relief than placebos compared to 273 in 1996 in the charts above it can be seen that the effect of placebo drugs has increased a lot whereas the effectiveness of pain relief drugs has barely changed meaning that the treatment advantage the effectiveness of active drugs as opposed to placebos has fallen dramatically weirdly it seems like this is only happening in the united states whereas other countries havent seen particularly large increases in the effect size of placebospblockquote
pthat is from a relnoopener hrefhttpsatissubstackcompallplacebosarenotcreatedequal target_blankthe substack of sama hail bruno mp
pthe post a relnofollow hrefhttpmarginalrevolutioncommarginalrevolution202112claimsaboutplaceboshtmlclaims about placebosa appeared first on a relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap | blockquotepthe placebo effect united states actually lot stronger time meaning drugs approved performance relative placebo convincing relnofollow ugc noopener hrefhttpsjournalslwwcompainabstract201512000increasing_placebo_responses_over_time_in_u_s_27aspxstudyamakes point clearly 2013 drugs produced 89 pain relief placebos compared 273 1996 charts seen effect placebo drugs increased lot effectiveness pain relief drugs barely changed meaning treatment advantage effectiveness active drugs opposed placebos fallen dramatically weirdly like happening united states countries havent seen particularly large increases effect size placebospblockquote pthat relnoopener hrefhttpsatissubstackcompallplacebosarenotcreatedequal target_blankthe substack sama hail bruno mp pthe post relnofollow hrefhttpmarginalrevolutioncommarginalrevolution202112claimsaboutplaceboshtmlclaims placebosa appeared relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap |
61ae8faef930bcc7b882c71a | Do we live in a “post-outrage” world? | pa relnoopener hrefhttpswwwpoliticocomnews20211205roevwadedemocrats2022elections523759 target_blankfrom david siders at politicoap
blockquotepi wish we lived in a world where outrage mattered but i think we live in a postoutrage world and voters today are affected only by that which directly affects them which is why the economy affordability and cost of living is such a major issue for so many people while a lot of people will express sympathy for that 12yearold girl in texas who got raped but no longer can terminate her pregnancy its not what motivates them to go to the polls sadlypblockquote
pand some detailsp
blockquotepinterviews with more than a dozen democraticb bstrategists pollsters and officials reveal skepticism that the courts decision will dramatically alter the midterm landscape unless and perhaps not even then iroe iis completely overturned privately several democratic strategists have suggested the usefulness of any decision on abortion next year will be limited and some may advise their clients not to focus on abortion rights at allp
section
div
div
div
div
div
psome of that thinking is colored by virginias gubernatorial race earlier this year after the supreme courta relnoopener hrefhttpswwwpoliticocomnews20210901texasabortionbanroe508598 target_blank allowed a law banning abortion after six weeks of pregnancy to take effect in texasa the party was so sure abortion would resonate with voters that democrat terry mcauliffe made it a centerpiece of his campaign saying a relnoopener hrefhttpswwwpoliticocomnews20210901abortiongovernorsracecaliforniavirginia508675 target_blankit will be a huge motivator for individuals to come out and voteap
div
div
div
div
div
section
blockquote
section datacontentsection1
div
div
div
div
div
blockquote
p datacontentchildindex00by the time ballots were cast just 8 percent of voters listed abortion as the most important issue facing virginiaa relnoopener hrefhttpswwwcnncomelection2021novemberexitpollsvirginiagovernor0 target_blank according to exit pollsa even worse for democrats of the people who cared most about the issue a majority voted for the republican glenn youngkinp
blockquote
p datacontentchildindex00cancellations up outrage down model thatp
div
div
div
div
div
section
pthe post a relnofollow hrefhttpmarginalrevolutioncommarginalrevolution202112doweliveinapostoutrageworldhtmldo we live in a postoutrage worlda appeared first on a relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap | pa relnoopener hrefhttpswwwpoliticocomnews20211205roevwadedemocrats2022elections523759 target_blankfrom david siders politicoap blockquotepi wish lived world outrage mattered think live postoutrage world voters today affected directly affects economy affordability cost living major issue people lot people express sympathy 12yearold girl texas got raped longer terminate pregnancy motivates polls sadlypblockquote pand detailsp blockquotepinterviews dozen democraticbbstrategists pollsters officials reveal skepticism courts decision dramatically alter midterm landscape iroeiis completely overturned privately democratic strategists suggested usefulness decision abortion year limited advise clients focus abortion rights allp section div div div div div psome thinking colored virginias gubernatorial race earlier year supreme courta relnoopener hrefhttpswwwpoliticocomnews20210901texasabortionbanroe508598 target_blankallowed law banning abortion weeks pregnancy effect texasa party sure abortion resonate voters democrat terry mcauliffe centerpiece campaign sayinga relnoopener hrefhttpswwwpoliticocomnews20210901abortiongovernorsracecaliforniavirginia508675 target_blankit huge motivator individuals come voteap div div div div div section blockquote section datacontentsection1 div div div div div blockquote p datacontentchildindex00by time ballots cast 8 percent voters listed abortion important issue facing virginiaa relnoopener hrefhttpswwwcnncomelection2021novemberexitpollsvirginiagovernor0 target_blankaccording exit pollsa worse democrats people cared issue majority voted republican glenn youngkinp blockquote p datacontentchildindex00cancellations outrage model thatp div div div div div section pthe post relnofollow hrefhttpmarginalrevolutioncommarginalrevolution202112doweliveinapostoutrageworldhtmldo live postoutrage worlda appeared relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap |
61ae914df930bcc7b882c74e | Work or Welfare? | img altwork or welfare srchttpss3amazonawscomprodstaticcontentquillettecom202112work1pngpppemif a man doesnt have a job or an income he has neither life nor liberty nor the possibility for the pursuit of happiness he merely exists embr
a hrefhttpswwwgoodreadscomquotes903968ifamandoesnthaveajoboranincomemartin luther king jra 1968p
pthroughout history work has been the common lot of humanityat least outside of the idle rich and those who could not find any it was celebrated by the calvinist capitalists described in webers ema hrefhttpswwwamazoncomprotestantethicspiritcapitalismdp0199747253the protestant ethic and the spirit of capitalismaem as a means for people to achieve their own salvation labor for its own sake was embraced by the a hrefhttpsmonthlyrevieworg20061001themeaningofworkamarxistperspectivemarxist canona as wellwork wrote a hrefhttpswwwmarxistsorgarchivemarxworks1876partplayedlabourindexhtmtextand2520it2520really2520is2520thethat2520labour2520created2520man2520himselffriedrich engelsa is the prime basic condition for all human existence and this to such an extent that in a sense we have to say that labor created man himselfppyet todays baffling shortage of workers in highincome countries may presage something different a postwork society in which only a select few labor for most economic maintenance would come from some form of universal basic income ubi this notion has been tried as part of a hrefhttpsthehillcomopinionfinance555778bidenopensthebackdoortouniversalbasicincomethe covid19 relief programa and in president bidens proposed build back better initiative which allows benefits for those who a hrefhttpswwwaeiorgpovertystudiesyourerightsenatormanchintherearenoworkrequirementsinbidensnewsafetynetcould join the workforcea but a hrefhttpswwwrealclearpoliticscomarticles20210917democrats_are_trashing_the_american_work_ethic_with_their_spending_bill_146426htmldont care toappthis idea is arising at a propitious time a strong majority of people in 28 countries around the world according to a hrefhttpswwwedelmancomtrust2020trustbarometera recent edelman surveya believe that capitalism does more harm than good more than fourinfive worry about job loss particularly from automation rising inequality and general fear of downward mobility have boosted support for a hrefhttpswwwwsjcomarticlestheeraofbiggovernmentisback11624636813expanded governmenta and greater redistribution of wealthppstrongsurplus classesstrongppas early as 1995 author jeremy rifkin suggested that automation would eliminate work for most and create the basis for a society where large numbers of people could be liberated from long hours in the formal marketplace this would allow them to focus on leisure activities a kind of technological utopia for the massesppits a compelling vision in some ways but right now it looks dystopic the ranks of what a hrefhttpsculturalstudiesnowblogspotcom201711marxonreservearmyoflaborunemployedhtmlmarxa called the reserve army of the unemployed are simply disengaging a decade ago a hrefhttpsnewsgallupcombusinessjournal151856wargoodjobsaspxtext2522the2520coming2520world2520war2520isworld2520that2520leaders2520will2520confront2522gallups jim cliftona wrote about a hrefhttpswwwamazoncomcomingjobswardpb0082onz6wemthe coming jobs waremaem emin which he predicted a global struggle for diminishing employment now there is plenty of work but people are not interested in the us labor participation rates have fallen from 80 percent in 1950 to a hrefhttpswwwstatistacomstatistics193961seasonallyadjustedmonthlycivilianlaborforceparticipationrateintheusa61 percenta now down from a hrefhttpswwwcensusgovlibrarystories202106whydidlaborforceparticipationratedeclinewheneconomywasgoodhtmltextthe2520national2520labor2520force2520participation253a252037725252520to25203992525644 percent in 2010a nearly a hrefhttpsfinanceyahoocomnews7waysmenlivewithoutworkinginamerica092147068htmlonethirda of american workingage males are not in the labor force suffering a hrefhttpswwwforbescomsitesadigaskell20191206theimpactofunemploymentonmalewellbeingsh11bc5f38167chigh ratesa of incarceration or drug alcohol and other health issuesppand to be sure opportunities may be further reduced by technology which could accelerate the loss of many kinds of jobs that once provided a means of upward mobility postal workers switchboard operators machinists computer operators bank tellers travel agents for a hrefhttpwwwwifrcomcontentnewsbureauoflaborstatisticsprojectsthelossoftensofthousandsofmiddleclassjobsby2024477101543htmlthe 90 million americans who work in such jobsaand their counterparts elsewherethe future could be bleak by 2030 a hrefhttpswwwusnewscomnewseconomyarticles20190626reportrobotswillreplace20millionmanufacturingjobsby2030oxford economicsa predicts that 20 million factory jobs worldwide will fall to automation15 million in the us 25 million in the eu and 125 million in chinappthe pandemic clearly accelerated this process notably in the service sector with the shift to online and takeout food chains like a hrefhttpswwwyahoocomfinancenewsmcdonaldsautomateddrivethruisjustthelatestsignofrobotstakingoverfastfood170158300htmlmcdonaldsa are perfecting electronic delivery systems that reduce the need for human labor large capital investments are necessary for such adaptations whichas frances a hrefhttpswwweconomicpolicyresearchorgresourcelibraryresearchpikettyelasticityofsubstitutionacritiquethomas pikettya has notedfavors larger corporations as opposed to smaller family businessesppstrongglobalism automation and its effectsstrongppa plausible future scenario is a society in which a small hyperproductive technical and managerial elite delivers food housing and pleasure to the plebes like those in the later centuries of the roman empire their only role in society would be to take and not threaten the imperial statea system that only worked due to the presence of slaves and huge territories to pillageppin the west globalization has worked to undermine much employment and promoted a pervasive sense of what historian martin wiener calls psychological deindustrializationa loss of interest in making things between 2000 and 2007 alone the united states hemorrhaged a hrefhttpsamericanaffairsjournalorg202005reshoringsupplychainsapracticalpolicyagenda34 million factory jobsa about 20 percent of the sectors total the trade deficit with china according to a hrefhttpswwwepiorgpublicationgrowingchinatradedeficitscostsusjobsthe economic policy institutea has cost as many as 37 million jobs since 2000 and similar symptoms have spread to a hrefhttpswwwwsjcomarticlesgermanyeconomylaggingbehindeuropesupplychain11636383954germanya long an industrial paragonppmany of these problems are of our own making pundits have long been predicting the demise of factory jobs and by now according to rifkin factories should be near workerless yet as automation kicks in american factory managers increasingly complain of a distressing lack of skilled workers due to an aging workforce as many a hrefhttpswwwkornferrycomcontentdamkornferrydocsarticlemigrationthenewmathformanufacturerspdfas 600000 new manufacturing jobsa are expected to be generated this decade which cannot be filled the current a hrefhttpswwwtradesmeninternationalcomconstructionmanagementweldershortagetextaccording2520the2520american2520welding2520societyunder2520the2520age2520of252035shortage of weldersa could grow to 400000 by 2024 amid a mild recovery in the us by may an estimated a hrefhttpswwwcnncom20210504economymanufacturingjobseconomyindexhtml500000 manufacturing jobs were left unfilledappin contrast our nonwestern competitors notably china are building a skilled workforce that can operate sophisticated automated facilities as a a hrefhttpsamericancompassorgwpcontentuploads202006americancompassmovingthechainsfinalwithcommentspdfpage50report from american compassa noted only five percent of american college students major in engineering compared with 33 percent in china as of 2016 china graduated 47 million stem students versus 568000 in the united states as well as six times as many students with engineering and computer science bachelors degrees meanwhile in the us a hrefhttpswwwinccomglennleibowitzappleceotimcookthisisnumber1reasonwemakeiphonesinchinaitsnotwhatyouthinkhtmlapple ceo tim cooka has observed you could have a meeting of tooling engineers and im not sure we could fill the room in china you could fill multiple football fields this helps explain why the company maintains virtually all its production in the middle kingdomppstrongthe green dawn of postindustrialismstrongppwhile asian countries are focusing on future work western societies seem determined to eliminate gainful employment for bluecollar and middlemanagement workers many jobs that could support families have disappeared and most new opportunities tend to be lowwage service work one widely cited reason for a hrefhttpswwwnytimescom20210601opinionlaborshortagejobsbidencovidhtmlthe recent labor shortagesa relates to a postpandemic reluctance to accept low wages including those in the gig economy where a hrefhttpswwwtheinformationcomarticlespaytransparencyforgigworkersispossibleutm_campaign255brtsu255dautomatedrtsutm_content1003949utm_mediumemailutm_sourcecioutm_term1000266pay and hours are often uncertainappsome lowpaid workers have also found a hrefhttpsfortunecom20210601usemploymentproblemcovid19minimumwageunemploymentbenefitsstate supporta during the pandemic to be in some cases more profitable than work and a way to remove the risks associated with crowded offices and public transport yet although the pandemic was the trigger for this withdrawal high levels of public welfare delinked from work have also been associated with the a hrefhttpswwwcityjournalorghtmlwarworkandhowendit15250htmlpersistently high unemploymenta that has plagued countries such as italy and spainppnot everyone sees mass idleness as an unalloyed negative postwork fits neatly with the a hrefhttpsscitechdailycomclimatechangemodelingofdegrowthscenariosreductioningdpenergyandmaterialusedegrowtha philosophy pushed by climate activists today this notion seeks to ratchet down consumption among the masses by reducing the size of homes cars air travel and air conditioning particularly hardhit would be a hrefhttpswwwpowerlineblogcomarchives201903exposingtherealcostsofgreenenergyphpmillions of workingclass peoplea particularly those in wellpaying manufacturing construction and energy jobs ubi would provide the basics for a properly austere ecological lifestyleppperhaps the most perverse impact of all this is that by raising energy and other costs it accelerates the deindustrialization of countries like the a hrefhttpswwwnetzerowatchcomrisingenergypricesarekillingbritishindustryclimatepoliciesaretoblameunited kingdoma and could make it harder to shift production to places like india and china by far a hrefhttpswwwstatistacomstatistics271748thelargestemittersofco2intheworldthe worlds largest emittera by the time china india and other developing countries have to embrace lower emissions likely with a hrefhttpswwwcnbccom20181108chinaindiawillleadglobalnuclearpowerproductiongrowthexpertshtmlnuclear powera the largely selfdriven deindustrialization of the west will likely be all but completeppstrongbuilding the postwork societystrongppthe most powerful groups advocating for a postwork future are precisely those most illustrative of the economic transformation of our times leading tech entrepreneurs may behave like a hrefhttpsmashablecomarticleworkaholicstartupcultureobsessed workaholicsa but they see no reason for the plebes to live the same way greg ferenstein who interviewed 147 digital company founders says a hrefhttpswwwcityjournalorghtmldisrupters14950htmlmost of them believe thata over the very long run an increasingly greater share of economic wealth will be generated by a smaller slice of very talented or original people everyone else will increasingly subsist on some combination of parttime entrepreneurial gig work and government aidppa hrefhttpswwwtheguardiancomtechnology2016jun22siliconvalleyuniversalbasicincomeycombinatornumerous figuresa such as a hrefhttpsfinanceyahoocomnewsmarkzuckerbergjoinssiliconvalley202800717htmlmark zuckerberga pierre omidyar a hrefhttpswwwnewyorkercommagazine20180709whoreallystandstowinfromuniversalbasicincomeelon muska and a hrefhttpsblogycombinatorcommovingforwardonbasicincomesam altmana founder of the y combinator have embraced a guaranteed wage that would cover most critical household bills this notion of a workfree future may be enticing to some but the reality may be far less pleasant as author a hrefhttpsriponsocietyorgarticleifyoulikebiggovernmentyoulllovetheubiaaron renna suggests for those parts of american society where income transfer has become a way of life like native americans the result has been shocking levels of drug abuse alcoholism and idlenessppin our era a broadbased ubi would necessitate high taxes particularly on the already beleaguered middle class the question will then be who gets what and who pays democratic presidential candidate a hrefhttpswwwcnbccom20200114budgetneutraluniversalbasicincomeplanwouldpay1320permonthhtmlandrew yangs campaigna was built around ubi and his plan was estimated to cost around 28 trillion annually paid for by a national value added tax and higher capital and social security taxes but some on the left see even ubi as inadequate and seek to seize tech wealth and commandeer their technology to create a hrefhttpswwwtheguardiancomsustainablebusiness2015mar18fullyautomatedluxurycommunismrobotsemploymentfully automated luxury communismaa leisure society paid for by apple and its counterpartsppunsurprisingly much kneejerk opposition to ubi comes from a hrefhttpswwwthedaycomarticle20210702op04210709867the righta but damon linker a liberal writing for the emweekem a hrefhttpstheweekcomarticles695019spiritualruinuniversalbasicincomedescribes ubi asa the road to spiritual ruin particularly for those most dependent on it some on the left even see it as the construct of a neoliberal a hrefhttpswwwtruthdigcomarticlestheoligarchsguaranteedbasicincomescamincome scama to hasten the end of productive work and upward mobility most voters according to an october a hrefhttpsmorningconsultcom20210721childtaxcreditpaymentsbidenpollmorning consulta poll also oppose permanent income supports yet a hrefhttpsthehillcomopinioncampaign577780americanshatebiggovernmentuntiltheyexperiencethebenefitsdemocratic strategistsa realize that such largesse once offered will be likely accepted by recipients and so want to continue it emad infinitumemppstrongthe hard work alternativestrongppthe current labor shortage and predictions of its continuance suggest that the market for work has not disappeared in areas such as manufacturing logistics and homebuilding precisely where labor shortages are a hrefhttpswwwwsjcomarticlesthegreatamericanlaborshortage11623191784most acutea in his 1995 book ema hrefhttpswwwamazoncomendworkdeclineglobalpostmarketdp0874778247the end of workaem rifkin suggests that industrial employment would be eliminated early in this century but labor demand not only in manufacturing is on the risepprather than embrace expanded welfare we could see a resurgence of higher wage work including in bluecollar fields demographic forces in the west and china have created a diminished workforce us population growth in the workingage cohort 1664 has dropped from 20 percent in the 1980s to a hrefhttpswwwwsjcomarticlesasworldrunsshortofworkersaboostforwagesandinflation11620824675less than five percenta in the last decade these trends were evident embefore emthe pandemic when workingclass americans were making a hrefhttpswwwwsjcomarticlesusincomesuppovertyratedownin201911600180606significant income gainsa for the first time in a generationppthe labor force is now a hrefhttpswwwwsjcomarticlestheotherreasonthelaborforceisshrunkenfearofcovid1911618163017textit2520suggests2520that2520even2520withuntil2520the2520virus2520is2520tamedamptextthe2520labor252dforce2520participation2520rateof2520nearly2520392520million2520peopledown 84 milliona over the past year in the us alone and with a a hrefhttpswwwcbsnewscomnewsjobopeningshitrecordhighwith101millionopeningsrecord 101 million job openingsa even a hrefhttpswwwyahoocommoneyexpertgreatwagerevoltamongrestaurantworkers193807846htmlrestaurantsa are being forced to hand out signing bonuses as workers remain on the sidelines awaiting higher pay these shortages are appearing in a hrefhttpswwwcnbccom20211020globalshortageofworkerswhatsgoingonexpertsexplainhtmlvirtually all highincome countriesa including the eu the uk a hrefhttpsasianikkeicomeconomyjapanscovidemergencyisoverlaborandchipshortagesarenotjapana and even a hrefhttpswwwwsjcomarticlesasworldrunsshortofworkersaboostforwagesandinflation11620824675chinaa where the workforce fell by over five percent in the last decade similar developments have been seen in other countries including a hrefhttpswwwwsjcomarticlesminerslabortofindenoughtruckdriversworkers11632043801australiaa where the western mining industry is being slowed by a lack of driversppeconomists may hate a hrefhttpsmailchimp0f861f0294ebsmbreopeningreport13365624e64a17c95bclabor shortagesa for raising business costs but the pandemic could help ameliorate the growing inequality in advanced countries by raising wages and reaffirming the value of work itself as occurred in the wake of the far more deadly medieval european plague workers and entrepreneurs who somehow survived that contagion found new opportunities and greater demand for laborppstrongwhat kind of society do we wantstrongppwe have two options we can surrender our future prosperity for an automated society in which the standard of living drops to levels comparable to those in the soviet union than in late20th century europe japan or america or we can continue to improve our societies there are many necessary things we can do with wellcompensated labor that extend beyond algorithmspptheres a clear need for a hrefhttpswwwglobestcom20210812cresongoingproblemalaborshortageslreturn20211103111849new housinga and other infrastructure providing a hrefhttpswwwyahoocomnewsnursingshortagespostpandemicone150252524htmlmedical carea and perhaps most critically getting humanity an exit pass from this planet as anyone who has visited the space factories here in southern california will know we still need peoplefrom engineers to machiniststo build rockets drones and moonwalkers much of this demand could be satisfied with intensely targeted skills training and a hrefhttpswwweconomicmodelingcomskillsrequiredutm_campaignskills2520required253a2520he2520ebookutm_mediumhe2520email_hsmi157401998_hsencp2anqtzjjjvgkw1oleau7fnroas2smff2fus11avhbiz6f1hcxr_vl8maf_vei5gxinx9s6acsut4qrryxnlaw_vazc3viuwutm_contentskills2520required2520utm_sourceemailmost employersa now prefer this for many jobs over a college degreeppthis worksociety follows the path that led albeit with some cruelty to the exploration of the oceans the mass settling of continents the conquest of diseases the building of healthier cities and in the past halfcentury the spread of prosperity to east asia and other oncepoor areas these are emblems of a society moving forwards worthy heirs of progress from the age of exploration to the heady days of silicon valleyppthe alternative system particularly under the degrowth regime offers a different prospective future this society may be secure in the basics but it will be parasitic and stagnant much like the last centuries of the roman empire or the ching dynasty it is a society in which young people can look forward to subsidized schooling housing and perhaps parttime work but may never buy a house raise a family or start a significant businessppin a postwork world the whole diverse character of our livesthe last remaining vestiges of autonomywould disappear it may be true that artificial intelligence will deliver goods and services efficiently but would they be able to provide personalized service or allow for human creativity we may exist in a digital age but the analog is where we live and without it our lives will be very bleak indeedour democracy will be functionally dead as we go from contributors to permanent dependents in our understandable desire to eliminate poverty and raise basic living standards we need not embrace a system that turns most people into quiescent drones the price of security must not be a new and cushy kind of slaveryp | img altwork welfare srchttpss3amazonawscomprodstaticcontentquillettecom202112work1pngpppemif man doesnt job income life liberty possibility pursuit happiness merely exists embr hrefhttpswwwgoodreadscomquotes903968ifamandoesnthaveajoboranincomemartin luther king jra 1968p pthroughout history work common lot humanityat outside idle rich find celebrated calvinist capitalists described webers ema hrefhttpswwwamazoncomprotestantethicspiritcapitalismdp0199747253the protestant ethic spirit capitalismaem means people achieve salvation labor sake embraced hrefhttpsmonthlyrevieworg20061001themeaningofworkamarxistperspectivemarxist canona wellwork wrote hrefhttpswwwmarxistsorgarchivemarxworks1876partplayedlabourindexhtmtextand2520it2520really2520is2520thethat2520labour2520created2520man2520himselffriedrich engelsa prime basic condition human existence extent sense labor created man himselfppyet todays baffling shortage workers highincome countries presage different postwork society select labor economic maintenance come form universal basic income ubi notion tried hrefhttpsthehillcomopinionfinance555778bidenopensthebackdoortouniversalbasicincomethe covid19 relief programa president bidens proposed build better initiative allows benefits hrefhttpswwwaeiorgpovertystudiesyourerightsenatormanchintherearenoworkrequirementsinbidensnewsafetynetcould join workforcea hrefhttpswwwrealclearpoliticscomarticles20210917democrats_are_trashing_the_american_work_ethic_with_their_spending_bill_146426htmldont care toappthis idea arising propitious time strong majority people 28 countries world according hrefhttpswwwedelmancomtrust2020trustbarometera recent edelman surveya believe capitalism harm good fourinfive worry job loss particularly automation rising inequality general fear downward mobility boosted support hrefhttpswwwwsjcomarticlestheeraofbiggovernmentisback11624636813expanded governmenta greater redistribution wealthppstrongsurplus classesstrongppas early 1995 author jeremy rifkin suggested automation eliminate work create basis society large numbers people liberated long hours formal marketplace allow focus leisure activities kind technological utopia massesppits compelling vision ways right looks dystopic ranks hrefhttpsculturalstudiesnowblogspotcom201711marxonreservearmyoflaborunemployedhtmlmarxa called reserve army unemployed simply disengaging decade ago hrefhttpsnewsgallupcombusinessjournal151856wargoodjobsaspxtext2522the2520coming2520world2520war2520isworld2520that2520leaders2520will2520confront2522gallups jim cliftona wrote hrefhttpswwwamazoncomcomingjobswardpb0082onz6wemthe coming jobs waremaem emin predicted global struggle diminishing employment plenty work people interested labor participation rates fallen 80 percent 1950 hrefhttpswwwstatistacomstatistics193961seasonallyadjustedmonthlycivilianlaborforceparticipationrateintheusa61 percenta hrefhttpswwwcensusgovlibrarystories202106whydidlaborforceparticipationratedeclinewheneconomywasgoodhtmltextthe2520national2520labor2520force2520participation253a252037725252520to25203992525644 percent 2010a nearly hrefhttpsfinanceyahoocomnews7waysmenlivewithoutworkinginamerica092147068htmlonethirda american workingage males labor force suffering hrefhttpswwwforbescomsitesadigaskell20191206theimpactofunemploymentonmalewellbeingsh11bc5f38167chigh ratesa incarceration drug alcohol health issuesppand sure opportunities reduced technology accelerate loss kinds jobs provided means upward mobility postal workers switchboard operators machinists computer operators bank tellers travel agents hrefhttpwwwwifrcomcontentnewsbureauoflaborstatisticsprojectsthelossoftensofthousandsofmiddleclassjobsby2024477101543htmlthe 90 million americans work jobsaand counterparts elsewherethe future bleak 2030 hrefhttpswwwusnewscomnewseconomyarticles20190626reportrobotswillreplace20millionmanufacturingjobsby2030oxford economicsa predicts 20 million factory jobs worldwide fall automation15 million 25 million eu 125 million chinappthe pandemic clearly accelerated process notably service sector shift online takeout food chains like hrefhttpswwwyahoocomfinancenewsmcdonaldsautomateddrivethruisjustthelatestsignofrobotstakingoverfastfood170158300htmlmcdonaldsa perfecting electronic delivery systems reduce need human labor large capital investments necessary adaptations whichas frances hrefhttpswwweconomicpolicyresearchorgresourcelibraryresearchpikettyelasticityofsubstitutionacritiquethomas pikettya notedfavors larger corporations opposed smaller family businessesppstrongglobalism automation effectsstrongppa plausible future scenario society small hyperproductive technical managerial elite delivers food housing pleasure plebes like later centuries roman empire role society threaten imperial statea system worked presence slaves huge territories pillageppin west globalization worked undermine employment promoted pervasive sense historian martin wiener calls psychological deindustrializationa loss interest making things 2000 2007 united states hemorrhaged hrefhttpsamericanaffairsjournalorg202005reshoringsupplychainsapracticalpolicyagenda34 million factory jobsa 20 percent sectors total trade deficit china according hrefhttpswwwepiorgpublicationgrowingchinatradedeficitscostsusjobsthe economic policy institutea cost 37 million jobs 2000 similar symptoms spread hrefhttpswwwwsjcomarticlesgermanyeconomylaggingbehindeuropesupplychain11636383954germanya long industrial paragonppmany problems making pundits long predicting demise factory jobs according rifkin factories near workerless automation kicks american factory managers increasingly complain distressing lack skilled workers aging workforce hrefhttpswwwkornferrycomcontentdamkornferrydocsarticlemigrationthenewmathformanufacturerspdfas 600000 new manufacturing jobsa expected generated decade filled current hrefhttpswwwtradesmeninternationalcomconstructionmanagementweldershortagetextaccording2520the2520american2520welding2520societyunder2520the2520age2520of252035shortage weldersa grow 400000 2024 amid mild recovery estimated hrefhttpswwwcnncom20210504economymanufacturingjobseconomyindexhtml500000 manufacturing jobs left unfilledappin contrast nonwestern competitors notably china building skilled workforce operate sophisticated automated facilities hrefhttpsamericancompassorgwpcontentuploads202006americancompassmovingthechainsfinalwithcommentspdfpage50report american compassa noted percent american college students major engineering compared 33 percent china 2016 china graduated 47 million stem students versus 568000 united states times students engineering computer science bachelors degrees hrefhttpswwwinccomglennleibowitzappleceotimcookthisisnumber1reasonwemakeiphonesinchinaitsnotwhatyouthinkhtmlapple ceo tim cooka observed meeting tooling engineers im sure fill room china fill multiple football fields helps explain company maintains virtually production middle kingdomppstrongthe green dawn postindustrialismstrongppwhile asian countries focusing future work western societies determined eliminate gainful employment bluecollar middlemanagement workers jobs support families disappeared new opportunities tend lowwage service work widely cited reason hrefhttpswwwnytimescom20210601opinionlaborshortagejobsbidencovidhtmlthe recent labor shortagesa relates postpandemic reluctance accept low wages including gig economy hrefhttpswwwtheinformationcomarticlespaytransparencyforgigworkersispossibleutm_campaign255brtsu255dautomatedrtsutm_content1003949utm_mediumemailutm_sourcecioutm_term1000266pay hours uncertainappsome lowpaid workers found hrefhttpsfortunecom20210601usemploymentproblemcovid19minimumwageunemploymentbenefitsstate supporta pandemic cases profitable work way remove risks associated crowded offices public transport pandemic trigger withdrawal high levels public welfare delinked work associated hrefhttpswwwcityjournalorghtmlwarworkandhowendit15250htmlpersistently high unemploymenta plagued countries italy spainppnot sees mass idleness unalloyed negative postwork fits neatly hrefhttpsscitechdailycomclimatechangemodelingofdegrowthscenariosreductioningdpenergyandmaterialusedegrowtha philosophy pushed climate activists today notion seeks ratchet consumption masses reducing size homes cars air travel air conditioning particularly hardhit hrefhttpswwwpowerlineblogcomarchives201903exposingtherealcostsofgreenenergyphpmillions workingclass peoplea particularly wellpaying manufacturing construction energy jobs ubi provide basics properly austere ecological lifestyleppperhaps perverse impact raising energy costs accelerates deindustrialization countries like hrefhttpswwwnetzerowatchcomrisingenergypricesarekillingbritishindustryclimatepoliciesaretoblameunited kingdoma harder shift production places like india china far hrefhttpswwwstatistacomstatistics271748thelargestemittersofco2intheworldthe worlds largest emittera time china india developing countries embrace lower emissions likely hrefhttpswwwcnbccom20181108chinaindiawillleadglobalnuclearpowerproductiongrowthexpertshtmlnuclear powera largely selfdriven deindustrialization west likely completeppstrongbuilding postwork societystrongppthe powerful groups advocating postwork future precisely illustrative economic transformation times leading tech entrepreneurs behave like hrefhttpsmashablecomarticleworkaholicstartupcultureobsessed workaholicsa reason plebes live way greg ferenstein interviewed 147 digital company founders says hrefhttpswwwcityjournalorghtmldisrupters14950htmlmost believe thata long run increasingly greater share economic wealth generated smaller slice talented original people increasingly subsist combination parttime entrepreneurial gig work government aidppa hrefhttpswwwtheguardiancomtechnology2016jun22siliconvalleyuniversalbasicincomeycombinatornumerous figuresa hrefhttpsfinanceyahoocomnewsmarkzuckerbergjoinssiliconvalley202800717htmlmark zuckerberga pierre omidyar hrefhttpswwwnewyorkercommagazine20180709whoreallystandstowinfromuniversalbasicincomeelon muska hrefhttpsblogycombinatorcommovingforwardonbasicincomesam altmana founder y combinator embraced guaranteed wage cover critical household bills notion workfree future enticing reality far pleasant author hrefhttpsriponsocietyorgarticleifyoulikebiggovernmentyoulllovetheubiaaron renna suggests parts american society income transfer way life like native americans result shocking levels drug abuse alcoholism idlenessppin era broadbased ubi necessitate high taxes particularly beleaguered middle class question gets pays democratic presidential candidate hrefhttpswwwcnbccom20200114budgetneutraluniversalbasicincomeplanwouldpay1320permonthhtmlandrew yangs campaigna built ubi plan estimated cost 28 trillion annually paid national value added tax higher capital social security taxes left ubi inadequate seek seize tech wealth commandeer technology create hrefhttpswwwtheguardiancomsustainablebusiness2015mar18fullyautomatedluxurycommunismrobotsemploymentfully automated luxury communismaa leisure society paid apple counterpartsppunsurprisingly kneejerk opposition ubi comes hrefhttpswwwthedaycomarticle20210702op04210709867the righta damon linker liberal writing emweekem hrefhttpstheweekcomarticles695019spiritualruinuniversalbasicincomedescribes ubi asa road spiritual ruin particularly dependent left construct neoliberal hrefhttpswwwtruthdigcomarticlestheoligarchsguaranteedbasicincomescamincome scama hasten end productive work upward mobility voters according october hrefhttpsmorningconsultcom20210721childtaxcreditpaymentsbidenpollmorning consulta poll oppose permanent income supports hrefhttpsthehillcomopinioncampaign577780americanshatebiggovernmentuntiltheyexperiencethebenefitsdemocratic strategistsa realize largesse offered likely accepted recipients want continue emad infinitumemppstrongthe hard work alternativestrongppthe current labor shortage predictions continuance suggest market work disappeared areas manufacturing logistics homebuilding precisely labor shortages hrefhttpswwwwsjcomarticlesthegreatamericanlaborshortage11623191784most acutea 1995 book ema hrefhttpswwwamazoncomendworkdeclineglobalpostmarketdp0874778247the end workaem rifkin suggests industrial employment eliminated early century labor demand manufacturing risepprather embrace expanded welfare resurgence higher wage work including bluecollar fields demographic forces west china created diminished workforce population growth workingage cohort 1664 dropped 20 percent 1980s hrefhttpswwwwsjcomarticlesasworldrunsshortofworkersaboostforwagesandinflation11620824675less percenta decade trends evident embefore emthe pandemic workingclass americans making hrefhttpswwwwsjcomarticlesusincomesuppovertyratedownin201911600180606significant income gainsa time generationppthe labor force hrefhttpswwwwsjcomarticlestheotherreasonthelaborforceisshrunkenfearofcovid1911618163017textit2520suggests2520that2520even2520withuntil2520the2520virus2520is2520tamedamptextthe2520labor252dforce2520participation2520rateof2520nearly2520392520million2520peopledown 84 milliona past year hrefhttpswwwcbsnewscomnewsjobopeningshitrecordhighwith101millionopeningsrecord 101 million job openingsa hrefhttpswwwyahoocommoneyexpertgreatwagerevoltamongrestaurantworkers193807846htmlrestaurantsa forced hand signing bonuses workers remain sidelines awaiting higher pay shortages appearing hrefhttpswwwcnbccom20211020globalshortageofworkerswhatsgoingonexpertsexplainhtmlvirtually highincome countriesa including eu uk hrefhttpsasianikkeicomeconomyjapanscovidemergencyisoverlaborandchipshortagesarenotjapana hrefhttpswwwwsjcomarticlesasworldrunsshortofworkersaboostforwagesandinflation11620824675chinaa workforce fell percent decade similar developments seen countries including hrefhttpswwwwsjcomarticlesminerslabortofindenoughtruckdriversworkers11632043801australiaa western mining industry slowed lack driversppeconomists hate hrefhttpsmailchimp0f861f0294ebsmbreopeningreport13365624e64a17c95bclabor shortagesa raising business costs pandemic help ameliorate growing inequality advanced countries raising wages reaffirming value work occurred wake far deadly medieval european plague workers entrepreneurs survived contagion found new opportunities greater demand laborppstrongwhat kind society wantstrongppwe options surrender future prosperity automated society standard living drops levels comparable soviet union late20th century europe japan america continue improve societies necessary things wellcompensated labor extend algorithmspptheres clear need hrefhttpswwwglobestcom20210812cresongoingproblemalaborshortageslreturn20211103111849new housinga infrastructure providing hrefhttpswwwyahoocomnewsnursingshortagespostpandemicone150252524htmlmedical carea critically getting humanity exit pass planet visited space factories southern california know need peoplefrom engineers machiniststo build rockets drones moonwalkers demand satisfied intensely targeted skills training hrefhttpswwweconomicmodelingcomskillsrequiredutm_campaignskills2520required253a2520he2520ebookutm_mediumhe2520email_hsmi157401998_hsencp2anqtzjjjvgkw1oleau7fnroas2smff2fus11avhbiz6f1hcxr_vl8maf_vei5gxinx9s6acsut4qrryxnlaw_vazc3viuwutm_contentskills2520required2520utm_sourceemailmost employersa prefer jobs college degreeppthis worksociety follows path led albeit cruelty exploration oceans mass settling continents conquest diseases building healthier cities past halfcentury spread prosperity east asia oncepoor areas emblems society moving forwards worthy heirs progress age exploration heady days silicon valleyppthe alternative system particularly degrowth regime offers different prospective future society secure basics parasitic stagnant like centuries roman empire ching dynasty society young people look forward subsidized schooling housing parttime work buy house raise family start significant businessppin postwork world diverse character livesthe remaining vestiges autonomywould disappear true artificial intelligence deliver goods services efficiently able provide personalized service allow human creativity exist digital age analog live lives bleak indeedour democracy functionally dead contributors permanent dependents understandable desire eliminate poverty raise basic living standards need embrace system turns people quiescent drones price security new cushy kind slaveryp |
61ae918cf930bcc7b882c754 | The hypocrisy of America’s terror debate | pwhat is terrorism and who is a terrorist two recent attacks in america one carried out by a 39yearold black man and another by a 15yearold white teen sharply illustrate just how polarised and confused the country is over these two seemingly straightforward questionsp
plast tuesday a 15yearschool boy recently a relnoopener hrefhttpswwwindependentcouknewsworldamericascrimemichiganschoolshootingethancrumbleyb1968855html target_blanknameda as ethan crumbley allegedly shot and a relnoopener hrefhttpswwwtheguardiancomusnews2021dec01michiganhighschoolshootingvictimsidentified target_blankkilled afour fellow students injuring seven others this happened at a high school in suburban detroit michigan the week before darrell brooks allegedly drove his suv into a christmas parade in waukesha wisconsin killing six and injuring many more a relnoopener hrefhttpswwwbbccouknewsworlduscanada59396999 target_blankaccordinga to witnesses he appeared to be intentionally trying to hit people one of the victims was an a relnoopener hrefhttpswwwbbccouknewsworlduscanada59396999 target_blankeightyearold boya at the time of the attack brooks was on bail after being charged with running over the mother of his child in a domestic dispute earlier last monthp
pprosecutors in michigan have levelled a relnoopener hrefhttpswwwtheguardiancomusnews2021dec02michiganschoolshootingprosecutorexplainsrareterrorismcharge target_blankone charge of terrorisma against crumbley in addition to four firstdegree murder counts and numerous other charges no charges of a relnoopener hrefhttpswwwindependentcouknewsworldamericascrimewaukeshapolicechiefparadeterrorismb1962405html target_blankterrorisma have been brought against brooks he instead a relnoopener hrefhttpswwwindependentcouknewswaukeshamadisonmilwaukeefoxnewspoliceb1968166html target_blankfacesa six counts of firstdegree homicidestrong strongp
divdiv
pthis raises all sorts of questions about the politics of categorising masscausality violence while schoolrampages often result in multiple deaths and terrorise those who are victimised in them they are not conventionally classified as terrorism since the motives of those who carry them out are typically personal they are not intended to further a political cause or ideology so it is curious that the authorities in michigan have levelled a charge of terrorismp
pcrumbleys alleged motives are as yet unclear although he a relnoopener hrefhttpswwwtheguardiancomusnews2021dec01michiganhighschoolshootingvictimsidentified target_blankreportedlya left some a relnoopener hrefhttpswwwindependentcouknewsworldamericascrimemichiganschoolshootingethancrumbleyb1968855html target_blankwritingsa that may shed some light on his thinking explaining the terrorism charge to cnn karen mcdonald the oakland county [michigan] prosecutor said that crumbley had set out to kill and injure as many people as possible if thats not terrorism i dont know what is she a relnoopener hrefhttpseditioncnncom20211201usmichigandeadlyshootingterrorismchargeindexhtml target_blanksaida in the process a relnoopener hrefhttpstwittercommtraceystatus1466839371278172160 target_blankenlarginga the concept of terrorism far beyond its standard meaning of a relnoopener hrefhttpstwittercomdrjohnhorganstatus1466412951418679301 target_blankpoliticallymotivated violencea against civilians and into the far broader domain of criminal murderousness mcdonald also a relnoopener hrefhttpseditioncnncom20211201usmichigandeadlyshootingterrorismchargeindexhtml target_blanknoteda by way of further explanation how terrifying it is to be in close proximity of another student shooting and killing fellow students i mean its terrorp
diva hrefhttpsunherdcom202110themythoflonewolfterrorismrefinnara hrefhttpsunherdcom202110themythoflonewolfterrorismrefinnarimg srchttpsunherdcomwpcontentuploads2021102gettyimages1235896981scalede1634653118324300x180jpgadiva hrefhttpsunherdcom202110themythoflonewolfterrorismrefinnarspansuggested readingspanaa hrefhttpsunherdcom202110themythoflonewolfterrorismrefinnarh5the myth of lonewolf terrorismh5apa hrefhttpsunherdcom202110themythoflonewolfterrorismrefinnarspanbyspan ayaan hirsi aliapdivadiv
pbrookss alleged motives are similarly unclear although we know that he had a relnoopener hrefhttpsnypostcom20211124darrellbrookscalledforviolenceagainstwhitepeople target_blankadvocateda for attacks against white people on social media and shared an antisemitic meme praising hitler we also know that a relnoopener hrefhttpsacademicoupcombjcarticle59115052837 target_blankvehicular rammingsa unlike high school shootings are a a relnoopener hrefhttpswwwcounterextremismcomvehiclesasweaponsofterror target_blankcommona emmodus operandiem of terrorists scores of isisinspired and directed operatives for example have used cars and trucks as weapons of massslaughter so it is seems worth noting that brooks who clearly harboured a relnoopener hrefhttpscontrasubstackcompthewaronamericancommunities target_blankextremist sentimentsa and whose alleged victims were all a relnoopener hrefhttpswwwfox2detroitcomnewscardinalsjjwattofferstopayfuneralcostsforwaukeshachristmasparadevictimsreport target_blankwhitea has not been given a terrorism charge needless to say brookss alleged actions would have been terrorising to those who were on the receiving end of themp
pwhat is even more curious is the incuriosity of the elite media and extremism experts about the brooks case had he been a white male who had expressed misogynistic views about women it is certain that they would have staged a giant moral panic about the global menace of a relnoopener hrefhttpsunherdcom202108whatthemediagetswrongaboutincels target_blankincelsa and the farrightp
pbut brooks who is a a relnoopener hrefhttpseditioncnncom20211122uswhatweknowaboutsuspectinwaukeshaparadetragedyindexhtml target_blankregistereda sex offender and trader in online hate has attracted little sustained discussion or concern to be clear im not saying that the brooks case should occasion a moral panic or that he be given a terrorism charge theres still much that we dont know about him his state of mind motives and indeed mental health but i do think we should ask questions about the selection bias of the credentialed commentators and experts who command so much of our attentionp
pas the emnew york postsem sohrab ahmaristrong stronghas recently a relnoopener hrefhttpswwwtheamericanconservativecomarticlessuvsdontkillpeople target_blankdocumenteda the coverage of the brooks case by mainstream media outlets has been quite appalling the emwashington postem in a tweet described the ramming attack as a tragedy caused by a suv a cbs national correspondent made reference to the wisconsin parade crash as if what happened was an unfortunate accident if this sounded coldly dispassionate and euphemistic in the extreme it is because it was what it emphatically emwasnt emwas an inferno of alarmist online commentary and outrage about the perpetrators vile beliefsp
pthe michigan attack by contrast has provoked a very different kind of commentary and critical probing thomas renard director of the international centre for counterterrorism at the hague a relnoopener hrefhttpstwittercomtom_renardstatus1466324825127981062 target_blanktweeteda this case raises so many questions what is terrorism does terrorism offence bring any added value in such case could it be counter productive should we use ct [counterterrorism] toolbox more often to deal with more forms of extremism or not pros and consp
prenard is right the michigan school shootingem doesem raise many questions one of which is why extremism scholars like renard had nothing to say about brookss alleged vehicular ramming attack and how emthatem case might raise questions about terrorism and ideologically motivated violence more broadlyp
pto be fair to renard and my fellow extremism researchers perhaps they just hadnt clocked the news about the waukesha attack especially given that it had attracted relatively little media attention or perhaps they had heard about it but were apt to ignore it because brooks wasnt charged with terrorismp
diva hrefhttpsunherdcom202110canwestopeveryterroristrefinnara hrefhttpsunherdcom202110canwestopeveryterroristrefinnarimg srchttpsunherdcomwpcontentuploads2021102gettyimages1235909330scalede1634576357748300x184jpgadiva hrefhttpsunherdcom202110canwestopeveryterroristrefinnarspansuggested readingspanaa hrefhttpsunherdcom202110canwestopeveryterroristrefinnarh5why prevent will never workh5apa hrefhttpsunherdcom202110canwestopeveryterroristrefinnarspanbyspan tom chiversapdivadiv
pbut neither explanation holds up to scrutiny many terrorism experts and extremism researchers are emvery emonline some of these people evidently are never emnotem online its hard to think that the waukesha attack would have escaped their noticep
ptheres also a whole cottage industry of counterextremist entrepreneurs which thrives on churning out report after report on the wider online ecosystems of a relnoopener hrefhttpsunherdcomthepostvicenewshasanincelproblem target_blankmisogynistic hatea and racialised invective so its odd that brookss violent rhetoric and past violence against women didnt raise any eyebrows among a group of researchers who are nothing if not hypervigilant when it comes to spotting signs of hatep
pi suspect other and deeper imperatives and incentives are at work one is to do with what the american sociologist erving goffman a relnoopener hrefhttpswwwamazoncompresentationselfeverydaylifedp0385094027 target_blankcalleda impression management while the other relates to the politics of grift the triumph of identity politics and the fear of running afoul of the puritanical scolds who police it has meant that whenever an act of masscasualty violence has been perpetrated by a white male that reviled figure of opprobrium in the cosmology of the what wesley yang a relnoopener hrefhttpswwwmanhattaninstituteorgthesuccessorideology target_blanktermsa the successor ideology it is tempting to vigorously call it out and to account the act of doing so has become a familiar ritual in public life the purpose of which is to communicate ones virtuep
pit is to pronounce in effect i really care about the evil of systemic racism in a durkheimian sense it also allows people to bond with other morally upstanding people and in a way that is emotionally seductivep
pthe temptation to call out or draw attention to the masscasualty violence of the farright is even stronger for extremism researchers since many have made decent careers out of researching and writing about jihadist groups and violence this makes them vulnerable to the charge of islamophobia and racism or both and perhaps even gives them a bad conscience from the perspective of their leftleaning critics these researchers are a relnoopener hrefhttpswwwsuporgbookstitleid24702 target_blankguiltya of focusing disproportionately on the jihadist threat or perpetuating dangerous essentialist tropes about islam and muslimsp
pnobody wants to be accused of islamophobia or racism and one way of forestalling or neutralising that accusation is to constantly amplify the threat of the farright of course extremism researchers would deny that theyre in the business of impression management of trying to foster a righteous impression before others and if theyre sounding alarmist about the farright threat this is because the threat is so goddamn alarming that it a relnoopener hrefhttpswwwspectatorcoukarticlewhyareterrorismexpertsbeingkeptawakeatnight target_blankkeeps them awakea at nightp
panother reason why extremism researchers are now so transfixed on the farright threat is because its unquestionably good for business its where all the a relnoopener hrefhttpswwwnytimescom20210404uspoliticsdomesticterrorismbidenhtml target_blankgrant moneya is you certainly wont receive state or private funding by saying that the qanon threat is exaggerated or that incels are more dangerous to themselves than to others and no publisher is going to offer a lucrative book deal for emhow terrorism is overblownemp
diva hrefhttpsunherdcom202109thetheatreofterrorrefinnara hrefhttpsunherdcom202109thetheatreofterrorrefinnarimg srchttpsunherdcomwpcontentuploads2021092gettyimages11615101300x169jpgadiva hrefhttpsunherdcom202109thetheatreofterrorrefinnarspanmore from this authorspanaa hrefhttpsunherdcom202109thetheatreofterrorrefinnarh5the theatre of terrorh5apa hrefhttpsunherdcom202109thetheatreofterrorrefinnarspanbyspan simon cotteeapdivadiv
pthis isnt just an american pathology here in britain two recent acts of lethal violence engendered two very different responses one was a killing spree by a 22yearold man called a relnoopener hrefhttpsthecriticcoukmassacremadetoorder target_blankjake davisona in just 12 minutes he killed his mother in the house they shared and then went on to shoot to death four others before turning his weapon on himself devon and cornwall police initially ruled out terrorism as a motive although it was known that davison had visited incel online forums and was a disgruntled virgin this prompted a slew of commentary on how davison was a terrorist and how incels were a relnoopener hrefhttpswwwtheguardiancomcommentisfree2021aug17incelmovementextremisminternetcommunitymisogyny target_blankfarrighta extremists emthe guardianem ran a a relnoopener hrefhttpswwwtheguardiancomuknews2021aug13shouldtheplymouthshootingsbedeclaredanactofterror target_blankstorya titled should the plymouth shootings be declared an act of terror quite why the headlinewriter thought it necessary to phrase the headline as a question was unclear since the whole substance of the piece sought to argue that there was little doubt that it should be declared an act of terrorp
pthen in october a relnoopener hrefhttpswwwbbccouknewsuk59010500 target_blankali harbi alia a 25yearold britishsomali man allegedly stabbed to death the conservative mp david amess the police soon declared this a terrorist incident and had a relnoopener hrefhttpsnewsskycomstoryfatalstabbingofmpsirdavidamessconfirmedasaterroristincident12435051 target_blankreferreda to a potential motivation linked to islamist extremism yet the a relnoopener hrefhttpswwwspikedonlinecom20211029davidamessandtheterrorismamnesiaindustry target_blankmain focusa of the media response was not on the political motives of the perpetrator but rather the scourge of online hate aimed at british politicians more generally as if somehow the dark corners of the internet had murdered amessp
pit gets boring to keep pointing out the doublestandard here which is that progressives are liable to deny or sanitise the political violence of those with whom they are in sympathy preeminently minorities while amplifying the political violence of their enemies preeminently the running dogs of white heteronormative patriarchy of course the right is also prone to a similar doublestandard pointing out the mental health problems of farright attackers while prioritising the role of militant religiosity in jihadi attacks but its imperative for terrorism experts and extremism researchers to resist this sort of tribal temptationp
pwhat is terrorism and who is a terrorist a lot of ink has been wasted in trying to answer this but its really not that complicated terrorism as the australian philosopher tony coady has usefully a relnoopener hrefhttpslinkspringercombook1010579780230204546 target_blankdefineda it is the organised use of violence to attack noncombatants ie civilians or their property for political purposes correspondingly a terrorist is someone who commits this kind of violencep
pthe trouble with terrorism as a concept relates not to its core meaning but to its practical application was the michigan schoolshooter a terrorist was darrell brooks the honest answer to both questions is that its still too early to tell and that both cases are complex yet its striking that only one of those questions is being publicly asked right now and its not the second onep
a hrefhttpsunherdcom202112thehypocrisyofamericasterrordebateappcommentsview 10 commentsa | pwhat isterrorism terroristtwo recent attacks america carried 39yearold black man 15yearold white teen sharply illustrate polarised confused country seemingly straightforward questionsp plast tuesday 15yearschool boyrecentlya relnoopener hrefhttpswwwindependentcouknewsworldamericascrimemichiganschoolshootingethancrumbleyb1968855html target_blanknamedaasethan crumbley allegedly shot anda relnoopener hrefhttpswwwtheguardiancomusnews2021dec01michiganhighschoolshootingvictimsidentified target_blankkilled afour fellow students injuring seven happened high school suburban detroit michigan week darrell brooks allegedly drove suv christmas parade waukesha wisconsin killing injuring relnoopener hrefhttpswwwbbccouknewsworlduscanada59396999 target_blankaccordingato witnesses appeared intentionally trying hit people victims ana relnoopener hrefhttpswwwbbccouknewsworlduscanada59396999 target_blankeightyearold boya time attack brooks bail charged running mother child domestic dispute earlier monthp pprosecutors michigan levelleda relnoopener hrefhttpswwwtheguardiancomusnews2021dec02michiganschoolshootingprosecutorexplainsrareterrorismcharge target_blankone charge terrorismaagainst crumbley addition firstdegree murder counts numerous charges charges ofa relnoopener hrefhttpswwwindependentcouknewsworldamericascrimewaukeshapolicechiefparadeterrorismb1962405html target_blankterrorismahave brought brooks insteada relnoopener hrefhttpswwwindependentcouknewswaukeshamadisonmilwaukeefoxnewspoliceb1968166html target_blankfacesasix counts firstdegree homicidestrongstrongp divdiv pthis raises sorts questions politics categorising masscausality violence schoolrampages result multiple deaths terrorise victimised conventionally classified terrorism motives carry typically personal intended political cause ideology curious authorities michigan levelled charge terrorismp pcrumbleys alleged motives unclear relnoopener hrefhttpswwwtheguardiancomusnews2021dec01michiganhighschoolshootingvictimsidentified target_blankreportedlyaleft somea relnoopener hrefhttpswwwindependentcouknewsworldamericascrimemichiganschoolshootingethancrumbleyb1968855html target_blankwritingsathat shed light thinking explaining terrorism charge cnnkaren mcdonald oakland county [michigan] prosecutor said thatcrumbley set kill injureas people possibleif thats terrorism dont know shea relnoopener hrefhttpseditioncnncom20211201usmichigandeadlyshootingterrorismchargeindexhtml target_blanksaida processa relnoopener hrefhttpstwittercommtraceystatus1466839371278172160 target_blankenlargingathe concept terrorism far standard meaning ofa relnoopener hrefhttpstwittercomdrjohnhorganstatus1466412951418679301 target_blankpoliticallymotivated violenceaagainst civilians far broader domain criminal murderousness mcdonald alsoa relnoopener hrefhttpseditioncnncom20211201usmichigandeadlyshootingterrorismchargeindexhtml target_blanknoteda way explanation terrifying close proximity student shooting killing fellow students mean terrorp diva hrefhttpsunherdcom202110themythoflonewolfterrorismrefinnara hrefhttpsunherdcom202110themythoflonewolfterrorismrefinnarimg srchttpsunherdcomwpcontentuploads2021102gettyimages1235896981scalede1634653118324300x180jpgadiva hrefhttpsunherdcom202110themythoflonewolfterrorismrefinnarspansuggested readingspanaa hrefhttpsunherdcom202110themythoflonewolfterrorismrefinnarh5the myth lonewolf terrorismh5apa hrefhttpsunherdcom202110themythoflonewolfterrorismrefinnarspanbyspan ayaan hirsi aliapdivadiv pbrookss alleged motives similarly unclear know relnoopener hrefhttpsnypostcom20211124darrellbrookscalledforviolenceagainstwhitepeople target_blankadvocatedafor attacks white people social media shared antisemitic meme praising hitler know thata relnoopener hrefhttpsacademicoupcombjcarticle59115052837 target_blankvehicular rammingsa unlike high school shootings aa relnoopener hrefhttpswwwcounterextremismcomvehiclesasweaponsofterror target_blankcommonaemmodus operandiemof terrorists scores isisinspired directed operatives example cars trucks weapons massslaughter worth noting brooks clearly harboureda relnoopener hrefhttpscontrasubstackcompthewaronamericancommunities target_blankextremist sentimentsa alleged victims relnoopener hrefhttpswwwfox2detroitcomnewscardinalsjjwattofferstopayfuneralcostsforwaukeshachristmasparadevictimsreport target_blankwhitea given terrorism charge needless brookss alleged actions terrorising receiving end themp pwhat curious incuriosity elite media extremism experts brooks case white male expressed misogynistic views women certain staged giant moral panic global menace ofa relnoopener hrefhttpsunherdcom202108whatthemediagetswrongaboutincels target_blankincelsaand farrightp pbut brooks aa relnoopener hrefhttpseditioncnncom20211122uswhatweknowaboutsuspectinwaukeshaparadetragedyindexhtml target_blankregistereda sex offender trader online hate attracted little sustained discussion concern clear im saying brooks case occasion moral panic given terrorism charge theres dont know state mind motives mental health think ask questions selection bias credentialed commentators experts command attentionp pas theemnew york postsemsohrab ahmaristrongstronghas recentlya relnoopener hrefhttpswwwtheamericanconservativecomarticlessuvsdontkillpeople target_blankdocumenteda coverage brooks case mainstream media outlets appalling emwashington postem tweet described ramming attack tragedy caused suv cbs national correspondent reference wisconsin parade crash happened unfortunate accidentif sounded coldly dispassionate euphemistic extreme emphaticallyemwasntemwas inferno alarmist online commentary outrage perpetrators vile beliefsp pthe michigan attack contrast provoked different kind commentary critical probing thomas renard director international centre counterterrorism hague relnoopener hrefhttpstwittercomtom_renardstatus1466324825127981062 target_blanktweetedathis case raises questions terrorism terrorism offence bring added value case counter productive use ct [counterterrorism] toolbox deal forms extremism pros consp prenard right michigan school shootingemdoesem raise questions extremism scholars like renard brookss alleged vehicular ramming attack emthatemcase raise questions terrorism ideologically motivated violence broadlyp pto fair renard fellow extremism researchers hadnt clocked news waukesha attack especially given attracted relatively little media attention heard apt ignore brooks wasnt charged terrorismp diva hrefhttpsunherdcom202110canwestopeveryterroristrefinnara hrefhttpsunherdcom202110canwestopeveryterroristrefinnarimg srchttpsunherdcomwpcontentuploads2021102gettyimages1235909330scalede1634576357748300x184jpgadiva hrefhttpsunherdcom202110canwestopeveryterroristrefinnarspansuggested readingspanaa hrefhttpsunherdcom202110canwestopeveryterroristrefinnarh5why prevent workh5apa hrefhttpsunherdcom202110canwestopeveryterroristrefinnarspanbyspan tom chiversapdivadiv pbut explanation holds scrutiny terrorism experts extremism researchers areemveryemonline people evidently emnotemonline hard think waukesha attack escaped noticep ptheres cottage industry counterextremist entrepreneurs thrives churning report report wider online ecosystems ofa relnoopener hrefhttpsunherdcomthepostvicenewshasanincelproblem target_blankmisogynistic hatea racialised invective odd brookss violent rhetoric past violence women didnt raise eyebrows group researchers hypervigilant comes spotting signs hatep pi suspect deeper imperatives incentives work american sociologist erving goffmana relnoopener hrefhttpswwwamazoncompresentationselfeverydaylifedp0385094027 target_blankcalleda impression management relates politics grift triumph identity politics fear running afoul puritanical scolds police meant act masscasualty violence perpetrated white male reviled figure opprobrium cosmology wesley yang relnoopener hrefhttpswwwmanhattaninstituteorgthesuccessorideology target_blanktermsathe successor ideology tempting vigorously account act familiar ritual public life purpose communicate ones virtuep pit pronounce effect care evil systemic racism durkheimian sense allows people bond morally upstanding people way emotionally seductivep pthe temptation draw attention masscasualty violence farright stronger extremism researchers decent careers researching writing jihadist groups violence makes vulnerable charge islamophobia racism gives bad conscience perspective leftleaning critics researchers area relnoopener hrefhttpswwwsuporgbookstitleid24702 target_blankguiltyaof focusing disproportionately jihadist threat perpetuating dangerous essentialist tropes islam muslimsp pnobody wants accused islamophobia racism way forestalling neutralising accusation constantly amplify threat farright course extremism researchers deny theyre business impression management trying foster righteous impression theyre sounding alarmist farright threat threat goddamn alarming ita relnoopener hrefhttpswwwspectatorcoukarticlewhyareterrorismexpertsbeingkeptawakeatnight target_blankkeeps awakeaat nightp panother reason extremism researchers transfixed farright threat unquestionably good business thea relnoopener hrefhttpswwwnytimescom20210404uspoliticsdomesticterrorismbidenhtml target_blankgrant moneyais certainly wont receive state private funding saying qanon threat exaggerated incels dangerous publisher going offer lucrative book deal foremhow terrorism overblownemp diva hrefhttpsunherdcom202109thetheatreofterrorrefinnara hrefhttpsunherdcom202109thetheatreofterrorrefinnarimg srchttpsunherdcomwpcontentuploads2021092gettyimages11615101300x169jpgadiva hrefhttpsunherdcom202109thetheatreofterrorrefinnarspanmore authorspanaa hrefhttpsunherdcom202109thetheatreofterrorrefinnarh5the theatre terrorh5apa hrefhttpsunherdcom202109thetheatreofterrorrefinnarspanbyspan simon cotteeapdivadiv pthis isnt american pathology britain recent acts lethal violence engendered different responses killing spree 22yearold man calleda relnoopener hrefhttpsthecriticcoukmassacremadetoorder target_blankjake davisona 12 minutes killed mother house shared went shoot death turning weapon devon cornwall police initially ruled terrorism motive known davison visited incel online forums disgruntled virgin prompted slew commentary davison terrorist incels relnoopener hrefhttpswwwtheguardiancomcommentisfree2021aug17incelmovementextremisminternetcommunitymisogyny target_blankfarrightaextremistsemthe guardianemran aa relnoopener hrefhttpswwwtheguardiancomuknews2021aug13shouldtheplymouthshootingsbedeclaredanactofterror target_blankstoryatitled plymouth shootings declared act terror headlinewriter thought necessary phrase headline question unclear substance piece sought argue little doubt declared act terrorp pthen octobera relnoopener hrefhttpswwwbbccouknewsuk59010500 target_blankali harbi alia 25yearold britishsomali man allegedly stabbed death conservative mp david amess police soon declared terrorist incident hada relnoopener hrefhttpsnewsskycomstoryfatalstabbingofmpsirdavidamessconfirmedasaterroristincident12435051 target_blankreferredato potential motivation linked islamist extremismyet thea relnoopener hrefhttpswwwspikedonlinecom20211029davidamessandtheterrorismamnesiaindustry target_blankmain focusaof media response political motives perpetrator scourge online hate aimed british politicians generally dark corners internet murdered amessp pit gets boring pointing doublestandard progressives liable deny sanitise political violence sympathy preeminently minorities amplifying political violence enemies preeminently running dogs white heteronormative patriarchy course right prone similar doublestandard pointing mental health problems farright attackers prioritising role militant religiosity jihadi attacks imperative terrorism experts extremism researchers resist sort tribal temptationp pwhat terrorism terrorist lot ink wasted trying answer complicated terrorism theaustralian philosopher tony coady usefullya relnoopener hrefhttpslinkspringercombook1010579780230204546 target_blankdefinedait isthe organised use violence attack noncombatants ie civilians property political purposes correspondingly terrorist commits kind violencep pthe trouble terrorism concept relates core meaning practical application michigan schoolshooter terrorist darrell brooks honest answer questions early tell cases complex striking questions publicly asked right second onep hrefhttpsunherdcom202112thehypocrisyofamericasterrordebateappcommentsview 10 commentsa |
61afe15e4b5a3edb66278025 | Australia’s draconian streak means that it is struggling to find the Covid exit lane | pin 2003 the philosopher nick bostrom wrote a paper on the existential threat posed to the universe by artificial general intelligence to illustrate his argument bostrom described a hypothetical ai whose sole goal was to manufacture as many paperclips as possible and who would resist with all its might any attempt to alter this goalbrbrintent on its mission the paperclip maximiser would destroy the earth and use the raw materials to manufacture more paperclips next it would move onto neighbouring planets and ultimately if it could the whole universebrbrthe parable of the paperclip maximiser has become well known among those who caution against the risks of ai it can also be used to demonstrate the dangers of singlemindedness more generally if you set your sights on one goal you can end up destroying everything standing in your waybrbrthe australian approach to covid19 has a whiff of the paperclip maximiser to it alongside new zealand a relnoreferrer noopener hrefhttpswwwnewstatesmancompolitics202107howfailurecovid19hasexposeddangerousdelusionfortressaustralia target_blanksocalled fortress australiaa has put some of the worlds strictest public health measures in place to protect against the disease including banning its people from leaving the countrybrbrsuggestions earlier this year that the australian state and federal governments might relent on their zerocovid strategy seem to have been forgotten as a terror of a new variant has led to the deployment of quarantine camps for travellers and anyone who has come into contact with an infected individual on 1 december three detainees who escaped from the disturbingly named centre for national resilience in howard springs northern territory were arrestedbrbranyone who has travelled to my familys home country in normal times will have noticed that it is no stranger to severe public health measures for instance australia has tough regulations on importing any plant or animal product even unwittingly once when travelling alone with my sixmonthold brother my mother was picked out by sniffer dogs at melbourne airport and forced to unpack her belongings on the floor of the baggage reclaim hall it turned out that the offending item was a plastic box containing tiny traces of baby food the customs officials were not sympatheticbrbrthe harshness of the countrys importation policies is in a relnoreferrer noopener hrefhttpswwwtheatlanticcomideasarchive202109pandemicaustraliastillliberaldemocracy619940 target_blankkeeping with the other authoritarian laws and regulationsa that often surprise foreigners familiar with australias reputation for carefree throw another shrimp on the barbie gaietybrbrin australia it is illegal to cycle without a helmet and illegal to cross the road at an intersection if a pedestrian light is red the countrys deportation laws are among the strictest in the western world not only for humans but also for animals when johnny depp brought his dogs pistol and boo with him to australia in 2015 he was told that if he did not remove the animals from the country within 72 hours they would be euthanised the incident set the hashtag waronterrier trending on twitterbrbrits therefore unsurprising that the australian federal and state governments have been so willing to pursue the authoritarian measures demanded by the zerocovid strategy and also unsurprising that voters have mostly cheered them onbrbrtheir efforts have been helped by the alarmist reporting in australian media which is effective in part because few in the country have direct experience of covid my friends dont know a single australian who has had it whereas i can think of only a handful in my british social circle who havent caught it over the past two years it is easy to overestimate the threat of an unknown dangerbrbrim not a libertarian i do accept that there are some circumstances in which the measures employed by the australian government would be necessary what i dispute is that the current circumstances merit this level of state controlbrbrcovid19 is not the black death its a nasty respiratory illness with an a relnoreferrer noopener hrefhttpswwwimperialacukmrcglobalinfectiousdiseaseanalysiscovid19report34ifr target_blankinfection fatality ratioa thats probably about ten times greater than seasonal flu although flu is more dangerous to children but we now have vaccines and the uk and australia have fully vaccinated a sizeable majority of their populations it was wrong to say in the early days of the pandemic that this disease was just flu but armed with the vaccine the comparison is aptbrand yet australia cant seem to find an offramp despite the human misery resulting from its punitive restrictions to give one example in may this year sarah haider and her husband moe were in quarantine in a brisbane hotel when she experienced pregnancy complications at 30 weeks and was taken to hospitalbrbrsarah gave birth to their son ilyas without her husband present since he was prevented from leaving the hotel with her ilyas was born by emergency csection and sarah was not allowed to hold her baby or even look at him since he was delivered behind a surgical curtain and then immediately removed from the roombrbrshe spent eight days confined to a covid quarantine ward separated from her newborn both parents were doublevaccinated and both had tested negative for the disease upon arrival in brisbane but we cant afford to take risks queenslands health minister yvette dath said when asked about the case the paperclip maximiser was intent on its goalbrbrthe australian critic clive james once quipped that the problem with his countrymen wasnt that so many of them are descended from convicts but that so many are descended from prison officers this has never felt truerbrp | pin 2003 philosopher nick bostrom wrote paper existential threat posed universe artificial general intelligence illustrate argument bostrom described hypothetical ai sole goal manufacture paperclips possible resist attempt alter goalbrbrintent mission paperclip maximiser destroy earth use raw materials manufacture paperclips neighbouring planets ultimately universebrbrthe parable paperclip maximiser known caution risks ai demonstrate dangers singlemindedness generally set sights goal end destroying standing waybrbrthe australian approach covid19 whiff paperclip maximiser alongside new zealand relnoreferrer noopener hrefhttpswwwnewstatesmancompolitics202107howfailurecovid19hasexposeddangerousdelusionfortressaustralia target_blanksocalled fortress australiaa worlds strictest public health measures place protect disease including banning people leaving countrybrbrsuggestions earlier year australian state federal governments relent zerocovid strategy forgotten terror new variant led deployment quarantine camps travellers come contact infected individual 1 december detainees escaped disturbingly named centre national resilience howard springs northern territory arrestedbrbranyone travelled familys home country normal times noticed stranger severe public health measures instance australia tough regulations importing plant animal product unwittingly travelling sixmonthold brother mother picked sniffer dogs melbourne airport forced unpack belongings floor baggage reclaim hall turned offending item plastic box containing tiny traces baby food customs officials sympatheticbrbrthe harshness countrys importation policies relnoreferrer noopener hrefhttpswwwtheatlanticcomideasarchive202109pandemicaustraliastillliberaldemocracy619940 target_blankkeeping authoritarian laws regulationsa surprise foreigners familiar australias reputation carefree throw shrimp barbie gaietybrbrin australia illegal cycle helmet illegal cross road intersection pedestrian light red countrys deportation laws strictest western world humans animals johnny depp brought dogs pistol boo australia 2015 told remove animals country 72 hours euthanised incident set hashtag waronterrier trending twitterbrbrits unsurprising australian federal state governments willing pursue authoritarian measures demanded zerocovid strategy unsurprising voters cheered onbrbrtheir efforts helped alarmist reporting australian media effective country direct experience covid friends dont know single australian think handful british social circle havent caught past years easy overestimate threat unknown dangerbrbrim libertarian accept circumstances measures employed australian government necessary dispute current circumstances merit level state controlbrbrcovid19 black death nasty respiratory illness relnoreferrer noopener hrefhttpswwwimperialacukmrcglobalinfectiousdiseaseanalysiscovid19report34ifr target_blankinfection fatality ratioa thats probably times greater seasonal flu flu dangerous children vaccines uk australia fully vaccinated sizeable majority populations wrong early days pandemic disease flu armed vaccine comparison aptbrand australia cant find offramp despite human misery resulting punitive restrictions example year sarah haider husband moe quarantine brisbane hotel experienced pregnancy complications 30 weeks taken hospitalbrbrsarah gave birth son ilyas husband present prevented leaving hotel ilyas born emergency csection sarah allowed hold baby look delivered surgical curtain immediately removed roombrbrshe spent days confined covid quarantine ward separated newborn parents doublevaccinated tested negative disease arrival brisbane cant afford risks queenslands health minister yvette dath said asked case paperclip maximiser intent goalbrbrthe australian critic clive james quipped problem countrymen wasnt descended convicts descended prison officers felt truerbrp |
61b284a0edd6b8f2324a18a6 | Behavioral Scientist’s Notable Books of 2021 | pimg sizesmaxwidth 1430px 100vw 1430px srchttpsbehavioralscientistorgwpcontentuploads202112notablebooks20211430x794jpg width1430 alt srcsethttpsbehavioralscientistorgwpcontentuploads202112notablebooks2021jpg 1430w httpsbehavioralscientistorgwpcontentuploads202112notablebooks2021300x167jpg 300w httpsbehavioralscientistorgwpcontentuploads202112notablebooks20211024x569jpg 1024w httpsbehavioralscientistorgwpcontentuploads202112notablebooks2021768x426jpg 768w classwebfeedsfeaturedvisual wppostimage height794p
pwelcome to our list of notable behavioral science books published in 2021 p
pthe end of the year is a time for looking back and for looking forward as we set intentions for the year ahead we also reflect on the year weve had we benchmark next years personal and professional expectations against this years results we count down the ball drops and we cross the threshold from our old self to newp
pto do this well we need to have a solid understanding of who we areour strengths and weaknesses biases and blindspots what motivates and supports us we also need a solid set of tools at our disposal p
pthis years notable behavioral science books provide us with both on this years list youll find books weve covered over the course of the year through excerpts commentaries and qampas as well as other new titles we wanted to introduce to you there are books that provide insight into how we make up our minds or change them the intricacies of our relationships with time technology and one another ideas for how to bring behavioral science to bear on the world and new ways of seeing old problemsthrough subtraction by noticing noise and by illuminating the essential elements of choicep
pwere pleased to invite your past and future selves to this years listp
p antonia heather and evanp
ppsyou can find our list of a relnoreferrer noopener hrefhttpsbehavioralscientistorgbehavioralsciencenotablebooksof2020 target_blanknotable behavioral science books from 2020 hereap
div classwpblockspacerdiv
hr classwpblockseparator
pemthis year were continuing our partnership with ema relnoreferrer noopener hrefhttpsbookshoporgpagesabout target_blankembookshoporgemaem a website dedicated to supporting local and independent bookstores when you purchase a book using a link below well receive a small commission that helps us sustain our nonprofit mission all of the books on this list and covered on our site are independently selected and reviewed by our editorial team bookshop is still relatively new so shipping is currently only available in the us head here for ema relnoreferrer noopener hrefhttpsukbookshoporg target_blankembookshop ukemaememp
hr classwpblockseparator
div classwpblockspacerdiv
div classwpblockspacerdiv
div classwpblockimagefigurea relnoopener hrefhttpsbookshoporga168809780807049082 target_blankimg alt width149 srchttpsbehavioralscientistorgwpcontentuploads2021129780807049082199x300jpg classwpimage34528 height225afigurediv
pstronga relnoreferrer noopener hrefhttpsbookshoporga168809780807049082 target_blankstrongthe behavioral code the hidden ways the law makes us better or worsestrongastrongbrby benjamin van rooij and adam finep
pfrom the back cover why do some laws radically change behavior whereas others are consistently ignored and routinely broken why do we keep relying on harsh punishment against crime even though it continues to fail professors benjamin van rooij and adam fine present the first accessible analysis of behavioral jurisprudence which will fundamentally alter how we understand the connection between law and human behaviorp
div classwpblockspacerdiv
div classwpblockimagefigurea relnoopener hrefhttpsbookshoporga168809781487507893 target_blankimg alt width150 srchttpsbehavioralscientistorgwpcontentuploads202106thebehaviorallyinformedorganization200x300jpg classwpimage32027 height225afigurediv
pa relnoreferrer noopener hrefhttpsbookshoporga168809781487507893 target_blankstrongthe behaviorally informed organizationstrongabredited by dilip soman and catherine yeungp
pfrom the back cover despite its centrality to organizations we do not have a good scientific framework for behavior change or a good understanding of how organizations can embed insights from behavioral science into their operations to overcome this void this book develops an overarching framework for using behavioral science it shows how behavioral insights can be embedded in organizations to achieve better outcomes improve the efficiency of processes and maximize stakeholder engagementp
pa relnoreferrer noopener hrefhttpsbehavioralscientistorgfourrolesforabehavioralscientistwithinyourorganization target_blankread an adaptationa from emthe behaviorally informed organization emon embehavioral scientistemem emdespite its clear valueadd we believe that behavioral science has still not reached its full potential within organizations we have a highly relevant and welldeveloped science of human behavior but we do not have a science of how organizations can embed insights from behavioral science into their operationsp
div classwpblockspacerdiv
div classwpblockimagefigurea relnoopener hrefhttpsbookshoporga168809780691203423 target_blankimg alt width145 srchttpsbehavioralscientistorgwpcontentuploads202106breakingthesocialmediaprismhowtomakeourplatformslesspolarizing193x300jpeg classwpimage32026 height225afigurediv
pa relnoreferrer noopener hrefhttpsbookshoporga168809780691203423 target_blankstrongbreaking the social media prism how to make our platforms less polarizingstrongabrby christopher a bailp
pfrom the back cover we use social media as a mirror to decipher our place in society but as chris bail explains it functions more like a prism that distorts our identities empowers statusseeking extremists and renders moderates all but invisible embreaking the social media prismem challenges common myths about echo chambers foreign misinformation campaigns and radicalizing algorithms revealing that the solution to political tribalism lies deep inside ourselvesp
div classwpblockspacerdiv
div classwpblockimagefigurea relnoopener hrefhttpsbookshoporga168809780691201788 target_blankimg alt width148 srchttpsbehavioralscientistorgwpcontentuploads2021129780691201788197x300webp classwpimage34530 height225afigurediv
pa relnoreferrer noopener hrefhttpsbookshoporga168809780525575238 target_blankastronga relnoreferrer noopener hrefhttpsbookshoporga168809780691201788 target_blankstrongcareer and family womens centurylong journey toward equitystrongastrongbrby claudia goldinp
pfrom the back cover claudia goldin provides a fresh indepth look at the diverse experiences of collegeeducated women from the 1900s to today examining the aspirations they formedand the barriers they facedin terms of career job marriage and children she shows how many professions are greedy paying disproportionately more for long hours and weekend work and how this perpetuates disparities between women and menp
pa relnoreferrer noopener hrefhttpsbehavioralscientistorghowgreedyworkmorethanbiasexplainsthepersistentgenderwagegap target_blankread our qampaa with the author [egalitarianminded couples] want to pursue what i call couple equity but instead when they have children or some other very important care responsibilities in which at least one of them will need to have a job with a certain amount of flexibility they have to then ask themselves how much are we willing to pay for this equity equity may be expensive and the expense is due to the notion of greedy workp
div classwpblockspacerdiv
div classwpblockimagefigurea relnoopener hrefhttpsbookshoporga168809780525575238 target_blankimg altchatter ethan kross width149 srchttpsbehavioralscientistorgwpcontentuploads202012chatter199x300jpg classwpimage26054 height225afigurediv
pa relnoreferrer noopener hrefhttpsbookshoporga168809780525575238 target_blankstrongchatter the voice in our head why it matters and how to harness itstrongabrby ethan krossp
pfrom the back cover ethan kross explores the silent conversations we have with ourselves interweaving groundbreaking behavioral and brain research from his own lab with realworld case studiesfrom a pitcher who forgets how to pitch to a harvard undergrad negotiating her double life as a spykross explains how these conversations shape our lives work and relationshipsp
pa relnoreferrer noopener hrefhttpsbehavioralscientistorghowtochannelyourmindsinnerchatter target_blankread an excerpta of emchatterem on embehavioral scientistem although the inner voice functions well much of the time it often leads to chatterthe cyclical negative thoughts and emotions that turn our singular capacity for introspection into a curse rather than a blessing this often happens precisely when we need our inner voice the mostwhen our stress is up the stakes are high and we encounter difficult emotions that call for the utmost poisep
div classwpblockspacerdiv
div classwpblockimagefigurea relnoopener hrefhttpsbookshoporga168809781101981641 target_blankimg alt width149 srchttpsbehavioralscientistorgwpcontentuploads202106druguseforgrownupschasinglibertyinthelandoffear199x300jpg classwpimage32028 height225afigurediv
pa relnoreferrer noopener hrefhttpsbookshoporga168809781101981641 target_blankstrongdrug use for grownups chasing liberty in the land of fearstrongabrby carl l hartp
pfrom the back cover [carl l hart] draws on decades of research and his own personal experience to argue definitively that the criminalization and demonization of drug usenot drugs themselveshave been a tremendous scourge on america not least in reinforcing this countrys enduring structural racismp
div classwpblockspacerdiv
div classwpblockimagefigurea relnoopener hrefhttpsbookshoporga168809780593084434 target_blankimg alt width149 srchttpsbehavioralscientistorgwpcontentuploads2021129780593084434199x300webp classwpimage34531 height225afigurediv
pa relnoreferrer noopener hrefhttpsbookshoporga168809781101981641 target_blankastronga relnoreferrer noopener hrefhttpsbookshoporga168809780593084434 target_blankstrongthe elements of choice why the way we decide mattersstrongastrongbrby eric j johnsonp
pfrom the back cover going well beyond the familiar concepts of nudges and defaults emthe elements of choiceem offers a comprehensive systematic guide to creating effective choice architectures the environments in which we make decisions the designers of decisions need to consider all the elements involved in presenting a choice how many options to offer how to present those options how to account for our natural cognitive shortcuts and much morep
pa relnoreferrer noopener hrefhttpsbehavioralscientistorghowthenetflixchoiceenginetriestomaximizehappinessperdollarspent_ux_ui target_blankread an excerpta from emthe elements of choice emon embehavioral scientistem its friday night after a long week and youre definitely going to relax and watch a movie so you turn to netflix the worlds largest streaming service it is also the prototypical choice engine its goal is to help you find something to watch it does not just passively present options it tries to customize the set of things that you see it gives you some control over what is presented and it even helps you comprehend new options you might likep
div classwpblockspacerdiv
div classwpblockimagefigurea relnoopener hrefhttpsbookshoporga168809781984881755 target_blankimg alt width149 srchttpsbehavioralscientistorgwpcontentuploads202108ffcover199x300jpeg classwpimage33508 height225afigurediv
pa relnoreferrer noopener hrefhttpsbookshoporga168809781984881755 target_blankstrongthe family firm a datadriven guide to better decision making in the early school yearsstrongabrby emily osterp
pfrom the back cover professor of economics and mom of two emily oster offers a classic business school framework for datadriven parents to think more deliberately about the key issues of the elementary years school health extracurricular activities and morep
pa relnoreferrer noopener hrefhttpsbehavioralscientistorgdatadrivenparentingaconversationwithemilyosterfamilyfirm target_blankread our qampaa with the author samuel salzer and aline holzwarth speak to emily oster about datadriven parenting during the elementary school yearsp
div classwpblockspacerdiv
div classwpblockimagefigurea relnoopener hrefhttpsbookshoporga168809780374159122 target_blankimg alt width146 srchttpsbehavioralscientistorgwpcontentuploads2021124000195x300jpg classwpimage34570 height225afigurediv
pa relnoreferrer noopener hrefhttpsbookshoporga168809780374159122 target_blankstrongfour thousand weeks time management for mortalsstrongabrby oliver burkemanp
pfrom the back cover the average human lifespan is absurdly insultingly brief assuming you live to be eighty you have just over four thousand weeks drawing on the insights of both ancient and contemporary philosophers psychologists and spiritual teachers oliver burkeman delivers an entertaining humorous practical and ultimately profound guide to time and time management rejecting the futile modern obsession with getting everything done emfour thousand weeksem introduces readers to tools for constructing a meaningful life by embracing finitude showing how many of the unhelpful ways weve come to think about time arent inescapable unchanging truths but choices weve made as individuals and as a societyand that we could do things differentlyp
div classwpblockspacerdiv
div classwpblockimagefigurea relnoopener hrefhttpsbookshoporga168809781982128562 target_blankimg alt width149 srchttpsbehavioralscientistorgwpcontentuploads202106highconflictwhywegettrappedandhowwegetout199x300jpeg classwpimage32031 height225afigurediv
pa relnoreferrer noopener hrefhttpsbookshoporga168809781982128562 target_blankstronghigh conflict why we get trapped and how we get outstrongabrby amanda ripleyp
pfrom the back cover high conflict is what happens when discord distills into a goodversusevil kind of feud the kind with an us and a them in this state the normal rules of engagement no longer apply the brain behaves differently we feel increasingly certain of our own superiority and at the same time more and more mystified by the other side amanda ripley investigates how good people get captured by high conflictand how they break freep
div classwpblockspacerdiv
div classwpblockimagefigurea relnoopener hrefhttpsbookshoporga168809780593083758 target_blankimg alt width149 srchttpsbehavioralscientistorgwpcontentuploads202105htccover199x300jpeg classwpimage31793 height225afigurediv
pa relnoreferrer noopener hrefhttpsbookshoporga168809780593083758 target_blankstronghow to change the science of getting from where you are to where you want to bestrongabrby katy milkmanstrong strongp
pfrom the back cover in a career devoted to uncovering what helps people change milkman has discovered a crucial thing many of us get wrong our strategy change shes learned comes most readily when you understand whats standing between you and success and tailor your solution to that roadblockp
pa relnoreferrer noopener hrefhttpsbehavioralscientistorgtokickstartanewbehaviorcopyandpastekatymilkmanhowtochange target_blankread an excerpta of emhow to changeem on embehavioral scientistem we found that encouraging people to copy and paste one anothers best life hacks motivated both more exercise and better class preparation in adults who wanted to work out more and college students seeking to improve their grades respectively when were unsure of ourselves a powerful way the people around us can help boost our capacity and condence is by showing us whats possiblep
pa relnoreferrer noopener hrefhttpsbehavioralscientistorgspeakingwithkatymilkmanabouthowtochange target_blankread our qampaa with the author i think theres an overemphasis on big goals its not that goals arent useful theres tons of research showing that having a certain kind of goala clear concrete achievable goal or a stretch goalreally is valuable but its not solving a problem you still have to deal with the challenges of procrastination temptation forgetting selfefficacy and whether or not your peers are supporting you p
div classwpblockspacerdiv
div classwpblockimagefigurea relnoopener hrefhttpswwwindieboundorgbook9781982120627 target_blankimg altthe suprising science that will help you find love width149 srchttpsbehavioralscientistorgwpcontentuploads202012howtonotdiealone199x300jpg classwpimage26057 height225afigurediv
pa relnoreferrer noopener hrefhttpswwwindieboundorgbook9781982120627 target_blankstronghow to not die alone the surprising science that will help you find lovestrongabrby logan uryp
pfrom the back cover great relationships dont just appear in our livestheyre the culmination of a series of decisions including when to get out there whom to date how to end it with the wrong person when to commit to the right one and everything in between but our brains often get in the way we make poor decisions which thwart us on our quest to find lasting love logan ury reveals the hidden forces that cause those mistakesp
pa relnoreferrer noopener hrefhttpsbehavioralscientistorgmasteringmodernloveloganuryonbuildingbetterrelationshipsthroughbehavioralscience target_blankread our qampaa with the author dating apps unfortunately perpetuate some of the superficiality and people focus on those things more as opposed to what they should be focusing on the things that we know relationship science has found are correlated with longterm relationship success things like kindness loyalty emotional stability the ability to make hard decisions together a growth mindset and perhaps most importantly what side of you they bring outp
div classwpblockspacerdiv
div classwpblockimagefigurea relnoopener hrefhttpswwwharpercollinscomproductsinfluencenewandexpandedrobertbcialdinivariant32903969996834 target_blankimg alt width149 srchttpsbehavioralscientistorgwpcontentuploads202106influencenewandexpandedthepsychologyofpersuasion198x300jpeg classwpimage32037 height225afigurediv
pa relnoreferrer noopener hrefhttpswwwharpercollinscomproductsinfluencenewandexpandedrobertbcialdinivariant32903969996834 target_blankstronginfluence new and expanded the psychology of persuasionstrongabrby robert b cialdinip
pfrom the back cover in the new edition [robert cialdini] explains the psychology of why people say yes and how to apply these insights ethically in business and everyday settingsp
div classwpblockspacerdiv
div classwpblockimagefigurea relnoopener hrefhttpsbookshoporga168809781541672840 target_blankimg alt width145 srchttpsbehavioralscientistorgwpcontentuploads202106knowthyselfthescienceofselfawareness193x300jpeg classwpimage32038 height225afigurediv
pa relnoreferrer noopener hrefhttpsbookshoporga168809781541672840 target_blankstrongknow thyself the science of selfawarenessstrongabrby stephen m flemingp
pfrom the back cover how do we know what we and others knowor as importantly dont know as cognitive neuroscientist stephen fleming shows in emknow thyselfem we do this with metacognition metacognition or thinking about thinking is the most important tool we have for understanding our own mind metacognition is an awesome power it is what enables selfawareness as well as what lets us think about the minds of others it is the ultimate human trait and in its most rarefied forms is a power that neither other animals nor our current artificial intelligences havep
div classwpblockspacerdiv
div classwpblockimagefigurea relnoopener hrefhttpsbookshoporga168809780691214917 target_blankimg alt width145 srchttpsbehavioralscientistorgwpcontentuploads202106mindswideshuthowthenewfundamentalismsdivideus193x300jpeg classwpimage32039 height225afigurediv
pa relnoreferrer noopener hrefhttpsbookshoporga168809780691214917 target_blankstrongminds wide shut how the new fundamentalisms divide usstrongabrby gary saul morson and morton schapirop
pfrom the back cover morson and schapiro examine how rigid adherence to ideological thinking has altered politics economics religion and literature in ways that are mutually reinforcing and antithetical to the openmindedness and readiness to compromise that animate democracy in response they propose alternatives that would again make serious dialogue possiblep
pa relnoreferrer noopener hrefhttpsbehavioralscientistorgwecanallbefundamentalistsandfundamentalismiseverywhere target_blankread our qampaa with the authors gary saul morson and morton schapiro instead of professing that we embelieveem in science morson explained we should respect the scientific method and the spirit behind it which involves the careful weighing of evidence testing ideas by those who doubt them and arriving step by careful step at the best available answer subject to revision in the light of future evidencep
div classwpblockspacerdiv
div classwpblockimagefigurea relnoopener hrefhttpsbookshoporga168809780385544726 target_blankimg alt width148 srchttpsbehavioralscientistorgwpcontentuploads202106minehowthehiddenrulesofownershipcontrolourlives197x300jpeg classwpimage32040 height225afigurediv
pa relnoreferrer noopener hrefhttpsbookshoporga168809780385544726 target_blankstrongmine how the hidden rules of ownership control our livesstrongabrby michael heller and james salzmanp
pfrom the back cover a hidden set of rules governs who owns whatexplaining everything from whether you can recline your airplane seat to why hbo lets you borrow a password illegallyand in this lively and entertaining guide two acclaimed law professors reveal how things become minep
div classwpblockspacerdiv
div classwpblockimagefigurea relnoopener hrefhttpsbookshoporga168809781250296108 target_blankimg alt width147 srchttpsbehavioralscientistorgwpcontentuploads202106thenewbreedwhatourhistorywithanimalsrevealsaboutourfuturewithrobots196x300jpeg classwpimage32041 height225afigurediv
pa relnoreferrer noopener hrefhttpsbookshoporga168809781250296108 target_blankstrongthe new breed what our history with animals reveals about our future with robotsstrongabrby kate darlingp
pfrom the back cover there has been a lot of ink devoted to discussions of how robots will replace us and take our jobs but mit media lab researcher and technology policy expert kate darling argues just the opposite and that treating robots with a bit of humanity more like the way we treat animals will actually serve us betterp
pa relnoreferrer noopener hrefhttpsbehavioralscientistorgwhatourpetscantellusaboutourfuturewithrobots target_blankread our qampaa with the author it always bothered me that we are limiting ourselves and falling into this technological determinism that robots can will and should replace people and i just feel like animals are such a salient analogy that everyone gets [an animal] is also this autonomous thing that can sense think make decisions and learn that weve dealt with previouslyp
div classwpblockspacerdiv
div classwpblockimagefigurea relnoopener hrefhttpsbookshoporga168809781541758230 target_blankimg alt width148 srchttpsbehavioralscientistorgwpcontentuploads202106thenewclimatewarthefighttotakebackourplanet197x300jpeg classwpimage32042 height225afigurediv
pa relnoreferrer noopener hrefhttpsbookshoporga168809781541758230 target_blankstrongthe new climate war the fight to take back our planetstrongabrby michael e mannp
pfrom the back cover recycle fly less eat less meat these are some of the ways that weve been told can slow climate change but the inordinate emphasis on individual behavior is the result of a marketing campaign that has succeeded in placing the responsibility for fixing climate change squarely on the shoulders of individualsp
pa relnoreferrer noopener hrefhttpsbehavioralscientistorgurgencyandagencymichaelmannonconqueringclimatedespair target_blankread our qampaa with the author those who are framing it as a tipping point weve crossed as if its too late to do anythingthose narratives are steeped in distortions of the science that are almost as bad if not as bad as distortions of the science on the denialist sidep
div classwpblockspacerdiv
div classwpblockimagefigurea relnoopener hrefhttpsbookshoporga168809780316451406 target_blankimg alt width145 srchttpsbehavioralscientistorgwpcontentuploads202106noiseaflawinhumanjudgment193x300jpeg classwpimage32043 height225afigurediv
pa relnoreferrer noopener hrefhttpsbookshoporga168809780316451406 target_blankstrongnoise a flaw in human judgmentstrongabrby daniel kahneman oliver sibony and cass r sunsteinp
pfrom the back cover in emnoiseem daniel kahneman olivier sibony and cass r sunstein show the detrimental effects of noise in many fields including medicine law economic forecasting forensic science bail child protection strategy performance reviews and personnel selection wherever there is judgment there is noise yet most of the time individuals and organizations alike are unaware of it they neglect noise with a few simple remedies people can reduce both noise and bias and so make far better decisionsp
pa relnoreferrer noopener hrefhttpsbehavioralscientistorgaconversationwithdanielkahnemanaboutnoise target_blankread our qampaa with author daniel kahneman ive been studying bias all my life but a few years ago encountered an instance of noise and i was very impressed both by how much noise there was among underwriters judging exactly the same thing and mostly i was impressed by how little people knew about itp
div classwpblockspacerdiv
div classwpblockimagefigurea relnoopener hrefhttpsbookshoporga168809780143137009 target_blankimg alt width147 srchttpsbehavioralscientistorgwpcontentuploads202108nudgecover196x300jpeg classwpimage33409 height225afigurediv
pa relnoreferrer noopener hrefhttpsbookshoporga168809780143137009 target_blankstrongnudge the final editionstrongabrby richard h thaler and cass r sunsteinp
pfrom the back cover the authors have rewritten the book from cover to cover making use of their experiences in and out of government over the past dozen years as well as an explosion of new research in numerous academic disciplines to commit themselves to never undertaking this daunting task again they are calling this the final edition it offers a wealth of new insights for both its avowed fans and newcomers to the field about a wide variety of issues that we face in our daily livescovid19 health personal finance retirement savings credit card debt home mortgages medical care organ donation climate change and sludge paperwork and other nuisances we dont want and that keep us from getting what we do wantall while honoring one of the cardinal rules of nudging make it funp
pa relnoreferrer noopener hrefhttpsbehavioralscientistorgfivetakeawaysfromourconversationwithrichardthaleraboutthepastpresentandfutureofnudge target_blankread or watch our qampaa with author richard thaler the release of new emnudgeem provided the occasion for our recent conversation but our conversation went beyond the book we corrected the record on organ donation he revealed why he wished the original subtitle included the phrase choice architecture his thoughts on replication in behavioral economics and what advice hed give organizations looking to apply behavioral sciencep
div classwpblockspacerdiv
div classwpblockimagefigurea relnoopener hrefhttpsbookshoporga168809780262045865 target_blankimg alt width149 srchttpsbehavioralscientistorgwpcontentuploads2021129780262045865199x300jpg classwpimage34532 height225afigurediv
pa relnoreferrer noopener hrefhttpsbookshoporga168809781524743802 target_blankastronga relnoreferrer noopener hrefhttpsbookshoporga168809780262045865 target_blankstrongof sound mind how our brain constructs a meaningful sonic worldstrongastrongbrby nina krausp
pfrom the back cover making sense of sound is one of the hardest jobs we ask our brains to do in emof sound mindem nina kraus examines the partnership of sound and brain showing for the first time that the processing of sound drives many of the brains core functions our hearing is always onwe cant close our ears the way we close our eyesand yet we can ignore sounds that are unimportant we dont just hear we engage with sounds kraus explores what goes on in our brains when we hear a wordor a chord or a meow or a screechp
div classwpblockspacerdiv
div classwpblockimagefigurea relnoopener hrefhttpsbookshoporga168809780316538411 target_blankimg alt width146 srchttpsbehavioralscientistorgwpcontentuploads2021129780316538411194x300webp classwpimage34533 height225afigurediv
pa relnoreferrer noopener hrefhttpsbookshoporga168809781250262820 target_blankastronga relnoreferrer noopener hrefhttpsbookshoporga168809780316538411 target_blankstrongthe power of us harnessing our shared identities to improve performance increase cooperation and promote social harmonystrongastrongbrby jay van bavel amp dominic jay packerp
pfrom the back cover if youre like most people you probably believe that your identity is stable but in fact your identity is constantly changingoften outside your conscious awareness and sometimes even against your wishesto reflect the interests of the groups you belong to in emthe power of usem psychologists dominic packer and jay van bavel integrate their own cuttingedge research in psychology and neuroscience to explain how identity really works and how to harness its dynamic naturep
pa relnoreferrer noopener hrefhttpsbehavioralscientistorgpowerofusfromstrangerstoteammateshowgettingonthesamewavelengthmightbemorethanametaphor target_blankread an adaptationa from emthe power of us emon embehavioral scientistem a sense of common fate produces a shared identity the knowledge that we together are part of a group in turn that shared identity produces solidarity and the ability to work together collectively when they cohere shared identities become foundations on which people can coordinate and cooperate it allows them to face and overcome a crisis that might have been difficult to address alonep
div classwpblockspacerdiv
div classwpblockimagefigurea relnoopener hrefhttpsbookshoporga168809780525561996 target_blankimg alt width149 srchttpsbehavioralscientistorgwpcontentuploads2021129780525561996199x300webp classwpimage34534 height225afigurediv
pa relnoreferrer noopener hrefhttpsbookshoporga168809780525561996 target_blankstrongrationality what it is why it seems scarce why it mattersstrongabrby steven pinkerp
pfrom the back cover pinker rejects the cynical clich that humans are simply irrationalcavemen out of time saddled with biases fallacies and illusions after all we discovered the laws of nature lengthened and enriched our lives and set out the benchmarks for rationality itself we actually think in ways that are sensible in the lowtech contexts in which we spend most of our lives but fail to take advantage of the powerful tools of reasoning weve discovered over the millennia logic critical thinking probability correlation and causation and optimal ways to update beliefs and commit to choices individually and with othersp
pa relnoreferrer noopener hrefhttpsbehavioralscientistorgstevenpinkerrationalitywhyyoushouldalwaysswitchthemontyhallproblemfinallyexplained target_blankread an excerpta from emrationality emon embehavioral scientistem the godlike host reminds us how exotic the monty hall problem is it requires an omniscient being who defies the usual goal of a conversationto share what the hearer needs to know in this case which door hides the carand instead pursues the goal of enhancing suspense among third parties and unlike the world whose clues are indifferent to our sleuthing monty almighty knows the truth and knows our choice and picks his revelation accordinglyp
div classwpblockspacerdiv
div classwpblockimagefigurea relnoopener hrefhttpsbookshoporga168809781524743802 target_blankimg alt width149 srchttpsbehavioralscientistorgwpcontentuploads202112socialchemistrydecodingthepatternsofhumanconnection199x300jpeg classwpimage34535 height225afigurediv
pa relnoreferrer noopener hrefhttpsbookshoporga168809781524743802 target_blankstrongsocial chemistry decoding the patterns of human connectionstrongabrby marissa kingp
pfrom the back cover conventional wisdom says its the size of your network that matters but social science research has proven there is more to it king explains that the quality and structure of our relationships has the greatest impact on our personal and professional livesp
div classwpblockspacerdiv
div classwpblockimagefigurea relnoopener hrefhttpsbookshoporga168809781250262820 target_blankimg alt width148 srchttpsbehavioralscientistorgwpcontentuploads202106thesocialinstincthowcooperationshapedtheworld197x300jpeg classwpimage32045 height225afigurediv
pa relnoreferrer noopener hrefhttpsbookshoporga168809781250262820 target_blankstrongthe social instinct how cooperation shaped the worldstrongabrby nichola raihanip
pfrom the back cover [nichola raihani] reveals that the species that exhibit cooperative behaviorteaching helping grooming and selfsacrificemost similar to our own tend not to be other apes they are birds insects and fish occupying far more distant branches of the evolutionary tree by understanding the problems they face and how they cooperate to solve them we can glimpse how human cooperation first evolvedp
div classwpblockspacerdiv
div classwpblockimagefigurea relnoopener hrefhttpsbookshoporga168809781250249869 target_blankimg alt width148 srchttpsbehavioralscientistorgwpcontentuploads202104subtract_cover197x300jpg classwpimage30340 height225afigurediv
pa relnoreferrer noopener hrefhttpsbookshoporga168809781250249869 target_blankstrongsubtract the untapped science of lessstrongabrby leidy klotzp
pfrom the back cover we pile on todos but dont consider stopdoings we create incentives for good behavior but dont get rid of obstacles to it we collect newandimproved ideas but dont prune the outdated ones every day across challenges big and small we neglect a basic way to make things better we dont subtractp
pa relnoreferrer noopener hrefhttpsbehavioralscientistorgsubtractwhygettingtolesscanmeanthinkingmore target_blankread an adaptationa from emsubtractem on embehavioral scientistem subtraction is the act of getting to less but it is not the same as doing less in fact getting to less often means doing or at least thinking morep
div classwpblockspacerdiv
div classwpblockimagefigurea relnoopener hrefhttpsbookshoporga168809780062910561 target_blankimg alt width149 srchttpsbehavioralscientistorgwpcontentuploads2021129780062910561199x300webp classwpimage34536 height225afigurediv
pa relnoreferrer noopener hrefhttpsbookshoporga168809780062910561 target_blankstrongthe sweet spot the pleasures of suffering and the search for meaningstrongabrby paul bloomp
pfrom the back cover we are not natural hedonistsa good life involves more than pleasure people seek lives of meaning and significance we aspire to rich relationships and satisfying pursuits and this requires some amount of struggle anxiety and loss brilliantly argued witty and humane paul bloom shows how a life without chosen suffering would be emptyand worse than that boringp
pa relnoreferrer noopener hrefhttpsbehavioralscientistorgpaulbloomsweetspotunderstandingthepleasurepainparadox target_blankread an excerpta from emthe sweet spot emon embehavioral scientistem once you look for paradoxical reactions you see them everywhere we laugh at whats funny but we also laugh when anxious or embarrassed we grin when happy but sometimes we grin when angry smiling is associated with joy but when researchers asked people to watch a sad movie scenethe part of emsteel magnoliasem where a woman is speaking at the funeral of her adult daughterabout half of the subjects smiledp
div classwpblockspacerdiv
div classwpblockimagefigurea relnoopener hrefhttpsbookshoporga168809781984878106 target_blankimg altthe power of knowing what you dont know width149 srchttpsbehavioralscientistorgwpcontentuploads202012thinkagain199x300jpg classwpimage26062 height225afigurediv
pa relnoreferrer noopener hrefhttpsbookshoporga168809781984878106 target_blankstrongthink again the power of knowing what you dont knowstrongabrby adam grantp
pfrom the back cover too many of us favor the comfort of conviction over the discomfort of doubt we listen to opinions that make us feel good instead of ideas that make us think hard [grant] investigates how we can embrace the joy of being wrong bring nuance to charged conversations and build schools workplaces and communities of lifelong learnersp
pa relnoreferrer noopener hrefhttpsbehavioralscientistorgyourideasarenotyouridentityadamgrantonhowtogetbetteratchangingyourmind target_blankread our qampaa with the author i do not want to have bothsides conversations anymore whenever somebody says heres the other side my first question is can you tell me what the third angle and the fourth look likep
div classwpblockspacerdiv
div classwpblockimagefigurea relnoopener hrefhttpsbookshoporga168809781913019358 target_blankimg alt width144 srchttpsbehavioralscientistorgwpcontentuploads202111designingtransportcover192x300jpeg classwpimage34368 height225afigurediv
pa relnoreferrer noopener hrefhttpsbookshoporga168809781913019358 target_blankstrongtransport for humans are we nearly there yetstrongabrby pete dyson and rory sutherlandp
pfrom the back cover engineers plan transport systems people use them but the ways in which an engineer measures successspeed journey time efficiencyare often not the way that passengers think about a good trip we are not cargo we choose how and when to travel influenced not only by speed and time but by habit status comfort varietyand many other factors that engineering equations dont capture at allp
pa relnoreferrer noopener hrefhttpsbehavioralscientistorgdesigningtransportforhumansnotecons target_blankread an adaptationa from emtransport for humans emon embehavioral scientistem the greatest fallacy is that travel time is wasted time so the only option is to speed it up or cut it out in reality we need to invest in higherquality travel for more people while also enabling some people to travel less or by different meansp
div classwpblockspacerdiv
div classwpblockimagefigurea relnoopener hrefhttpsbookshoporga168809780393652208 target_blankimg alt width148 srchttpsbehavioralscientistorgwpcontentuploads202103usefuldelusionscover197x300jpg classwpimage28008 height225afigurediv
pa relnoreferrer noopener hrefhttpsbookshoporga168809780393652208 target_blankstronguseful delusions the power and paradox of the selfdeceiving brainstrongabrby shankar vedantam and bill meslerstrong strongp
pfrom the back cover everyone agrees that lies and selfdeception can do terrible harm to our lives to our communities and to the planet but in emuseful delusionsem host of hidden brain shankar vedantam argues that paradoxically deceiving ourselves and others can also play a vital role in human success and wellbeing the lies we tell each other and the lies that we tell ourselves sustain our daily interactions with friends lovers and coworkers they explain why some people live longer than others why some couples remain in love and others dont why some nations and tribes hold together while others splinterp
pa relnoreferrer noopener hrefhttpsbehavioralscientistorgtheusefulnessofourdelusions target_blankread an excerpta of emuseful delusionsem on embehavioral scientistem rather than seek to annihilate selfdeception and all it represents a better goal would be to think carefully about what it does and ask ourselves how we can work with it in other words we ought to care less about whether something is simply true or untrue and ask more complicated questions what are the consequences of selfdeception whom does it serve do the benefits justify the costsp
div classwpblockspacerdiv
div classwpblockimagefigurea relnoopener hrefhttpsbookshoporga168809780231197403 target_blankimg alt width149 srchttpsbehavioralscientistorgwpcontentuploads202106thewayout199x300jpeg classwpimage32129 height225afigurediv
pa relnoreferrer noopener hrefhttpsbookshoporga168809780231197403 target_blankstrongthe way out how to overcome toxic polarizationstrongabrby peter t colemanp
pfrom the back cover surveys show that americans have become more fearful and hateful of supporters of the opposing political party and imagine that they hold much more extreme views than they actually do we have cordoned ourselves off we prefer to date and marry those with similar opinions and are less willing to spend time with people on the other side how can we loosen the grip of this toxic polarization and start working on our most pressing problemsp
pa relnoreferrer noopener hrefhttpsbehavioralscientistorgtoxicpolarizationfeedsonsimplicitypetercolemanofferscomplexityasawayout target_blankread our qampaa with the author quotwith the kinds of polarization that were in today we have to understand them as complex systems that stabilize into strong patterns that resist change and even good faith attempts of changing themquotp
div classwpblockspacerdiv
div classwpblockimagefigurea relnoopener hrefhttpsbookshoporga168809780300257328 target_blankimg alt width149 srchttpsbehavioralscientistorgwpcontentuploads2021129780300257328199x300webp classwpimage34537 height225afigurediv
pa relnoreferrer noopener hrefhttpsbookshoporga168809780300257328 target_blankstrongthe week a history of the unnatural rhythms that make us who we arestrongabrby david m henkinp
pfrom the back cover reconstructing how weekly patterns insinuated themselves into the social practices and mental habits of americans henkin argues that the week is more than just a regimen of rest days or breaks from work but a dominant organizational principle of modern society ultimately the sevenday week shapes our understanding and experience of timep
div classwpblockspacerdiv
div classwpblockimagefigurea relnoopener hrefhttpsbookshoporga168809781324002833 target_blankimg alt width147 srchttpsbehavioralscientistorgwpcontentuploads202106whenbrainsdreamexploringthescienceandmysteryofsleep196x300jpeg classwpimage32051 height225afigurediv
pa relnoreferrer noopener hrefhttpsbookshoporga168809781324002833 target_blankstrongwhen brains dream exploring the science and mystery of sleepstrongabrby antonio zadra and robert stickgoldp
pfrom the back cover emwhen brains dreamem reveals recent discoveries about the sleeping brain and the many ways in which dreams are psychologically and neurologically meaningful experiences explores a host of dreamrelated disorders and explains how dreams can facilitate creativity and be a source of personal insightp
pa relnoreferrer noopener hrefhttpsbehavioralscientistorgwhatdreamsmaycomeandwhyandhow target_blankread our qampaa with author robert stickgold salvador dal sat in an armchair with his hand on the arm of the chair hed hold a key right over the end of the chair and think about a painting he wanted to make as he fell asleep the key dropped and woke him up and he got an image in his mind he got these images that he then painted [my colleague adam horowitz] wants to ask the question can everybody harness it and the answer is they probably canp
div classwpblockspacerdiv
div classwpblockimagefigurea relnoopener hrefhttpsbookshoporga168809780525536550 target_blankimg alt width149 srchttpsbehavioralscientistorgwpcontentuploads202106aworldwithoutemailreimaginingworkinanageofcommunicationoverload199x300jpg classwpimage32052 height225afigurediv
pa relnoreferrer noopener hrefhttpsbookshoporga168809780525536550 target_blankstronga world without email reimagining work in an age of communication overloadstrongabrby cal newportp
pfrom the back cover we have become so used to an inboxdriven workday that its hard to imagine alternatives but they do exist drawing on years of investigative reporting author and computer science professor cal newport makes the case that our current approach to work is broken then lays out a series of principles and concrete instructions for fixing itp
div classwpblockspacerdiv
div classwpblockimagefigurea relnoopener hrefhttpsbookshoporga168809781324005711 target_blankimg alt width148 srchttpsbehavioralscientistorgwpcontentuploads2021129781324005711197x300webp classwpimage34538 height225afigurediv
pa relnoreferrer noopener hrefhttpsbookshoporga168809781324005711 target_blankstrongyou have more influence than you think how we underestimate our power of persuasion and why it mattersstrongabrby vanessa bohnsp
pfrom the back cover whether attending a meeting sharing a post online or mustering the nerve to ask for a favor we often assume our actions input and requests will be overlooked or rejected bohns and her work demonstrate that people see us listen to us and agree to do things for us much more than we realizefor better and worsep
pa relnoreferrer noopener hrefhttpsbehavioralscientistorgnoneedtoshoutrecognizingtheinfluencethatsalreadyyours target_blankread an adaptationa from emyou have more influence than you think emon embehavioral scientistem while the times youve tried and failed to influence someone may loom large there are undoubtedly far more examples of times youve influenced someone without trying at alland without ever seeing the influence you had on the other hand this also means there have likely been times you influenced someone unintentionally in ways you may even wish you hadntp
hr classwpblockseparator
pemdisclosure leidy klotz katy milkman and dilip soman are members of organizations which provided financial support to embehavioral scientist emin 2021 richard thaler and emily oster are members of the embehavioral scientistsem advisory board emadvisory board members and organizational donors do not play a role in the editorial decisions of the magazineemem emevan nesterak of embehavioral scientist emserved as an editorial consultant on the books emchatterem and emsubtractem all of the books on this list and covered on our site are independently selected and reviewed by our editorial team emp
pthe post a relnofollow hrefhttpsbehavioralscientistorgbehavioralscientistsnotablebooksof2021behavioral scientists notable books of 2021a appeared first on a relnofollow hrefhttpsbehavioralscientistorgbehavioral scientistap | pimg sizesmaxwidth 1430px 100vw 1430px srchttpsbehavioralscientistorgwpcontentuploads202112notablebooks20211430x794jpg width1430 alt srcsethttpsbehavioralscientistorgwpcontentuploads202112notablebooks2021jpg 1430w httpsbehavioralscientistorgwpcontentuploads202112notablebooks2021300x167jpg 300w httpsbehavioralscientistorgwpcontentuploads202112notablebooks20211024x569jpg 1024w httpsbehavioralscientistorgwpcontentuploads202112notablebooks2021768x426jpg 768w classwebfeedsfeaturedvisual wppostimage height794p pwelcome list notable behavioral science books published 2021p pthe end year time looking looking forward set intentions year ahead reflect year weve benchmark years personal professional expectations years results count ball drops cross threshold old self newp pto need solid understanding areour strengths weaknesses biases blindspots motivates supports need solid set tools disposalp pthis years notable behavioral science books provide years list youll find books weve covered course year excerpts commentaries qampas new titles wanted introduce books provide insight minds change intricacies relationships time technology ideas bring behavioral science bear world new ways seeing old problemsthrough subtraction noticing noise illuminating essential elements choicep pwere pleased invite past future selves years listp p antonia heather evanp ppsyou find list relnoreferrer noopener hrefhttpsbehavioralscientistorgbehavioralsciencenotablebooksof2020 target_blanknotable behavioral science books 2020 hereap div classwpblockspacerdiv hr classwpblockseparator pemthis year continuing partnership ema relnoreferrer noopener hrefhttpsbookshoporgpagesabout target_blankembookshoporgemaem website dedicated supporting local independent bookstores purchase book link receive small commission helps sustain nonprofit mission books list covered site independently selected reviewed editorial team bookshop relatively new shipping currently available head ema relnoreferrer noopener hrefhttpsukbookshoporg target_blankembookshop ukemaememp hr classwpblockseparator div classwpblockspacerdiv div classwpblockspacerdiv div classwpblockimagefigurea relnoopener hrefhttpsbookshoporga168809780807049082 target_blankimg alt width149 srchttpsbehavioralscientistorgwpcontentuploads2021129780807049082199x300jpg classwpimage34528 height225afigurediv pstronga relnoreferrer noopener hrefhttpsbookshoporga168809780807049082 target_blankstrongthe behavioral code hidden ways law makes better worsestrongastrongbrby benjamin van rooij adam finep pfrom cover laws radically change behavior consistently ignored routinely broken relying harsh punishment crime continues fail professors benjamin van rooij adam fine present accessible analysis behavioral jurisprudence fundamentally alter understand connection law human behaviorp div classwpblockspacerdiv div classwpblockimagefigurea relnoopener hrefhttpsbookshoporga168809781487507893 target_blankimg alt width150 srchttpsbehavioralscientistorgwpcontentuploads202106thebehaviorallyinformedorganization200x300jpg classwpimage32027 height225afigurediv pa relnoreferrer noopener hrefhttpsbookshoporga168809781487507893 target_blankstrongthe behaviorally informed organizationstrongabredited dilip soman catherine yeungp pfrom cover despite centrality organizations good scientific framework behavior change good understanding organizations embed insights behavioral science operations overcome void book develops overarching framework behavioral science shows behavioral insights embedded organizations achieve better outcomes improve efficiency processes maximize stakeholder engagementp pa relnoreferrer noopener hrefhttpsbehavioralscientistorgfourrolesforabehavioralscientistwithinyourorganization target_blankread adaptationa emthe behaviorally informed organization emon embehavioral scientistemem emdespite clear valueadd believe behavioral science reached potential organizations highly relevant welldeveloped science human behavior science organizations embed insights behavioral science operationsp div classwpblockspacerdiv div classwpblockimagefigurea relnoopener hrefhttpsbookshoporga168809780691203423 target_blankimg alt width145 srchttpsbehavioralscientistorgwpcontentuploads202106breakingthesocialmediaprismhowtomakeourplatformslesspolarizing193x300jpeg classwpimage32026 height225afigurediv pa relnoreferrer noopener hrefhttpsbookshoporga168809780691203423 target_blankstrongbreaking social media prism platforms polarizingstrongabrby christopher bailp pfrom cover use social media mirror decipher place society chris bail explains functions like prism distorts identities empowers statusseeking extremists renders moderates invisible embreaking social media prismem challenges common myths echo chambers foreign misinformation campaigns radicalizing algorithms revealing solution political tribalism lies deep inside ourselvesp div classwpblockspacerdiv div classwpblockimagefigurea relnoopener hrefhttpsbookshoporga168809780691201788 target_blankimg alt width148 srchttpsbehavioralscientistorgwpcontentuploads2021129780691201788197x300webp classwpimage34530 height225afigurediv pa relnoreferrer noopener hrefhttpsbookshoporga168809780525575238 target_blankastronga relnoreferrer noopener hrefhttpsbookshoporga168809780691201788 target_blankstrongcareer family womens centurylong journey equitystrongastrongbrby claudia goldinp pfrom cover claudia goldin provides fresh indepth look diverse experiences collegeeducated women 1900s today examining aspirations formedand barriers facedin terms career job marriage children shows professions greedy paying disproportionately long hours weekend work perpetuates disparities women menp pa relnoreferrer noopener hrefhttpsbehavioralscientistorghowgreedyworkmorethanbiasexplainsthepersistentgenderwagegap target_blankread qampaa author [egalitarianminded couples] want pursue couple equity instead children important care responsibilities need job certain flexibility ask willing pay equity equity expensive expense notion greedy workp div classwpblockspacerdiv div classwpblockimagefigurea relnoopener hrefhttpsbookshoporga168809780525575238 target_blankimg altchatter ethan kross width149 srchttpsbehavioralscientistorgwpcontentuploads202012chatter199x300jpg classwpimage26054 height225afigurediv pa relnoreferrer noopener hrefhttpsbookshoporga168809780525575238 target_blankstrongchatter voice head matters harness itstrongabrby ethan krossp pfrom cover ethan kross explores silent conversations interweaving groundbreaking behavioral brain research lab realworld case studiesfrom pitcher forgets pitch harvard undergrad negotiating double life spykross explains conversations shape lives work relationshipsp pa relnoreferrer noopener hrefhttpsbehavioralscientistorghowtochannelyourmindsinnerchatter target_blankread excerpta emchatterem embehavioral scientistem inner voice functions time leads chatterthe cyclical negative thoughts emotions turn singular capacity introspection curse blessing happens precisely need inner voice mostwhen stress stakes high encounter difficult emotions utmost poisep div classwpblockspacerdiv div classwpblockimagefigurea relnoopener hrefhttpsbookshoporga168809781101981641 target_blankimg alt width149 srchttpsbehavioralscientistorgwpcontentuploads202106druguseforgrownupschasinglibertyinthelandoffear199x300jpg classwpimage32028 height225afigurediv pa relnoreferrer noopener hrefhttpsbookshoporga168809781101981641 target_blankstrongdrug use grownups chasing liberty land fearstrongabrby carl l hartp pfrom cover [carl l hart] draws decades research personal experience argue definitively criminalization demonization drug usenot drugs themselveshave tremendous scourge america reinforcing countrys enduring structural racismp div classwpblockspacerdiv div classwpblockimagefigurea relnoopener hrefhttpsbookshoporga168809780593084434 target_blankimg alt width149 srchttpsbehavioralscientistorgwpcontentuploads2021129780593084434199x300webp classwpimage34531 height225afigurediv pa relnoreferrer noopener hrefhttpsbookshoporga168809781101981641 target_blankastronga relnoreferrer noopener hrefhttpsbookshoporga168809780593084434 target_blankstrongthe elements choice way decide mattersstrongastrongbrby eric j johnsonp pfrom cover going familiar concepts nudges defaults emthe elements choiceem offers comprehensive systematic guide creating effective choice architectures environments decisions designers decisions need consider elements involved presenting choice options offer present options account natural cognitive shortcuts morep pa relnoreferrer noopener hrefhttpsbehavioralscientistorghowthenetflixchoiceenginetriestomaximizehappinessperdollarspent_ux_ui target_blankread excerpta emthe elements choice emon embehavioral scientistem friday night long week youre definitely going relax watch movie turn netflix worlds largest streaming service prototypical choice engine goal help find watch passively present options tries customize set things gives control presented helps comprehend new options likep div classwpblockspacerdiv div classwpblockimagefigurea relnoopener hrefhttpsbookshoporga168809781984881755 target_blankimg alt width149 srchttpsbehavioralscientistorgwpcontentuploads202108ffcover199x300jpeg classwpimage33508 height225afigurediv pa relnoreferrer noopener hrefhttpsbookshoporga168809781984881755 target_blankstrongthe family firm datadriven guide better decision making early school yearsstrongabrby emily osterp pfrom cover professor economics mom emily oster offers classic business school framework datadriven parents think deliberately key issues elementary years school health extracurricular activities morep pa relnoreferrer noopener hrefhttpsbehavioralscientistorgdatadrivenparentingaconversationwithemilyosterfamilyfirm target_blankread qampaa author samuel salzer aline holzwarth speak emily oster datadriven parenting elementary school yearsp div classwpblockspacerdiv div classwpblockimagefigurea relnoopener hrefhttpsbookshoporga168809780374159122 target_blankimg alt width146 srchttpsbehavioralscientistorgwpcontentuploads2021124000195x300jpg classwpimage34570 height225afigurediv pa relnoreferrer noopener hrefhttpsbookshoporga168809780374159122 target_blankstrongfour thousand weeks time management mortalsstrongabrby oliver burkemanp pfrom cover average human lifespan absurdly insultingly brief assuming live eighty thousand weeks drawing insights ancient contemporary philosophers psychologists spiritual teachers oliver burkeman delivers entertaining humorous practical ultimately profound guide time time management rejecting futile modern obsession getting emfour thousand weeksem introduces readers tools constructing meaningful life embracing finitude showing unhelpful ways weve come think time arent inescapable unchanging truths choices weve individuals societyand things differentlyp div classwpblockspacerdiv div classwpblockimagefigurea relnoopener hrefhttpsbookshoporga168809781982128562 target_blankimg alt width149 srchttpsbehavioralscientistorgwpcontentuploads202106highconflictwhywegettrappedandhowwegetout199x300jpeg classwpimage32031 height225afigurediv pa relnoreferrer noopener hrefhttpsbookshoporga168809781982128562 target_blankstronghigh conflict trapped outstrongabrby amanda ripleyp pfrom cover high conflict happens discord distills goodversusevil kind feud kind state normal rules engagement longer apply brain behaves differently feel increasingly certain superiority time mystified amanda ripley investigates good people captured high conflictand break freep div classwpblockspacerdiv div classwpblockimagefigurea relnoopener hrefhttpsbookshoporga168809780593083758 target_blankimg alt width149 srchttpsbehavioralscientistorgwpcontentuploads202105htccover199x300jpeg classwpimage31793 height225afigurediv pa relnoreferrer noopener hrefhttpsbookshoporga168809780593083758 target_blankstronghow change science getting want bestrongabrby katy milkmanstrongstrongp pfrom cover career devoted uncovering helps people change milkman discovered crucial thing wrong strategy change shes learned comes readily understand whats standing success tailor solution roadblockp pa relnoreferrer noopener hrefhttpsbehavioralscientistorgtokickstartanewbehaviorcopyandpastekatymilkmanhowtochange target_blankread excerpta emhow changeem embehavioral scientistem found encouraging people copy paste anothers best life hacks motivated exercise better class preparation adults wanted work college students seeking improve grades respectively unsure powerful way people help boost capacity condence showing whats possiblep pa relnoreferrer noopener hrefhttpsbehavioralscientistorgspeakingwithkatymilkmanabouthowtochange target_blankread qampaa author think theres overemphasis big goals goals arent useful theres tons research showing having certain kind goala clear concrete achievable goal stretch goalreally valuable solving problem deal challenges procrastination temptation forgetting selfefficacy peers supporting youp div classwpblockspacerdiv div classwpblockimagefigurea relnoopener hrefhttpswwwindieboundorgbook9781982120627 target_blankimg altthe suprising science help find love width149 srchttpsbehavioralscientistorgwpcontentuploads202012howtonotdiealone199x300jpg classwpimage26057 height225afigurediv pa relnoreferrer noopener hrefhttpswwwindieboundorgbook9781982120627 target_blankstronghow die surprising science help find lovestrongabrby logan uryp pfrom cover great relationships dont appear livestheyre culmination series decisions including date end wrong person commit right brains way poor decisions thwart quest find lasting love logan ury reveals hidden forces cause mistakesp pa relnoreferrer noopener hrefhttpsbehavioralscientistorgmasteringmodernloveloganuryonbuildingbetterrelationshipsthroughbehavioralscience target_blankread qampaa author dating apps unfortunately perpetuate superficiality people focus things opposed focusing things know relationship science found correlated longterm relationship success things like kindness loyalty emotional stability ability hard decisions growth mindset importantly bring outp div classwpblockspacerdiv div classwpblockimagefigurea relnoopener hrefhttpswwwharpercollinscomproductsinfluencenewandexpandedrobertbcialdinivariant32903969996834 target_blankimg alt width149 srchttpsbehavioralscientistorgwpcontentuploads202106influencenewandexpandedthepsychologyofpersuasion198x300jpeg classwpimage32037 height225afigurediv pa relnoreferrer noopener hrefhttpswwwharpercollinscomproductsinfluencenewandexpandedrobertbcialdinivariant32903969996834 target_blankstronginfluence new expanded psychology persuasionstrongabrby robert b cialdinip pfrom cover new edition [robert cialdini] explains psychology people yes apply insights ethically business everyday settingsp div classwpblockspacerdiv div classwpblockimagefigurea relnoopener hrefhttpsbookshoporga168809781541672840 target_blankimg alt width145 srchttpsbehavioralscientistorgwpcontentuploads202106knowthyselfthescienceofselfawareness193x300jpeg classwpimage32038 height225afigurediv pa relnoreferrer noopener hrefhttpsbookshoporga168809781541672840 target_blankstrongknow thyself science selfawarenessstrongabrby stephen m flemingp pfrom cover know knowor importantly dont know cognitive neuroscientist stephen fleming shows emknow thyselfem metacognition metacognition thinking thinking important tool understanding mind metacognition awesome power enables selfawareness lets think minds ultimate human trait rarefied forms power animals current artificial intelligences havep div classwpblockspacerdiv div classwpblockimagefigurea relnoopener hrefhttpsbookshoporga168809780691214917 target_blankimg alt width145 srchttpsbehavioralscientistorgwpcontentuploads202106mindswideshuthowthenewfundamentalismsdivideus193x300jpeg classwpimage32039 height225afigurediv pa relnoreferrer noopener hrefhttpsbookshoporga168809780691214917 target_blankstrongminds wide shut new fundamentalisms divide usstrongabrby gary saul morson morton schapirop pfrom cover morson schapiro examine rigid adherence ideological thinking altered politics economics religion literature ways mutually reinforcing antithetical openmindedness readiness compromise animate democracy response propose alternatives dialogue possiblep pa relnoreferrer noopener hrefhttpsbehavioralscientistorgwecanallbefundamentalistsandfundamentalismiseverywhere target_blankread qampaa authors gary saul morson morton schapiro instead professing embelieveem science morson explained respect scientific method spirit involves careful weighing evidence testing ideas doubt arriving step careful step best available answer subject revision light future evidencep div classwpblockspacerdiv div classwpblockimagefigurea relnoopener hrefhttpsbookshoporga168809780385544726 target_blankimg alt width148 srchttpsbehavioralscientistorgwpcontentuploads202106minehowthehiddenrulesofownershipcontrolourlives197x300jpeg classwpimage32040 height225afigurediv pa relnoreferrer noopener hrefhttpsbookshoporga168809780385544726 target_blankstrongmine hidden rules ownership control livesstrongabrby michael heller james salzmanp pfrom cover hidden set rules governs owns whatexplaining recline airplane seat hbo lets borrow password illegallyand lively entertaining guide acclaimed law professors reveal things minep div classwpblockspacerdiv div classwpblockimagefigurea relnoopener hrefhttpsbookshoporga168809781250296108 target_blankimg alt width147 srchttpsbehavioralscientistorgwpcontentuploads202106thenewbreedwhatourhistorywithanimalsrevealsaboutourfuturewithrobots196x300jpeg classwpimage32041 height225afigurediv pa relnoreferrer noopener hrefhttpsbookshoporga168809781250296108 target_blankstrongthe new breed history animals reveals future robotsstrongabrby kate darlingp pfrom cover lot ink devoted discussions robots replace jobs mit media lab researcher technology policy expert kate darling argues opposite treating robots bit humanity like way treat animals actually serve betterp pa relnoreferrer noopener hrefhttpsbehavioralscientistorgwhatourpetscantellusaboutourfuturewithrobots target_blankread qampaa author bothered limiting falling technological determinism robots replace people feel like animals salient analogy gets [an animal] autonomous thing sense think decisions learn weve dealt previouslyp div classwpblockspacerdiv div classwpblockimagefigurea relnoopener hrefhttpsbookshoporga168809781541758230 target_blankimg alt width148 srchttpsbehavioralscientistorgwpcontentuploads202106thenewclimatewarthefighttotakebackourplanet197x300jpeg classwpimage32042 height225afigurediv pa relnoreferrer noopener hrefhttpsbookshoporga168809781541758230 target_blankstrongthe new climate war fight planetstrongabrby michael e mannp pfrom cover recycle fly eat meat ways weve told slow climate change inordinate emphasis individual behavior result marketing campaign succeeded placing responsibility fixing climate change squarely shoulders individualsp pa relnoreferrer noopener hrefhttpsbehavioralscientistorgurgencyandagencymichaelmannonconqueringclimatedespair target_blankread qampaa author framing tipping point weve crossed late anythingthose narratives steeped distortions science bad bad distortions science denialist sidep div classwpblockspacerdiv div classwpblockimagefigurea relnoopener hrefhttpsbookshoporga168809780316451406 target_blankimg alt width145 srchttpsbehavioralscientistorgwpcontentuploads202106noiseaflawinhumanjudgment193x300jpeg classwpimage32043 height225afigurediv pa relnoreferrer noopener hrefhttpsbookshoporga168809780316451406 target_blankstrongnoise flaw human judgmentstrongabrby daniel kahneman oliver sibony cass r sunsteinp pfrom cover emnoiseem daniel kahneman olivier sibony cass r sunstein detrimental effects noise fields including medicine law economic forecasting forensic science bail child protection strategy performance reviews personnel selection judgment noise time individuals organizations alike unaware neglect noise simple remedies people reduce noise bias far better decisionsp pa relnoreferrer noopener hrefhttpsbehavioralscientistorgaconversationwithdanielkahnemanaboutnoise target_blankread qampaa author daniel kahneman ive studying bias life years ago encountered instance noise impressed noise underwriters judging exactly thing impressed little people knew itp div classwpblockspacerdiv div classwpblockimagefigurea relnoopener hrefhttpsbookshoporga168809780143137009 target_blankimg alt width147 srchttpsbehavioralscientistorgwpcontentuploads202108nudgecover196x300jpeg classwpimage33409 height225afigurediv pa relnoreferrer noopener hrefhttpsbookshoporga168809780143137009 target_blankstrongnudge final editionstrongabrby richard h thaler cass r sunsteinp pfrom cover authors rewritten book cover cover making use experiences government past dozen years explosion new research numerous academic disciplines commit undertaking daunting task calling final edition offers wealth new insights avowed fans newcomers field wide variety issues face daily livescovid19 health personal finance retirement savings credit card debt home mortgages medical care organ donation climate change sludge paperwork nuisances dont want getting wantall honoring cardinal rules nudging funp pa relnoreferrer noopener hrefhttpsbehavioralscientistorgfivetakeawaysfromourconversationwithrichardthaleraboutthepastpresentandfutureofnudge target_blankread watch qampaa author richard thaler release new emnudgeem provided occasion recent conversation conversation went book corrected record organ donation revealed wished original subtitle included phrase choice architecture thoughts replication behavioral economics advice hed organizations looking apply behavioral sciencep div classwpblockspacerdiv div classwpblockimagefigurea relnoopener hrefhttpsbookshoporga168809780262045865 target_blankimg alt width149 srchttpsbehavioralscientistorgwpcontentuploads2021129780262045865199x300jpg classwpimage34532 height225afigurediv pa relnoreferrer noopener hrefhttpsbookshoporga168809781524743802 target_blankastronga relnoreferrer noopener hrefhttpsbookshoporga168809780262045865 target_blankstrongof sound mind brain constructs meaningful sonic worldstrongastrongbrby nina krausp pfrom cover making sense sound hardest jobs ask brains emof sound mindem nina kraus examines partnership sound brain showing time processing sound drives brains core functions hearing onwe cant close ears way close eyesand ignore sounds unimportant dont hear engage sounds kraus explores goes brains hear wordor chord meow screechp div classwpblockspacerdiv div classwpblockimagefigurea relnoopener hrefhttpsbookshoporga168809780316538411 target_blankimg alt width146 srchttpsbehavioralscientistorgwpcontentuploads2021129780316538411194x300webp classwpimage34533 height225afigurediv pa relnoreferrer noopener hrefhttpsbookshoporga168809781250262820 target_blankastronga relnoreferrer noopener hrefhttpsbookshoporga168809780316538411 target_blankstrongthe power harnessing shared identities improve performance increase cooperation promote social harmonystrongastrongbrby jay van bavel amp dominic jay packerp pfrom cover youre like people probably believe identity stable fact identity constantly changingoften outside conscious awareness wishesto reflect interests groups belong emthe power usem psychologists dominic packer jay van bavel integrate cuttingedge research psychology neuroscience explain identity works harness dynamic naturep pa relnoreferrer noopener hrefhttpsbehavioralscientistorgpowerofusfromstrangerstoteammateshowgettingonthesamewavelengthmightbemorethanametaphor target_blankread adaptationa emthe power emon embehavioral scientistem sense common fate produces shared identity knowledge group turn shared identity produces solidarity ability work collectively cohere shared identities foundations people coordinate cooperate allows face overcome crisis difficult address alonep div classwpblockspacerdiv div classwpblockimagefigurea relnoopener hrefhttpsbookshoporga168809780525561996 target_blankimg alt width149 srchttpsbehavioralscientistorgwpcontentuploads2021129780525561996199x300webp classwpimage34534 height225afigurediv pa relnoreferrer noopener hrefhttpsbookshoporga168809780525561996 target_blankstrongrationality scarce mattersstrongabrby steven pinkerp pfrom cover pinker rejects cynical clich humans simply irrationalcavemen time saddled biases fallacies illusions discovered laws nature lengthened enriched lives set benchmarks rationality actually think ways sensible lowtech contexts spend lives fail advantage powerful tools reasoning weve discovered millennia logic critical thinking probability correlation causation optimal ways update beliefs commit choices individually othersp pa relnoreferrer noopener hrefhttpsbehavioralscientistorgstevenpinkerrationalitywhyyoushouldalwaysswitchthemontyhallproblemfinallyexplained target_blankread excerpta emrationality emon embehavioral scientistem godlike host reminds exotic monty hall problem requires omniscient defies usual goal conversationto share hearer needs know case door hides carand instead pursues goal enhancing suspense parties unlike world clues indifferent sleuthing monty almighty knows truth knows choice picks revelation accordinglyp div classwpblockspacerdiv div classwpblockimagefigurea relnoopener hrefhttpsbookshoporga168809781524743802 target_blankimg alt width149 srchttpsbehavioralscientistorgwpcontentuploads202112socialchemistrydecodingthepatternsofhumanconnection199x300jpeg classwpimage34535 height225afigurediv pa relnoreferrer noopener hrefhttpsbookshoporga168809781524743802 target_blankstrongsocial chemistry decoding patterns human connectionstrongabrby marissa kingp pfrom cover conventional wisdom says size network matters social science research proven king explains quality structure relationships greatest impact personal professional livesp div classwpblockspacerdiv div classwpblockimagefigurea relnoopener hrefhttpsbookshoporga168809781250262820 target_blankimg alt width148 srchttpsbehavioralscientistorgwpcontentuploads202106thesocialinstincthowcooperationshapedtheworld197x300jpeg classwpimage32045 height225afigurediv pa relnoreferrer noopener hrefhttpsbookshoporga168809781250262820 target_blankstrongthe social instinct cooperation shaped worldstrongabrby nichola raihanip pfrom cover [nichola raihani] reveals species exhibit cooperative behaviorteaching helping grooming selfsacrificemost similar tend apes birds insects fish occupying far distant branches evolutionary tree understanding problems face cooperate solve glimpse human cooperation evolvedp div classwpblockspacerdiv div classwpblockimagefigurea relnoopener hrefhttpsbookshoporga168809781250249869 target_blankimg alt width148 srchttpsbehavioralscientistorgwpcontentuploads202104subtract_cover197x300jpg classwpimage30340 height225afigurediv pa relnoreferrer noopener hrefhttpsbookshoporga168809781250249869 target_blankstrongsubtract untapped science lessstrongabrby leidy klotzp pfrom cover pile todos dont consider stopdoings create incentives good behavior dont rid obstacles collect newandimproved ideas dont prune outdated ones day challenges big small neglect basic way things better dont subtractp pa relnoreferrer noopener hrefhttpsbehavioralscientistorgsubtractwhygettingtolesscanmeanthinkingmore target_blankread adaptationa emsubtractem embehavioral scientistem subtraction act getting fact getting means thinking morep div classwpblockspacerdiv div classwpblockimagefigurea relnoopener hrefhttpsbookshoporga168809780062910561 target_blankimg alt width149 srchttpsbehavioralscientistorgwpcontentuploads2021129780062910561199x300webp classwpimage34536 height225afigurediv pa relnoreferrer noopener hrefhttpsbookshoporga168809780062910561 target_blankstrongthe sweet spot pleasures suffering search meaningstrongabrby paul bloomp pfrom cover natural hedonistsa good life involves pleasure people seek lives meaning significance aspire rich relationships satisfying pursuits requires struggle anxiety loss brilliantly argued witty humane paul bloom shows life chosen suffering emptyand worse boringp pa relnoreferrer noopener hrefhttpsbehavioralscientistorgpaulbloomsweetspotunderstandingthepleasurepainparadox target_blankread excerpta emthe sweet spot emon embehavioral scientistem look paradoxical reactions laugh whats funny laugh anxious embarrassed grin happy grin angry smiling associated joy researchers asked people watch sad movie scenethe emsteel magnoliasem woman speaking funeral adult daughterabout half subjects smiledp div classwpblockspacerdiv div classwpblockimagefigurea relnoopener hrefhttpsbookshoporga168809781984878106 target_blankimg altthe power knowing dont know width149 srchttpsbehavioralscientistorgwpcontentuploads202012thinkagain199x300jpg classwpimage26062 height225afigurediv pa relnoreferrer noopener hrefhttpsbookshoporga168809781984878106 target_blankstrongthink power knowing dont knowstrongabrby adam grantp pfrom cover favor comfort conviction discomfort doubt listen opinions feel good instead ideas think hard [grant] investigates embrace joy wrong bring nuance charged conversations build schools workplaces communities lifelong learnersp pa relnoreferrer noopener hrefhttpsbehavioralscientistorgyourideasarenotyouridentityadamgrantonhowtogetbetteratchangingyourmind target_blankread qampaa author want bothsides conversations anymore somebody says heres question tell angle fourth look likep div classwpblockspacerdiv div classwpblockimagefigurea relnoopener hrefhttpsbookshoporga168809781913019358 target_blankimg alt width144 srchttpsbehavioralscientistorgwpcontentuploads202111designingtransportcover192x300jpeg classwpimage34368 height225afigurediv pa relnoreferrer noopener hrefhttpsbookshoporga168809781913019358 target_blankstrongtransport humans nearly yetstrongabrby pete dyson rory sutherlandp pfrom cover engineers plan transport systems people use ways engineer measures successspeed journey time efficiencyare way passengers think good trip cargo choose travel influenced speed time habit status comfort varietyand factors engineering equations dont capture allp pa relnoreferrer noopener hrefhttpsbehavioralscientistorgdesigningtransportforhumansnotecons target_blankread adaptationa emtransport humans emon embehavioral scientistem greatest fallacy travel time wasted time option speed cut reality need invest higherquality travel people enabling people travel different meansp div classwpblockspacerdiv div classwpblockimagefigurea relnoopener hrefhttpsbookshoporga168809780393652208 target_blankimg alt width148 srchttpsbehavioralscientistorgwpcontentuploads202103usefuldelusionscover197x300jpg classwpimage28008 height225afigurediv pa relnoreferrer noopener hrefhttpsbookshoporga168809780393652208 target_blankstronguseful delusions power paradox selfdeceiving brainstrongabrby shankar vedantam bill meslerstrongstrongp pfrom cover agrees lies selfdeception terrible harm lives communities planet emuseful delusionsem host hidden brain shankar vedantam argues paradoxically deceiving play vital role human success wellbeing lies tell lies tell sustain daily interactions friends lovers coworkers explain people live longer couples remain love dont nations tribes hold splinterp pa relnoreferrer noopener hrefhttpsbehavioralscientistorgtheusefulnessofourdelusions target_blankread excerpta emuseful delusionsem embehavioral scientistem seek annihilate selfdeception represents better goal think carefully ask work words ought care simply true untrue ask complicated questions consequences selfdeception serve benefits justify costsp div classwpblockspacerdiv div classwpblockimagefigurea relnoopener hrefhttpsbookshoporga168809780231197403 target_blankimg alt width149 srchttpsbehavioralscientistorgwpcontentuploads202106thewayout199x300jpeg classwpimage32129 height225afigurediv pa relnoreferrer noopener hrefhttpsbookshoporga168809780231197403 target_blankstrongthe way overcome toxic polarizationstrongabrby peter t colemanp pfrom cover surveys americans fearful hateful supporters opposing political party imagine hold extreme views actually cordoned prefer date marry similar opinions willing spend time people loosen grip toxic polarization start working pressing problemsp pa relnoreferrer noopener hrefhttpsbehavioralscientistorgtoxicpolarizationfeedsonsimplicitypetercolemanofferscomplexityasawayout target_blankread qampaa author quotwith kinds polarization today understand complex systems stabilize strong patterns resist change good faith attempts changing themquotp div classwpblockspacerdiv div classwpblockimagefigurea relnoopener hrefhttpsbookshoporga168809780300257328 target_blankimg alt width149 srchttpsbehavioralscientistorgwpcontentuploads2021129780300257328199x300webp classwpimage34537 height225afigurediv pa relnoreferrer noopener hrefhttpsbookshoporga168809780300257328 target_blankstrongthe week history unnatural rhythms arestrongabrby david m henkinp pfrom cover reconstructing weekly patterns insinuated social practices mental habits americans henkin argues week regimen rest days breaks work dominant organizational principle modern society ultimately sevenday week shapes understanding experience timep div classwpblockspacerdiv div classwpblockimagefigurea relnoopener hrefhttpsbookshoporga168809781324002833 target_blankimg alt width147 srchttpsbehavioralscientistorgwpcontentuploads202106whenbrainsdreamexploringthescienceandmysteryofsleep196x300jpeg classwpimage32051 height225afigurediv pa relnoreferrer noopener hrefhttpsbookshoporga168809781324002833 target_blankstrongwhen brains dream exploring science mystery sleepstrongabrby antonio zadra robert stickgoldp pfrom cover emwhen brains dreamem reveals recent discoveries sleeping brain ways dreams psychologically neurologically meaningful experiences explores host dreamrelated disorders explains dreams facilitate creativity source personal insightp pa relnoreferrer noopener hrefhttpsbehavioralscientistorgwhatdreamsmaycomeandwhyandhow target_blankread qampaa author robert stickgold salvador dal sat armchair hand arm chair hed hold key right end chair think painting wanted fell asleep key dropped woke got image mind got images painted [my colleague adam horowitz] wants ask question everybody harness answer probably canp div classwpblockspacerdiv div classwpblockimagefigurea relnoopener hrefhttpsbookshoporga168809780525536550 target_blankimg alt width149 srchttpsbehavioralscientistorgwpcontentuploads202106aworldwithoutemailreimaginingworkinanageofcommunicationoverload199x300jpg classwpimage32052 height225afigurediv pa relnoreferrer noopener hrefhttpsbookshoporga168809780525536550 target_blankstronga world email reimagining work age communication overloadstrongabrby cal newportp pfrom cover inboxdriven workday hard imagine alternatives exist drawing years investigative reporting author computer science professor cal newport makes case current approach work broken lays series principles concrete instructions fixing itp div classwpblockspacerdiv div classwpblockimagefigurea relnoopener hrefhttpsbookshoporga168809781324005711 target_blankimg alt width148 srchttpsbehavioralscientistorgwpcontentuploads2021129781324005711197x300webp classwpimage34538 height225afigurediv pa relnoreferrer noopener hrefhttpsbookshoporga168809781324005711 target_blankstrongyou influence think underestimate power persuasion mattersstrongabrby vanessa bohnsp pfrom cover attending meeting sharing post online mustering nerve ask favor assume actions input requests overlooked rejected bohns work demonstrate people listen agree things realizefor better worsep pa relnoreferrer noopener hrefhttpsbehavioralscientistorgnoneedtoshoutrecognizingtheinfluencethatsalreadyyours target_blankread adaptationa emyou influence think emon embehavioral scientistem times youve tried failed influence loom large undoubtedly far examples times youve influenced trying alland seeing influence hand means likely times influenced unintentionally ways wish hadntp hr classwpblockseparator pemdisclosure leidy klotz katy milkman dilip soman members organizations provided financial support toembehavioral scientist emin 2021richard thaler emily oster members embehavioral scientistsem advisory board emadvisory board members organizational donors play role editorial decisions magazineemem emevan nesterak embehavioral scientist emserved editorial consultant booksemchatterem emsubtractem books list covered site independently selected reviewed editorial team emp pthe post relnofollow hrefhttpsbehavioralscientistorgbehavioralscientistsnotablebooksof2021behavioral scientists notable books 2021a appeared relnofollow hrefhttpsbehavioralscientistorgbehavioral scientistap |
61b284f4edd6b8f2324a18ac | Allegra Stratton is the latest scapegoat for Boris Johnson’s government of lies | pthe leaked footage of a hrefhttpswwwnewstatesmancompolitics202112allegrastrattonhasresignedbutborisjohnsonstroublesmayonlyjustbebeginningallegra strattona joking about an illegal christmas party which was allegedly held yards from boris johnsons office while the rest of the nation grieved alone for lost loved ones and obeyed the law presents the iconic image of modern conservatism posh people partying on the publics expense in defiance of both rules and moral decency and then being paid sixfigure salaries to rehearse lying about it on camera p
pstratton was a good journalist as a emnewsnightem producer she once got me into the treasury to see gordon brown an hour before some vital football match was starting on the pretence that all we wanted was a clip as i grilled him relentlessly and at length he began to signal urgently to his aides to end it stratton held them off long enough for us to get a decent story i jumped into a taxi exhilarated p
pshe was a good pr person too hired in 2020 to polish the image of the chancellor a hrefhttpswwwnewstatesmancompoliticstransportpolitics202111rishisunakstransportcutsareafalseeconomyandthewholecountrywillpaythepricerishi sunaka she reinvented him as a softfocus catalogue model there would be no more journalists snaking their way in for any impromptu confrontations we the taxpayers would pay for an americanstyle image campaign sunak would even get his own font and graphic design look p
pnaturally a hrefhttpswwwnewstatesmancompoliticsukpolitics202112borisjohnsonsattempttoshifttheblamehasonlymadehimlookworseboris johnsona wanted the same treatment hiring stratton would solve two problems she would not only give johnson an image makeover but and heres where the story turns dark actually replace him as the governments public face and by hiring a white housestyle press spokesperson johnson would look presidential p
pin the resulting shambles stratton has ended not only her own career but quite possibly that of boris johnson because in that a hrefhttpswwwnewstatesmancompoliticsukpolitics202112couldthedowningstreetpartyunravelborisjohnsonspoliticalcareerleaked video aencapsulates what johnsons government has become an incompetent liemachine in flagrant breach of the rules and of the law p
pstrongem[see alsoa hrefhttpswwwnewstatesmancompolitics202107politicsliesborisjohnsonanderosionrulelaw the politics of lies boris johnson and the erosion of the rule of lawa]emstrongp
pwhat would competence and professionalism have demanded that the most senior civil servant who was aware of the party on 18 december report it to the cabinet secretary in writing and that the most senior media adviser which at this point could plausibly have been stratton herself prepare a crisis management plan for when not if news of the rulebreach leaked to the media p
pbut as the jokey spontaneity of the video reveals nobody had thought to do the basic actions that a corporate senior manager would it was left to a privatelyeducated adviser in his twenties to remind privately educated stratton that she might face questions about the breach though stratton reminds the assembled special advisers that this is being recorded no one even bothers to secure the tape p
pthe entire episode is an example of what happens when you let amateurs run a government machine designed around the assumptions of truth professionalism and competence above all when many of those amateurs are rich people who have winged it into journalism and pr p
pthe common assumption among journalists is that politicians routinely lie not big lies of course but the kind of stonewalling and evasion that browna hrefhttpswwwnewstatesmancomlabourincrisis202105tonyblairwithouttotalchangelabourwilldie tony blairaa hrefhttpswwwnewstatesmancompolitics202104davidcameronandgreatsellout david camerona and theresa may were good at and which jeremy corbyn was incapable of doing but most of the politicians ive met would not willingly practise lying to the public on camera with a room full of witnesses unless there was some deadly serious national emergency that required doing it for public good p
pbut downing street is not currently run by politicians in the normal sense it is run by modern machiavellis johnson stratton michael gove and numerous underlings all come out of journalism and not the journalism of the flak jacket or the scoop p
pthey originated from a faction of journalism where lavish salaries are paid to those who are in the right networks the murdoch garden party the emspectatorem christmas bash the discreet yachting trips where whitegloved flunkies hand you chilled champagne p
pin this world the most fashionable thing to be is reactionary to say loudly that taxation is pointless that the readers of a newspaper are stupid little housewives that benefit claimants a relnoreferrer noopener hrefhttpswwwnewstatesmancompolitics201205hownewsnighthumilatedsinglemothershanenethorpe target_blankas stratton implied in 2012 to public outrage on emnewsnightema choose their misery and that lying is a legitimate and routine tool of statecraft p
pwhy else would johnson have denied that a party took place why else would he have tried to get his ministers to haplessly parrot the same line p
pjohnson himself has established the pattern he a relnoreferrer noopener hrefhttpswwwhuffingtonpostcoukentryborisjohnsonclaimseustopsbananasbeingsoldinbunchesofmorethanthreethatisnottrue_uk_573b2445e4b0f0f53e36c968 target_blanklied his waya through the 2016 brexit campaign in 2019 he a relnoreferrer noopener hrefhttpswwwpoliticshomecomnewsarticleborisjohnsonapologisedtoqueenfollowingsupremecourtprorogationruling target_blankmisled the queena in order to prorogue parliament a month after being presented with a relnoreferrer noopener hrefhttpsiscindependentgovukwpcontentuploads202103ccs207_ccs0221966010001_russiareportv02web_accessiblepdf target_blankthe intelligence and security committee report on russiaa which showed widespread and persistent interference in british politics he stated there was no evidence that ive ever seen of any russian interference in uk democratic processes p
pso prolific are johnsons lies a relnoreferrer noopener hrefhttpstwittercompeterstefanovi2status1459541907772780546s20 target_blankthat the viral video of them made by the campaigner peter stefanovica has been viewed 41 million times as dominic cummings his former chief political adviser wrote he lies so blatantly so naturally so regularly that there is no real distinction possible with him as there is with normal people between truth and lies p
psince large parts of the electorate put to one side that johnson was a liar perhaps preferring them to the complex and unpalatable truth this moment might be a good time to confront the consequences of lying as statecraft and its root causes p
pthe consequences of organised lying were well understood by the generation of journalists who were confronted by both nazism and stalinism p
pthe political philosopher hannah arendt author of emthe origins of totalitarianismem noted that the elites power within the fascist movements of the interwar period rested on an artificially induced inability to understand facts as facts to distinguish between truth and falsehood this was instilled in specialist educational settings and produced what she called the elites outstanding negative quality it [the elite class] never stops to think about the world as it really is and never compares the lies with reality if the world doesnt match the lie the world or the historical record can be changed so that the lie becomes true p
pbut arendt understood an even more disturbing fact that the unorganised masses who followed europes dictators and autocrats to their doom in the 1930s wanted the lies the masses she wrote do not believe in anything visible in the reality of their own experience they do not trust their eyes and ears but only their imaginations which may be caught by anything that is at once universal and consistent in itself p
pin the past decade across the western world we have learned that you dont need to be a fascist to deploy the elite strategy of lying nor a footsoldier to become mesmerised by it cummings himself the architect of the brexit lie a relnoreferrer noopener hrefhttpsdominiccummingscom20150808onthereferendum12newicmpollshows4636forstayingintheeueducationbbcpropagandawilliemunzenberg target_blankonce wrote admiringlya of soviet propaganda techniques which overwhelm reason and humans capacity for objective analysis by creating a emmoral picture emsuch that people send little moral signals to each other by their actions p
pthe consequence since brexit has been devastating for democracy a proportion of the british public will put up with anything johnson does or says so long as he continues to enact their xenophobic and racist prejudices this is the intention behind the a relnoreferrer noopener hrefhttpswwwnewstatesmancomtheexplainer202112whatdoesthenationalityandbordersbillmeanforyou target_blanknationality and borders billa and the recent sewell report which suggested that it was white working class boys not people from minority ethnic backgrounds who are being oppressed by the antiracism industry p
pthis particular alliance of elite and mob to use arendts phrase is addicted to lying from top to bottom it has scoured the insides out of the mechanisms of democratic accountability and destroyed peoples trust in government at the exact moment when energy security public health and geopolitical stability are all in question p
pas ive argued before this is not really conservatism anymore its not the political projection of the managerial class and high finance it bears no allegiance to the political philosophy of edmund burke michael oakeshott or anyone in between them p
pthis is a government by a selfselected elite by and for itself as stratton found out and cummings before her it will ruthlessly discard even the most obedient true believers to maintain its power but the result is that the inner circle tightens and the lies become even bigger p | pthe leaked footage hrefhttpswwwnewstatesmancompolitics202112allegrastrattonhasresignedbutborisjohnsonstroublesmayonlyjustbebeginningallegra strattona joking illegal christmas party allegedly held yards boris johnsons office rest nation grieved lost loved ones obeyed law presents iconic image modern conservatism posh people partying publics expense defiance rules moral decency paid sixfigure salaries rehearse lying camerap pstratton good journalist emnewsnightem producer got treasury gordon brown hour vital football match starting pretence wanted clip grilled relentlessly length began signal urgently aides end stratton held long decent story jumped taxi exhilaratedp pshe good pr person hired 2020 polish image chancellor hrefhttpswwwnewstatesmancompoliticstransportpolitics202111rishisunakstransportcutsareafalseeconomyandthewholecountrywillpaythepricerishi sunaka reinvented softfocus catalogue model journalists snaking way impromptu confrontations taxpayers pay americanstyle image campaign sunak font graphic design lookp pnaturally hrefhttpswwwnewstatesmancompoliticsukpolitics202112borisjohnsonsattempttoshifttheblamehasonlymadehimlookworseboris johnsona wanted treatment hiring stratton solve problems johnson image makeover heres story turns dark actually replace governments public face hiring white housestyle press spokesperson johnson look presidentialp pin resulting shambles stratton ended career possibly boris johnson hrefhttpswwwnewstatesmancompoliticsukpolitics202112couldthedowningstreetpartyunravelborisjohnsonspoliticalcareerleaked video aencapsulates johnsons government incompetent liemachine flagrant breach rules lawp pstrongem[see alsoa hrefhttpswwwnewstatesmancompolitics202107politicsliesborisjohnsonanderosionrulelaw politics lies boris johnson erosion rule lawa]emstrongp pwhat competence professionalism demanded senior civil servant aware party 18 december report cabinet secretary writing senior media adviser point plausibly stratton prepare crisis management plan news rulebreach leaked mediap pbut jokey spontaneity video reveals thought basic actions corporate senior manager left privatelyeducated adviser twenties remind privately educated stratton face questions breach stratton reminds assembled special advisers recorded bothers secure tapep pthe entire episode example happens let amateurs run government machine designed assumptions truth professionalism competence amateurs rich people winged journalism prp pthe common assumption journalists politicians routinely lie big lies course kind stonewalling evasion browna hrefhttpswwwnewstatesmancomlabourincrisis202105tonyblairwithouttotalchangelabourwilldie tony blairaa hrefhttpswwwnewstatesmancompolitics202104davidcameronandgreatsellout david camerona theresa good jeremy corbyn incapable politicians ive met willingly practise lying public camera room witnesses deadly national emergency required public goodp pbut downing street currently run politicians normal sense run modern machiavellis johnson stratton michael gove numerous underlings come journalism journalism flak jacket scoopp pthey originated faction journalism lavish salaries paid right networks murdoch garden party theemspectatoremchristmas bash discreet yachting trips whitegloved flunkies hand chilled champagnep pin world fashionable thing reactionary loudly taxation pointless readers newspaper stupid little housewives benefit claimants relnoreferrer noopener hrefhttpswwwnewstatesmancompolitics201205hownewsnighthumilatedsinglemothershanenethorpe target_blankas stratton implied 2012 public outrage emnewsnightema choose misery lying legitimate routine tool statecraftp pwhy johnson denied party took place tried ministers haplessly parrot linep pjohnson established pattern hea relnoreferrer noopener hrefhttpswwwhuffingtonpostcoukentryborisjohnsonclaimseustopsbananasbeingsoldinbunchesofmorethanthreethatisnottrue_uk_573b2445e4b0f0f53e36c968 target_blanklied wayathrough 2016 brexit campaign 2019 hea relnoreferrer noopener hrefhttpswwwpoliticshomecomnewsarticleborisjohnsonapologisedtoqueenfollowingsupremecourtprorogationruling target_blankmisled queenain order prorogue parliament month presented witha relnoreferrer noopener hrefhttpsiscindependentgovukwpcontentuploads202103ccs207_ccs0221966010001_russiareportv02web_accessiblepdf target_blankthe intelligence security committee report russiaa showed widespread persistent interference british politics stated evidence ive seen russian interference uk democratic processesp pso prolific johnsons liesa relnoreferrer noopener hrefhttpstwittercompeterstefanovi2status1459541907772780546s20 target_blankthat viral video campaigner peter stefanovicahas viewed 41 million times dominic cummings chief political adviser wrote lies blatantly naturally regularly real distinction possible normal people truth liesp psince large parts electorate johnson liar preferring complex unpalatable truth moment good time confront consequences lying statecraft root causesp pthe consequences organised lying understood generation journalists confronted nazism stalinismp pthe political philosopher hannah arendt author ofemthe origins totalitarianismem noted elites power fascist movements interwar period rested artificially induced inability understand facts facts distinguish truth falsehood instilled specialist educational settings produced called elites outstanding negative quality [the elite class] stops think world compares lies reality world doesnt match lie world historical record changed lie truep pbut arendt understood disturbing fact unorganised masses followed europes dictators autocrats doom 1930s wanted lies masses wrote believe visible reality experience trust eyes ears imaginations caught universal consistent itselfp pin past decade western world learned dont need fascist deploy elite strategy lying footsoldier mesmerised cummings architect brexit liea relnoreferrer noopener hrefhttpsdominiccummingscom20150808onthereferendum12newicmpollshows4636forstayingintheeueducationbbcpropagandawilliemunzenberg target_blankonce wrote admiringlyaof soviet propaganda techniques whichoverwhelm reason humans capacity objective analysis creating aemmoral pictureemsuch peoplesend little moral signals actionsp pthe consequence brexit devastating democracy proportion british public johnson says long continues enact xenophobic racist prejudices intention thea relnoreferrer noopener hrefhttpswwwnewstatesmancomtheexplainer202112whatdoesthenationalityandbordersbillmeanforyou target_blanknationality borders billa recent sewell report suggested white working class boys people minority ethnic backgrounds oppressed antiracism industryp pthis particular alliance elite mob use arendts phrase addicted lying scoured insides mechanisms democratic accountability destroyed peoples trust government exact moment energy security public health geopolitical stability questionp pas ive argued conservatism anymore political projection managerial class high finance bears allegiance political philosophy edmund burke michael oakeshott themp pthis government selfselected elite stratton found cummings ruthlessly discard obedient true believers maintain power result inner circle tightens lies biggerp |
61b3d5500f3548283e90ce9b | What Would It Take To ‘Fix’ Polling … And Other Questions From Podcast Listeners | pin this installment of the a tabindex1 relnoopener noreferrer hrefhttpsfivethirtyeightcomtagpoliticspodcast dataremovetabindextrue datastringifylinkhttpsfivethirtyeightcomtagpoliticspodcast target_blank datasktooltip_parentfivethirtyeight politics podcasta nate silver and galen druke open the mailbag and answer listener questions including how much it would cost to fix polling and why vice president kamala harris is polling less favorably than president biden they also ask whether a a tabindex1 relnoopener noreferrer hrefhttpswwwwashingtonpostcomopinions20211203bidenmediacoverageworsetrumpfavorable dataremovetabindextrue datastringifylinkhttpswwwwashingtonpostcomopinions20211203bidenmediacoverageworsetrumpfavorable target_blank datasktooltip_parentsentiment analysisa suggesting that the press covers biden more negatively than it did former president donald trump is a good or bad use of datap | pin installment tabindex1 relnoopener noreferrer hrefhttpsfivethirtyeightcomtagpoliticspodcast dataremovetabindextrue datastringifylinkhttpsfivethirtyeightcomtagpoliticspodcast target_blank datasktooltip_parentfivethirtyeight politics podcasta nate silver galen druke open mailbag answer listener questions including cost fix polling vice president kamala harris polling favorably president biden ask tabindex1 relnoopener noreferrer hrefhttpswwwwashingtonpostcomopinions20211203bidenmediacoverageworsetrumpfavorable dataremovetabindextrue datastringifylinkhttpswwwwashingtonpostcomopinions20211203bidenmediacoverageworsetrumpfavorable target_blank datasktooltip_parentsentiment analysisa suggesting press covers biden negatively president donald trump good bad use datap |
61b3d5b80f3548283e90ceac | Princeton Marxists Protest Campus Appearance by ‘Trans Epidemic’ Speaker | pimg width736 alt srchttpss1freebeaconcomup2021121cd01ad7ba3f4927aa60d429baeef80a1_736x5141jpg height514ppin the ultimate exhibition of campus intersectionality student communists at princeton university connected their protest of an author they view as quottransphobicquot to their fight to end capitalismp
pquotlgbt oppression has a central role in maintaining the capitalism means of productionquot princetons revolutionary student action group wrote in a letter plastered around campus ahead of a speech by abigail shrier author of emirreversible damage the transgender craze seducing our daughters emquotthe liberation of the working class is liberation from gender oppressionquotp
pthe student flier argues that combating shriers book billed as a deep dive into what she calls a quottrans epidemicquot in young girls was part of their quotfight for a socialist futurequotp
pimg sizesmaxwidth 768px 100vw 768px srchttpss1freebeaconcomup2021121cd01ad7ba3f4927aa60d429baeef80a2jpg alt width768 srcsethttpsfreebeaconcomwpcontentuploads2021121cd01ad7ba3f4927aa60d429baeef80a2jpg 768w httpsfreebeaconcomwpcontentuploads2021121cd01ad7ba3f4927aa60d429baeef80a2225x300jpg 225w httpsfreebeaconcomwpcontentuploads2021121cd01ad7ba3f4927aa60d429baeef80a2736x981jpg 736w httpsfreebeaconcomwpcontentuploads2021121cd01ad7ba3f4927aa60d429baeef80a2368x491jpg 368w httpsfreebeaconcomwpcontentuploads2021121cd01ad7ba3f4927aa60d429baeef80a2150x200jpg 150w classwpimage1546395 height1024p
pimg sizesmaxwidth 768px 100vw 768px srchttpss4freebeaconcomup2021127ce9f6d7fc7449c0ac24cb08242b9723jpg alt width768 srcsethttpsfreebeaconcomwpcontentuploads2021127ce9f6d7fc7449c0ac24cb08242b9723jpg 768w httpsfreebeaconcomwpcontentuploads2021127ce9f6d7fc7449c0ac24cb08242b9723225x300jpg 225w httpsfreebeaconcomwpcontentuploads2021127ce9f6d7fc7449c0ac24cb08242b9723736x981jpg 736w httpsfreebeaconcomwpcontentuploads2021127ce9f6d7fc7449c0ac24cb08242b9723368x491jpg 368w httpsfreebeaconcomwpcontentuploads2021127ce9f6d7fc7449c0ac24cb08242b9723150x200jpg 150w classwpimage1546398 height1024p
prevolutionary student action is a student branch of workers voice an openly marxist organization that believes quotcapitalism can only be overcome through a socialist revolutionquot its website which is linked on the princeton flier says the groups mission is to quotpave the road to communismquot and a quotclassless society free of exploitation and oppressionquotp
pshriers wednesday event was cohosted by the princeton open campus coalition and the emprinceton toryem the schools conservative newspaper the event was held at an offcampus location disclosed only to attendees organizers told the emfree beaconem to protect students from harassment from groups like revolutionary student action which isnt recognized by the universityp
pquotwe are thrilled that the event itself took place without disruption but the visceral reaction of certain princeton community members is indicative of an ailing culture surrounding open discourse and robust dialoguequot said myles mcknight president of the open campus coalition quotwe feel that students should be excited to engage with differing points of view on controversial issues about which reasonable people disagreequotp
popposition to shriers event was not limited to the communist group mcknight said several students reported being verbally harassed by peers who knew they were attending the event several students turned to social media to slam the university for allowing the event to proceedp
pquotthis woman has openly demonstrated in her twt [sic] feed that shes arriving on campus with the mission of engaging in transphobic discourse with princeton [sic] studentsquot one instagram post shared with the emfree beaconem readsp
pprincetons gender and sexuality resource center hosted a counterevent a quotteachinquot on transgender issues wednesday night in collaboration with the princeton pride alliancep
pseveral prominent figures in recent years have faced backlash for deviating from the progressive line on transgender issues both on college campuses and off kathleen stock a sex and gender researcher a relnoopener hrefhttpswwwtheguardiancomworld2021oct28sussexprofessorkathleenstockresignsaftertransgenderrightsrow target_blankresigneda from the university of sussex in october after mobs of students protested against her belief in the existence of biological sex internationally acclaimed author jk rowling has been shunned for suggesting that the elimination of sex erases womenit is a relnoopener hrefhttpswwwhollywoodreportercomtvtvnewsharrypotterretrospectivetofeaturecastbutnojkrowling1235048570 target_blankwidely believeda she was left out of the 20th anniversary celebration of her harry potter series because of her comments on transgenderismp
pshrier posted her a relnoopener hrefhttpsabigailshriersubstackcompwhatitoldthestudentsofprinceton target_blankfull remarksa at princeton shortly after her appearance in which she addressed the pushback shes gotten from many on the leftp
pquotim not a provocateur i dont get a rush from making people angryquot shrier said quotyou dont have to be a troll to find yourself in the center of controversy you need only be two things effective and unwilling to back downquotp
pthe communist letter said shriers appearance quotput peoples lives at risk by further marginalizing themquotp
pthe post a relnofollow hrefhttpsfreebeaconcomcampusprincetonmarxistsprotestcampusappearancebytransepidemicspeakerprinceton marxists protest campus appearance by trans epidemic speakera appeared first on a relnofollow hrefhttpsfreebeaconcomwashington free beaconap | pimg width736 alt srchttpss1freebeaconcomup2021121cd01ad7ba3f4927aa60d429baeef80a1_736x5141jpg height514ppin ultimate exhibition campus intersectionality student communists princeton university connected protest author view quottransphobicquot fight end capitalismp pquotlgbt oppression central role maintaining capitalism means productionquot princetons revolutionary student action group wrote letter plastered campus ahead speech abigail shrier author emirreversible damage transgender craze seducing daughters emquotthe liberation working class liberation gender oppressionquotp pthe student flier argues combating shriers book billed deep dive calls quottrans epidemicquot young girls quotfight socialist futurequotp pimg sizesmaxwidth 768px 100vw 768px srchttpss1freebeaconcomup2021121cd01ad7ba3f4927aa60d429baeef80a2jpg alt width768 srcsethttpsfreebeaconcomwpcontentuploads2021121cd01ad7ba3f4927aa60d429baeef80a2jpg 768w httpsfreebeaconcomwpcontentuploads2021121cd01ad7ba3f4927aa60d429baeef80a2225x300jpg 225w httpsfreebeaconcomwpcontentuploads2021121cd01ad7ba3f4927aa60d429baeef80a2736x981jpg 736w httpsfreebeaconcomwpcontentuploads2021121cd01ad7ba3f4927aa60d429baeef80a2368x491jpg 368w httpsfreebeaconcomwpcontentuploads2021121cd01ad7ba3f4927aa60d429baeef80a2150x200jpg 150w classwpimage1546395 height1024p pimg sizesmaxwidth 768px 100vw 768px srchttpss4freebeaconcomup2021127ce9f6d7fc7449c0ac24cb08242b9723jpg alt width768 srcsethttpsfreebeaconcomwpcontentuploads2021127ce9f6d7fc7449c0ac24cb08242b9723jpg 768w httpsfreebeaconcomwpcontentuploads2021127ce9f6d7fc7449c0ac24cb08242b9723225x300jpg 225w httpsfreebeaconcomwpcontentuploads2021127ce9f6d7fc7449c0ac24cb08242b9723736x981jpg 736w httpsfreebeaconcomwpcontentuploads2021127ce9f6d7fc7449c0ac24cb08242b9723368x491jpg 368w httpsfreebeaconcomwpcontentuploads2021127ce9f6d7fc7449c0ac24cb08242b9723150x200jpg 150w classwpimage1546398 height1024p prevolutionary student action student branch workers voice openly marxist organization believes quotcapitalism overcome socialist revolutionquot website linked princeton flier says groups mission quotpave road communismquot quotclassless society free exploitation oppressionquotp pshriers wednesday event cohosted princeton open campus coalition emprinceton toryem schools conservative newspaper event held offcampus location disclosed attendees organizers told emfree beaconem protect students harassment groups like revolutionary student action isnt recognized universityp pquotwe thrilled event took place disruption visceral reaction certain princeton community members indicative ailing culture surrounding open discourse robust dialoguequot said myles mcknight president open campus coalition quotwe feel students excited engage differing points view controversial issues reasonable people disagreequotp popposition shriers event limited communist group mcknight said students reported verbally harassed peers knew attending event students turned social media slam university allowing event proceedp pquotthis woman openly demonstrated twt [sic] feed shes arriving campus mission engaging transphobic discourse princeton [sic] studentsquot instagram post shared emfree beaconem readsp pprincetons gender sexuality resource center hosted counterevent quotteachinquot transgender issues wednesday night collaboration princeton pride alliancep pseveral prominent figures recent years faced backlash deviating progressive line transgender issues college campuses kathleen stock sex gender researcher relnoopener hrefhttpswwwtheguardiancomworld2021oct28sussexprofessorkathleenstockresignsaftertransgenderrightsrow target_blankresigneda university sussex october mobs students protested belief existence biological sex internationally acclaimed author jk rowling shunned suggesting elimination sex erases womenit relnoopener hrefhttpswwwhollywoodreportercomtvtvnewsharrypotterretrospectivetofeaturecastbutnojkrowling1235048570 target_blankwidely believeda left 20th anniversary celebration harry potter series comments transgenderismp pshrier posted relnoopener hrefhttpsabigailshriersubstackcompwhatitoldthestudentsofprinceton target_blankfull remarksa princeton shortly appearance addressed pushback shes gotten leftp pquotim provocateur dont rush making people angryquot shrier said quotyou dont troll find center controversy need things effective unwilling downquotp pthe communist letter said shriers appearance quotput peoples lives risk marginalizing themquotp pthe post relnofollow hrefhttpsfreebeaconcomcampusprincetonmarxistsprotestcampusappearancebytransepidemicspeakerprinceton marxists protest campus appearance trans epidemic speakera appeared relnofollow hrefhttpsfreebeaconcomwashington free beaconap |
61b3d6160f3548283e90ceb6 | How Big Oil Rigs the System to Keep Winning | a hrefhttpstruthoutorgarticleshowbigoilrigsthesystemtokeepwinningimg sizesmaxwidth 200px 100vw 200px srchttpstruthoutorgwpcontentuploads2021122021_1210gaspowerplant200x123jpg width200 altclimate activists demonstrate outside the gates of the mossmorran petrochemical refinery near cowdenbeath scotland to protest against flaring and pollution at the plant on august 1 2021 srcsethttpstruthoutorgwpcontentuploads2021122021_1210gaspowerplant200x123jpg 200w httpstruthoutorgwpcontentuploads2021122021_1210gaspowerplant400x246jpg 400w httpstruthoutorgwpcontentuploads2021122021_1210gaspowerplant1200x737jpg 1200w httpstruthoutorgwpcontentuploads2021122021_1210gaspowerplant800x491jpg 800w httpstruthoutorgwpcontentuploads2021122021_1210gaspowerplant1536x943jpg 1536w httpstruthoutorgwpcontentuploads2021122021_1210gaspowerplant2048x1257jpg 2048w httpstruthoutorgwpcontentuploads2021122021_1210gaspowerplant2400x1473jpg 2400w classwppostimage height123aasidethis article is published as part of a hrefhttpscoveringclimatenoworgcovering climate nowa a global collaboration of news outlets strengthening coverage of the climate storyaside
pspandespite countless spana hrefhttpsinsideclimatenewsorgprojectexxontheroadnottakenspaninvestigationsspanaspan spana hrefhttpsgizmodocomshelljustgotwreckedindutchcourt1846972483spanlawsuitsspanaspan spana hrefhttpsgizmodocombigoilsliesarefinallygettingthepublicscrutinyt1846159657spansocial shamingspanaspan and regulations dating back decades the oil and gas industry remains formidable after all it has made consuming its products seem like a human necessity it has confused the public about climate science bought the eternal gratitude of one of americas two main political parties and repeatedly outmaneuvered regulatory efforts and it has done all this in part by thinking ahead and then acting ruthlessly while the rest of us were playing checkers its executives were playing threedimensional chessspanp
pspantake this brief tour of the industrys history and then ask yourself is there any doubt that these companies are now plotting to keep the profits rolling in even as megahurricanes and roaring wildfires spana hrefhttpsgizmodocomtheipccwarnsthisisamakeorbreakdecadeforhuman1847444573spanscream the dangersspanaspan of the climate emergency spanp
h2bthe john d rockefeller mythbh2
pspanida tarbell is one of the most celebrated investigative journalists in american history long before bob woodward and carl bernstein exposed the watergate scandal tarbells reporting broke up the standard oil monopoly in 19 articles that became a widely read book spana hrefhttpswwwbritannicacomtopicthehistoryofthestandardoilcompanyispanhistory of the standard oil companyspaniaispanspanispan published in 1904 she exposed spanspanits unsavory practices spanspaninspanspan 1911 federal regulators used tarbells findings to break standard oil into 33 much smaller companiesspanp
pspandavid had slayed goliath the us government had set a monopolybusting standard for future generations john d rockefeller standard oils owner lost the good guys wonor so it seemedspanp
pspanin fact rockefeller saw what was coming and ended up profitingmassivelyfrom the breakup of his company rockefeller made sure to retain significant stock holdings in each of standard oils 33 offspring and position them in different parts of the us where they wouldnt compete against one another collectively the 33 offspring went on to make rockefeller very very rich indeed it was the spanispanbreakupspanispan of standard oil that tripled his wealth and made him the wealthiest man in the world in 1916 five years after standard oil was broken up rockefeller became the worlds first billionaire spanp
h2bsay it aint so dr seussbh2
pspanone of the offspring of standard oil was esso so spelled out which later launched one of the most successful advertising campaigns in history it did so by relying on the talents of a young cartoonist who millions would later adore under his pen name dr seuss decades before authoring the proenvironment parable spanispanthe loraxspanispan theodore geisel helped esso market flit a household spray gun that killed mosquitoes what americans werent told was that the pesticide ddt made up 5 of each blast of flitspanp
pspanwhen esso put considerable creative resources behind the flit campaign they were looking years ahead to a time when they would also successfully market oilbased products the campaign spana hrefhttpsworldhistoryprojectorg1928theodorseussgeiseldrseusscreatesartworkfortheflitadcampaignspanran for 17 yearsspanaspan in the 1940s and 1950s at the time an unheard length of time for an ad campaign it taught esso and other standard oil companies how to sell derivative products like plastic and pesticides that made the company and the brand a household name in the minds of the public in its day quick henry the flit was as ubiquitous as got milk is todayspanp
pspanat the time the public and even many scientists didnt appreciate the deadly nature of ddt that didnt come until spanspanthe 1962 publication of rachel carsons book spana hrefhttpsbookshoporgbookssilentspringanniversary9780618249060ispansilent springspaniaspan but accepting that ddt was deadly was hard in part spanspanbecause of the genius of geisel whose wacky charactersstrikingly similar to the figures who would later populate dr seuss booksenergetically extolled flits alleged benefits spanp
pspangeisel later said the spanspanexperiencespanspan taught me conciseness and how to marry pictures with words the flit ad campaign was incredibly smart and clever marketing it taught the industry how to sell a dangerous and unnecessary product as if it were something useful and even fun years later exxonmobil would take that cleverness to new heights in its advertorials they werent about clever characters but they were awfully clever containing few if any outright lies but a whole lot of halftruths and misrepresentations it was clever enough to convince the new york times to run them without labeling them as the advertisements that they in fact were spanspantheir climate advertorials appeared in the oped page of the new york times and were spana hrefhttpswwwtheguardiancomenvironment2021nov18theforgottenoiladsthattoldusclimatechangewasnothingspanpart of what scholarsspanaspan have called the longest regular weekly use of media to influence public and elite opinion in contemporary americaspanp
h2bcontrolling climate sciencebh2
pspanbig oil also saw climate change coming as abundant investigative reporting and spana hrefhttpsgizmodocomexxonacknowledgedclimatechangeinternallybutstill1798342694spanacademic studiesspanaspan have documented the companies own scientists were telling their executives in the 1970s that burning more oil and other fossil fuels would spana hrefhttpsgizmodocomexxonpredicted2019sominousco2milestonein19821834748763spanoverheat the planetspanaspan other scientists had been saying so since the 1960s the companies responded by lying about the danger of their products blunting public awareness and lobbying against government action the result is todays climate emergency spanp
pspanless wellknown is how oil and gas companies didnt just lie about their own research they also mounted a stealth campaign to monitor and influence what the rest of the scientific community learned and said about climate change spanp
pspanthe companies embedded scientists in universities and made sure they were present at important conferences they nominated them to be contributors to the intergovernmental panel on climate change the un body whose assessments from 1990 onward defined what the press public and policymakers thought was true about climate science while the ipcc reports which rely on consensus science were sound big oils scientific participation gave them an insiders view of the road ahead more ominously they introduced the art of questioning the consensus science in forums where every word is parsedspanp
pspanthe industry was employing a strategy pioneered by tobacco companies but with a twist beginning in the 1950s the tobacco industry cultivated a sotto voce network of scientists at scores of american universities and medical schools whose work it funded some of these scientists were actively engaged in research to discredit the idea that cigarette smoking was a health risk but most of it was more subtle the industry supported research on causes of cancer and heart disease other than tobacco such as radon asbestos and diet it was a form of misdirection designed to deflect our attention away from the harms of tobacco and onto other things the scheme worked for a while but when it was exposed in the 1990s in part through lawsuits the bad publicity largely killed it what selfrespecting scientist would take tobacco industry money after that spanp
pspanthe oil and gas industry learned from that mistake and decided that instead of working surreptitiously it would work in the open and rather than work primarily with individual scientists whose work might be of use it would seek to influence the direction of the scientific community as a whole the industrys internal scientists continued to do research and publish peerreviewed articles but the industry also openly funded university collaborations and other researchers from the late 1970s through the 1980s exxon was known both as a climate research pioneer and as a generous patron of university science supporting student research and fellowships at many major universities its scientists also worked alongside senior colleagues at nasa the department of energy and other key institutions and funded breakfasts luncheons and other activities at scientific meetings those efforts had the net effect of creating goodwill and bonds of loyalty its been effective spanp
pspanthe industrys scientists may have been operating in good faith but their work helped delay public recognition of the scientific consensus that climate change was unequivocally manmade happening now and very dangerous the industrys extensive presence in the field also gave it early access to cutting edge research it used to its advantage exxon for example designed oil platforms to accommodate more rapid sea level rise even as the company publicly denied that climate change was occurring spanp
h2bdont call it methane its natural gasbh2
pspanmethane is an even more powerful greenhouse gas than carbon dioxide yet it has received far less attention one reason is that the oil and gas industry has positioned methane which marketing experts cleverly labeled natural gasas the future of the energy economy the industry promotes methane gas as a clean fuel thats needed to bridge the transition from todays carbon economy to tomorrows renewable energy era some go further and see gas as a permanent part of the energy landscape bps plan is renewables plus gas for the foreseeable future and the company and other oil majors spana hrefhttpsheatedworldpmisleadingclimateadsfrombigoilspanfrequently invokespana a hrefhttpswwwbpcomenglobalcorporatewhatwedogasandlowcarbonenergyhtmlspanlow carbonspanaspan instead of no carbonspanp
pspanexcept that methane gas isnt clean its about 80 times more potent at trapping heat in the atmosphere than carbon dioxide is spanp
pspanas recently as a decade ago many scientists and environmentalists viewed natural gas as a climate hero the oil and gas industrys ad guys encouraged this view by portraying gas as a coal killer the american petroleum institute paid millions to spana hrefhttpswwwapiorgnewspolicyandissuesnews20170205apilaunchespowerpastimpossiblecampaspanrun its firstever super bowl adspanaspan in 2017 portraying gas as an engine of innovation that powers the american way of life between 2008 and 2019 api spent more than 750 million on public relations advertising and communications for both oil and gas interests spana hrefhttpsclimateinvestigationsorgtradeassociationprspendingamericanpetroleuminstitutespanan analysisspanaspan by the climate investigations center found today most americans view gas as clean even though spana hrefhttpsccareportscareportsenvironmentalimpactsofshalegasextractionincanadaspanscience showsspanaspan that we cant meet our climate goals without spana hrefhttpsgizmodocompledgesarenotplansworldstopmethanehuntercal1848005460spanquickly transitioning awayspanaspan from it the bottom line is that we cant solve a problem caused by fossil fuels with more fossil fuels but the industry has spana hrefhttpstomdispatchcomnaomioreskesagreenbridgetohellspanmade a lot of usspanaspan think otherwise spanp
pspantheres little chance the oil and gas industry can defeat renewable energy in the long term wind solar and geothermal whichspan spanare clean and costcompetitive will eventually dominate energy markets researchers at the university of california berkeley gridlab and energy innovation have found that spana hrefhttpswwwrewiringamericaorgspanthe us can achieve 90 clean electricity by the year 2035spanaspan with spana hrefhttpsenergyinnovationorgwpcontentuploads202009pathwaysto100zerocarbonpowerby2035withoutincreasingcustomercostspdfspanno new gasspanaspan and at no additional cost to consumers but the oil and gas industry doesnt need to win the fight in the long term it just needs to win spanispanright now spanispanso it can keep developing oil and gas fields that will be in use for decades to come to do that it just has to keep doing what it has done for the past 25 years win today fight again tomorrow spanp
h2ba spiders web of pipelinesbh2
pspanheres a final example of how the oil and gas industry plans for the next war even as its adversaries are still fighting the last one almost no one outside of a few law firms trade groups and congressional staff in washington dc knows what the spana hrefhttpswwwfercgovspanfederal energy regulatory commissionspanaspan is or does but the oil and gas industry knows and it moved quickly after donald trump became president to lay the groundwork for decades of future fossil fuel dependency spanp
pspanferc has long been a rubber stamp for the oil and gas industry the industry proposes gas pipelines and ferc approves them when ferc approves a pipeline that approval grants the pipeline eminent domain which in effect makes the pipeline all but impossible to stop spanp
pspaneminent domain gives a company the legal right to build a pipeline through landowners properties and there is nothing they or state or county officials can do about it a couple of states have successfully though temporarily blocked pipelines by invoking federal statutes such as the clean water act but if those state cases reach the current supreme court the three justices trump appointedneil gorsuch brett kavanaugh and amy coneybarrettare almost certain to rule in the industrys favorspanp
pspanoil and gas industry executives seized upon trumps arrival in the white house in the opening days of his administration independent researchers listened in on public trade gatherings of the executives who talked about flooding the zone at ferc the industry planned to submit not just one or two but nearly a dozen interstate gas pipeline requests plotted on a map the projected pipelines covered so much of the us that they resembled a spiders web spanp
pspanonce pipelines are in the system companies can start to build them and utility commissioners in every corner of america see this gas infrastructure as a fait accompli and pipelines are built to last decades in fact if properly maintained a pipeline can last forever in principle this strategy could allow the oil and gas industry to lock in fossil fuel dependency for the rest of the century spanp
pspanin hindsight its clear that oil and gas industry leaders used outright climate denial when it suited their corporate and political interests throughout the 1990s but now that outright denial is no longer credible theyve pivoted from denial to delay industry pr and marketing efforts have shifted massive resources to a central message that yes climate change is real but that the necessary changes will require more research and decades to implement and above all more fossil fuels spana hrefhttpswwwtheguardiancomenvironment2021sep09bigoildelaytacticsnewclimatesciencedenialspanclimate delayspanaspan is the new climate denialspanp
pspannearly every major oil and gas company now claims that they accept the science and that they support sensible climate policies but their actions speak louder than words its clear that the future they want is one that still uses fossil fuels abundantlyregardless of what the science says whether it is selling deadly pesticides or deadly fossil fuels they will do what it takes to keep their products on the market now that were in a race to a clean energy future its time to recognize that they simply cant be trusted as partners in that race weve been fooled too many timesspanp | hrefhttpstruthoutorgarticleshowbigoilrigsthesystemtokeepwinningimg sizesmaxwidth 200px 100vw 200px srchttpstruthoutorgwpcontentuploads2021122021_1210gaspowerplant200x123jpg width200 altclimate activists demonstrate outside gates mossmorran petrochemical refinery near cowdenbeath scotland protest flaring pollution plant august 1 2021 srcsethttpstruthoutorgwpcontentuploads2021122021_1210gaspowerplant200x123jpg 200w httpstruthoutorgwpcontentuploads2021122021_1210gaspowerplant400x246jpg 400w httpstruthoutorgwpcontentuploads2021122021_1210gaspowerplant1200x737jpg 1200w httpstruthoutorgwpcontentuploads2021122021_1210gaspowerplant800x491jpg 800w httpstruthoutorgwpcontentuploads2021122021_1210gaspowerplant1536x943jpg 1536w httpstruthoutorgwpcontentuploads2021122021_1210gaspowerplant2048x1257jpg 2048w httpstruthoutorgwpcontentuploads2021122021_1210gaspowerplant2400x1473jpg 2400w classwppostimage height123aasidethis article published hrefhttpscoveringclimatenoworgcovering climate nowa global collaboration news outlets strengthening coverage climate storyaside pspandespite countless spana hrefhttpsinsideclimatenewsorgprojectexxontheroadnottakenspaninvestigationsspanaspan spana hrefhttpsgizmodocomshelljustgotwreckedindutchcourt1846972483spanlawsuitsspanaspan spana hrefhttpsgizmodocombigoilsliesarefinallygettingthepublicscrutinyt1846159657spansocial shamingspanaspan regulations dating decades oil gas industry remains formidable consuming products like human necessity confused public climate science bought eternal gratitude americas main political parties repeatedly outmaneuvered regulatory efforts thinking ahead acting ruthlessly rest playing checkers executives playing threedimensional chessspanp pspantake brief tour industrys history ask doubt companies plotting profits rolling megahurricanes roaring wildfires spana hrefhttpsgizmodocomtheipccwarnsthisisamakeorbreakdecadeforhuman1847444573spanscream dangersspanaspan climate emergency spanp h2bthe john d rockefeller mythbh2 pspanida tarbell celebrated investigative journalists american history long bob woodward carl bernstein exposed watergate scandal tarbells reporting broke standard oil monopoly 19 articles widely read book spana hrefhttpswwwbritannicacomtopicthehistoryofthestandardoilcompanyispanhistory standard oil companyspaniaispanspanispan published 1904 exposed spanspanits unsavory practices spanspaninspanspan 1911 federal regulators tarbells findings break standard oil 33 smaller companiesspanp pspandavid slayed goliath government set monopolybusting standard future generations john d rockefeller standard oils owner lost good guys wonor seemedspanp pspanin fact rockefeller saw coming ended profitingmassivelyfrom breakup company rockefeller sure retain significant stock holdings standard oils 33 offspring position different parts wouldnt compete collectively 33 offspring went rockefeller rich spanispanbreakupspanispan standard oil tripled wealth wealthiest man world 1916 years standard oil broken rockefeller worlds billionaire spanp h2bsay aint dr seussbh2 pspanone offspring standard oil esso spelled later launched successful advertising campaigns history relying talents young cartoonist millions later adore pen dr seuss decades authoring proenvironment parable spanispanthe loraxspanispan theodore geisel helped esso market flit household spray gun killed mosquitoes americans werent told pesticide ddt 5 blast flitspanp pspanwhen esso considerable creative resources flit campaign looking years ahead time successfully market oilbased products campaign spana hrefhttpsworldhistoryprojectorg1928theodorseussgeiseldrseusscreatesartworkfortheflitadcampaignspanran 17 yearsspanaspan 1940s 1950s time unheard length time ad campaign taught esso standard oil companies sell derivative products like plastic pesticides company brand household minds public day quick henry flit ubiquitous got milk todayspanp pspanat time public scientists didnt appreciate deadly nature ddt didnt come spanspanthe 1962 publication rachel carsons book spana hrefhttpsbookshoporgbookssilentspringanniversary9780618249060ispansilent springspaniaspan accepting ddt deadly hard spanspanbecause genius geisel wacky charactersstrikingly similar figures later populate dr seuss booksenergetically extolled flits alleged benefits spanp pspangeisel later said spanspanexperiencespanspan taught conciseness marry pictures words flit ad campaign incredibly smart clever marketing taught industry sell dangerous unnecessary product useful fun years later exxonmobil cleverness new heights advertorials werent clever characters awfully clever containing outright lies lot halftruths misrepresentations clever convince new york times run labeling advertisements fact spanspantheir climate advertorials appeared oped page new york times spana hrefhttpswwwtheguardiancomenvironment2021nov18theforgottenoiladsthattoldusclimatechangewasnothingspanpart scholarsspanaspan called longest regular weekly use media influence public elite opinion contemporary americaspanp h2bcontrolling climate sciencebh2 pspanbig oil saw climate change coming abundant investigative reporting spana hrefhttpsgizmodocomexxonacknowledgedclimatechangeinternallybutstill1798342694spanacademic studiesspanaspan documented companies scientists telling executives 1970s burning oil fossil fuels spana hrefhttpsgizmodocomexxonpredicted2019sominousco2milestonein19821834748763spanoverheat planetspanaspan scientists saying 1960s companies responded lying danger products blunting public awareness lobbying government action result todays climate emergency spanp pspanless wellknown oil gas companies didnt lie research mounted stealth campaign monitor influence rest scientific community learned said climate change spanp pspanthe companies embedded scientists universities sure present important conferences nominated contributors intergovernmental panel climate change un body assessments 1990 onward defined press public policymakers thought true climate science ipcc reports rely consensus science sound big oils scientific participation gave insiders view road ahead ominously introduced art questioning consensus science forums word parsedspanp pspanthe industry employing strategy pioneered tobacco companies twist beginning 1950s tobacco industry cultivated sotto voce network scientists scores american universities medical schools work funded scientists actively engaged research discredit idea cigarette smoking health risk subtle industry supported research causes cancer heart disease tobacco radon asbestos diet form misdirection designed deflect attention away harms tobacco things scheme worked exposed 1990s lawsuits bad publicity largely killed selfrespecting scientist tobacco industry money spanp pspanthe oil gas industry learned mistake decided instead working surreptitiously work open work primarily individual scientists work use seek influence direction scientific community industrys internal scientists continued research publish peerreviewed articles industry openly funded university collaborations researchers late 1970s 1980s exxon known climate research pioneer generous patron university science supporting student research fellowships major universities scientists worked alongside senior colleagues nasa department energy key institutions funded breakfasts luncheons activities scientific meetings efforts net effect creating goodwill bonds loyalty effective spanp pspanthe industrys scientists operating good faith work helped delay public recognition scientific consensus climate change unequivocally manmade happening dangerous industrys extensive presence field gave early access cutting edge research advantage exxon example designed oil platforms accommodate rapid sea level rise company publicly denied climate change occurring spanp h2bdont methane natural gasbh2 pspanmethane powerful greenhouse gas carbon dioxide received far attention reason oil gas industry positioned methane marketing experts cleverly labeled natural gasas future energy economy industry promotes methane gas clean fuel thats needed bridge transition todays carbon economy tomorrows renewable energy era gas permanent energy landscape bps plan renewables plus gas foreseeable future company oil majors spana hrefhttpsheatedworldpmisleadingclimateadsfrombigoilspanfrequently invokespana hrefhttpswwwbpcomenglobalcorporatewhatwedogasandlowcarbonenergyhtmlspanlow carbonspanaspan instead carbonspanp pspanexcept methane gas isnt clean 80 times potent trapping heat atmosphere carbon dioxide spanp pspanas recently decade ago scientists environmentalists viewed natural gas climate hero oil gas industrys ad guys encouraged view portraying gas coal killer american petroleum institute paid millions spana hrefhttpswwwapiorgnewspolicyandissuesnews20170205apilaunchespowerpastimpossiblecampaspanrun firstever super bowl adspanaspan 2017 portraying gas engine innovation powers american way life 2008 2019 api spent 750 million public relations advertising communications oil gas interests spana hrefhttpsclimateinvestigationsorgtradeassociationprspendingamericanpetroleuminstitutespanan analysisspanaspan climate investigations center found today americans view gas clean spana hrefhttpsccareportscareportsenvironmentalimpactsofshalegasextractionincanadaspanscience showsspanaspan cant meet climate goals spana hrefhttpsgizmodocompledgesarenotplansworldstopmethanehuntercal1848005460spanquickly transitioning awayspanaspan line cant solve problem caused fossil fuels fossil fuels industry spana hrefhttpstomdispatchcomnaomioreskesagreenbridgetohellspanmade lot usspanaspan think spanp pspantheres little chance oil gas industry defeat renewable energy long term wind solar geothermal whichspan spanare clean costcompetitive eventually dominate energy markets researchers university california berkeley gridlab energy innovation found spana hrefhttpswwwrewiringamericaorgspanthe achieve 90 clean electricity year 2035spanaspan spana hrefhttpsenergyinnovationorgwpcontentuploads202009pathwaysto100zerocarbonpowerby2035withoutincreasingcustomercostspdfspanno new gasspanaspan additional cost consumers oil gas industry doesnt need win fight long term needs win spanispanright spanispanso developing oil gas fields use decades come past 25 years win today fight tomorrow spanp h2ba spiders web pipelinesbh2 pspanheres final example oil gas industry plans war adversaries fighting outside law firms trade groups congressional staff washington dc knows spana hrefhttpswwwfercgovspanfederal energy regulatory commissionspanaspan oil gas industry knows moved quickly donald trump president lay groundwork decades future fossil fuel dependency spanp pspanferc long rubber stamp oil gas industry industry proposes gas pipelines ferc approves ferc approves pipeline approval grants pipeline eminent domain effect makes pipeline impossible stop spanp pspaneminent domain gives company legal right build pipeline landowners properties state county officials couple states successfully temporarily blocked pipelines invoking federal statutes clean water act state cases reach current supreme court justices trump appointedneil gorsuch brett kavanaugh amy coneybarrettare certain rule industrys favorspanp pspanoil gas industry executives seized trumps arrival white house opening days administration independent researchers listened public trade gatherings executives talked flooding zone ferc industry planned submit nearly dozen interstate gas pipeline requests plotted map projected pipelines covered resembled spiders web spanp pspanonce pipelines system companies start build utility commissioners corner america gas infrastructure fait accompli pipelines built decades fact properly maintained pipeline forever principle strategy allow oil gas industry lock fossil fuel dependency rest century spanp pspanin hindsight clear oil gas industry leaders outright climate denial suited corporate political interests 1990s outright denial longer credible theyve pivoted denial delay industry pr marketing efforts shifted massive resources central message yes climate change real necessary changes require research decades implement fossil fuels spana hrefhttpswwwtheguardiancomenvironment2021sep09bigoildelaytacticsnewclimatesciencedenialspanclimate delayspanaspan new climate denialspanp pspannearly major oil gas company claims accept science support sensible climate policies actions speak louder words clear future want uses fossil fuels abundantlyregardless science says selling deadly pesticides deadly fossil fuels takes products market race clean energy future time recognize simply cant trusted partners race weve fooled timesspanp |
61b527279847f7182e240ec8 | Great Protocol Politics | the 21st century doesnt belong to china the united states or silicon valley it belongs to the internet | 21st century doesnt belong china united states silicon valley belongs internet |
61b67858015894746e1a260f | Does China own more of America than we thought? | blockquotepthis paper demonstrates that the measured stock of chinas holding of us assets could be much higher than indicated by the us net international investment position data due to unrecorded historical chinese inflows into an increasingly popular global safe haven asset us residential real estate we first use aggregate capital flows data to show that the increase in unrecorded capital inflows in the us balance of payment accounts over the past decade is mainly linked to inflows from china into us housing markets then using a unique web traffic dataset that provides a direct measure of chinese demand for us housing at the zip code level we estimate via a differenceindifference matching framework that house prices in major us cities that are highly exposed to demand from china have on average grown 7 percentage points faster than similar neighborhoods with low exposure over the period 20102016 these average excess price growth gaps comove closely with macrolevel measures of us capital inflows from china and tend to widen following periods of economic stress in china suggesting that chinese households view us housing as a safe haven assetpblockquote
pif true does that raise or lower the chance of a war a relnoopener hrefhttpspapersssrncomsol3paperscfmabstract_id3965183 target_blankthat piecea is from william barcelona nathan converse and anna wong via the excellent a relnoopener hrefhttpswwwnationalaffairscomblogdetailfindingsadailyroundupinsidegames target_blankkevin lewisap
pthe post a relnofollow hrefhttpmarginalrevolutioncommarginalrevolution202112doeschinaownmoreofamericathanwethoughthtmldoes china own more of america than we thoughta appeared first on a relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap | blockquotepthis paper demonstrates measured stock chinas holding assets higher indicated net international investment position data unrecorded historical chinese inflows increasingly popular global safe haven asset residential real estate use aggregate capital flows data increase unrecorded capital inflows balance payment accounts past decade mainly linked inflows china housing markets unique web traffic dataset provides direct measure chinese demand housing zip code level estimate differenceindifference matching framework house prices major cities highly exposed demand china average grown 7 percentage points faster similar neighborhoods low exposure period 20102016 average excess price growth gaps comove closely macrolevel measures capital inflows china tend widen following periods economic stress china suggesting chinese households view housing safe haven assetpblockquote pif true raise lower chance war relnoopener hrefhttpspapersssrncomsol3paperscfmabstract_id3965183 target_blankthat piecea william barcelona nathan converse anna wong excellent relnoopener hrefhttpswwwnationalaffairscomblogdetailfindingsadailyroundupinsidegames target_blankkevin lewisap pthe post relnofollow hrefhttpmarginalrevolutioncommarginalrevolution202112doeschinaownmoreofamericathanwethoughthtmldoes china america thoughta appeared relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap |
Subsets and Splits