_id
stringlengths 24
24
| title
stringlengths 5
149
| content
stringlengths 74
164k
| clean_content
stringlengths 35
156k
|
---|---|---|---|
6179d5639cb58ea58cb4ef13 | Sequoia to go more long-term | blockquotepsequoia capital one of silicon valleys oldest and largest venture capital firms has launched a bold restructuring to create a single overarching fundp
pthe sequoia fund will take in capital from investors and funnel it to sequoias traditional venture funds which invest in us and european startups it will also hold sequoias stakes in publicly listed companies such as airbnb it will also charge a management fee of under 1 per cent and potential performance fees adding an extra layer of fees on top of its existing venture funds a person briefed on the changes saidp
psequoia hopes that the ambitious plan will give it and its investors more flexibility its investors will not have to commit their money to a specific vc fund for several years while sequoia will be able to hold on to its investments for longer than other vc funds which typically aim to return money to investors within a decade investments will no longer have expiration dates wrote sequoia partner roelof botha in a blog post our sole focus will be to grow value for our companies and limited partners over the long runp
psequoia also said it would file with the us securities and exchange commission to become a registered investment adviser allowing it to invest more money in cryptocurrencies public stocks and private shares that it does not purchase directly from companiespblockquote
pit seems we are headed toward a future where the larger more successful players move closer to being fullservice investment houses here is a relnoopener hrefhttpswwwftcomcontent7df180266af8438096b6c57dd5c8426e target_blankthe ft storya what is the best way to think about which assets they are building upon as the scarce factors behind their successes and what are the limits to exploiting those scarce factors which culture clashes need to be overcome for this to workp
pthis kind of number is not very reliable but in broad terms it tells you somethingp
blockquotepthe median us venture capital fund rose by 881 per cent in the 12 months through june this year according to estimates from the investment firm cambridge associatespblockquote
phere is a relnoopener hrefhttpsmediumcomsequoiacapitalthesequoiafundpatientcapitalforbuildingenduringcompanies9ed7bcd6c7daid_tokeneyjhbgcioijsuzi1niisimtpzci6imjizdjhyzdjngm1zwi4ywrjogvlzmziyzhmnweyzgq2y2y3ntq1ztqilcj0exaioijkv1qifqeyjpc3mioijodhrwczovl2fjy291bnrzlmdvb2dszs5jb20ilcjuymyioje2mzuyodmxodesimf1zci6ijixnji5njazntgznc1rmws2cwuwnjbzmnrwmmeyamftngxqzgntczawc3r0zy5hchbzlmdvb2dszxvzzxjjb250zw50lmnvbsisinn1yii6ijexnjixnzyxnjyxmjyzmdy3mda4miisimvtywlsijoidgnvd2vuqgdtywlslmnvbsisimvtywlsx3zlcmlmawvkijp0cnvllcjhenaioiiymtyyotywmzu4mzqtazfrnnflmdywczj0cdjhmmphbtrsamrjbxmwmhn0dgcuyxbwcy5nb29nbgv1c2vyy29udgvudc5jb20ilcjuyw1lijoivhlszxigq293zw4ilcjwawn0dxjlijoiahr0chm6ly9sadmuz29vz2xldxnlcmnvbnrlbnquy29tl2etl0fpade0r2gzdhvesfnlwhnhc21eblywsge1vw9nwmzruvrrngpay3rrzg14lxc9czk2lwmilcjnaxzlbl9uyw1lijoivhlszxiilcjmyw1pbhlfbmftzsi6iknvd2vuiiwiawf0ijoxnjm1mjgzndgxlcjlehaioje2mzuyodcwodesimp0asi6imfimmq0zwvlnzq3ywnkm2qwzmqwodflzgziodnmognlnmrjzdliotyifqqfw6pvuuvwbz5lq4kvtlgw_8vpamaki4fjd8ojjgmgnktiud4btljogl92cidin5pc3b3fd1k0uxuvqym5hpx90qcjtonfr14luobqksvtask7cs3t8s07swxyube_wxwhuw1a4yt_k9w5gu1lu5o6l4ofmrb24g8wdvc0klx_28mobwfsydmdeffnqdieevksdjqzznie3m8qmzcmajpje77ttojojmypke4ituoeevtp6eclwf38w9meldcfgvnjwsj3advxxztc6xx2hy4dfz041xyz3noik9lttspvxnyffh6ta2u1q8bii0uoi2axlly6bthiaalyx_g target_blanka useful short medium essaya from sequoia itselfp
pthe post a relnofollow hrefhttpmarginalrevolutioncommarginalrevolution202110sequoiatogomorelongtermhtmlsequoia to go more longterma appeared first on a relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap | blockquotepsequoia capital silicon valleys oldest largest venture capital firms launched bold restructuring create single overarching fundp pthe sequoia fund capital investors funnel sequoias traditional venture funds invest european startups hold sequoias stakes publicly listed companies airbnb charge management fee 1 cent potential performance fees adding extra layer fees existing venture funds person briefed changes saidp psequoia hopes ambitious plan investors flexibility investors commit money specific vc fund years sequoia able hold investments longer vc funds typically aim return money investors decade investments longer expiration dates wrote sequoia partner roelof botha blog post sole focus grow value companies limited partners long runp psequoia said file securities exchange commission registered investment adviser allowing invest money cryptocurrencies public stocks private shares purchase directly companiespblockquote pit headed future larger successful players closer fullservice investment houses relnoopener hrefhttpswwwftcomcontent7df180266af8438096b6c57dd5c8426e target_blankthe ft storya best way think assets building scarce factors successes limits exploiting scarce factors culture clashes need overcome workp pthis kind number reliable broad terms tells somethingp blockquotepthe median venture capital fund rose 881 cent 12 months june year according estimates investment firm cambridge associatespblockquote phere relnoopener hrefhttpsmediumcomsequoiacapitalthesequoiafundpatientcapitalforbuildingenduringcompanies9ed7bcd6c7daid_tokeneyjhbgcioijsuzi1niisimtpzci6imjizdjhyzdjngm1zwi4ywrjogvlzmziyzhmnweyzgq2y2y3ntq1ztqilcj0exaioijkv1qifqeyjpc3mioijodhrwczovl2fjy291bnrzlmdvb2dszs5jb20ilcjuymyioje2mzuyodmxodesimf1zci6ijixnji5njazntgznc1rmws2cwuwnjbzmnrwmmeyamftngxqzgntczawc3r0zy5hchbzlmdvb2dszxvzzxjjb250zw50lmnvbsisinn1yii6ijexnjixnzyxnjyxmjyzmdy3mda4miisimvtywlsijoidgnvd2vuqgdtywlslmnvbsisimvtywlsx3zlcmlmawvkijp0cnvllcjhenaioiiymtyyotywmzu4mzqtazfrnnflmdywczj0cdjhmmphbtrsamrjbxmwmhn0dgcuyxbwcy5nb29nbgv1c2vyy29udgvudc5jb20ilcjuyw1lijoivhlszxigq293zw4ilcjwawn0dxjlijoiahr0chm6ly9sadmuz29vz2xldxnlcmnvbnrlbnquy29tl2etl0fpade0r2gzdhvesfnlwhnhc21eblywsge1vw9nwmzruvrrngpay3rrzg14lxc9czk2lwmilcjnaxzlbl9uyw1lijoivhlszxiilcjmyw1pbhlfbmftzsi6iknvd2vuiiwiawf0ijoxnjm1mjgzndgxlcjlehaioje2mzuyodcwodesimp0asi6imfimmq0zwvlnzq3ywnkm2qwzmqwodflzgziodnmognlnmrjzdliotyifqqfw6pvuuvwbz5lq4kvtlgw_8vpamaki4fjd8ojjgmgnktiud4btljogl92cidin5pc3b3fd1k0uxuvqym5hpx90qcjtonfr14luobqksvtask7cs3t8s07swxyube_wxwhuw1a4yt_k9w5gu1lu5o6l4ofmrb24g8wdvc0klx_28mobwfsydmdeffnqdieevksdjqzznie3m8qmzcmajpje77ttojojmypke4ituoeevtp6eclwf38w9meldcfgvnjwsj3advxxztc6xx2hy4dfz041xyz3noik9lttspvxnyffh6ta2u1q8bii0uoi2axlly6bthiaalyx_g target_blanka useful short medium essaya sequoia itselfp pthe post relnofollow hrefhttpmarginalrevolutioncommarginalrevolution202110sequoiatogomorelongtermhtmlsequoia longterma appeared relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap |
6179d5809cb58ea58cb4ef15 | Biden Heads to COP 26 Throttled by Manchin and Trumpists – with Bob Pollin | a relnofollow hrefhttpstheanalysisnewsbidenheadstocop26throttledbymanchinandtrumpists titlebiden heads to cop 26 throttled by manchin and trumpists with bob pollinimg sizesmaxwidth 1024px 100vw 1024px srchttpstheanalysisnewswpcontentuploads202110webbobpolinclimate1024x576jpg width1024 alt srcsethttpstheanalysisnewswpcontentuploads202110webbobpolinclimate1024x576jpg 1024w httpstheanalysisnewswpcontentuploads202110webbobpolinclimate300x169jpg 300w httpstheanalysisnewswpcontentuploads202110webbobpolinclimate768x432jpg 768w httpstheanalysisnewswpcontentuploads202110webbobpolinclimatejpg 1100w classwebfeedsfeaturedvisual wppostimage height576aparve error src mismatch url httpsyoutubeh7hu_pgoce src in httpswwwyoutubecomembedh7hu_pgocefeatureoembedampenablejsapi1amporiginhttpstheanalysisnews src gen httpswwwyoutubecomembedh7hu_pgoceactual comparison url httpsyoutubeh7hu_pgoce src in httpswwwyoutubecomembedh7hu_pgoceenablejsapi1amporiginhttps3a2f2ftheanalysisnews src gen httpswwwp
pa relnofollow hrefhttpstheanalysisnewsbidenheadstocop26throttledbymanchinandtrumpistssourceap | relnofollow hrefhttpstheanalysisnewsbidenheadstocop26throttledbymanchinandtrumpists titlebiden heads cop 26 throttled manchin trumpists bob pollinimg sizesmaxwidth 1024px 100vw 1024px srchttpstheanalysisnewswpcontentuploads202110webbobpolinclimate1024x576jpg width1024 alt srcsethttpstheanalysisnewswpcontentuploads202110webbobpolinclimate1024x576jpg 1024w httpstheanalysisnewswpcontentuploads202110webbobpolinclimate300x169jpg 300w httpstheanalysisnewswpcontentuploads202110webbobpolinclimate768x432jpg 768w httpstheanalysisnewswpcontentuploads202110webbobpolinclimatejpg 1100w classwebfeedsfeaturedvisual wppostimage height576aparve error src mismatch url httpsyoutubeh7hu_pgoce src httpswwwyoutubecomembedh7hu_pgocefeatureoembedampenablejsapi1amporiginhttpstheanalysisnews src gen httpswwwyoutubecomembedh7hu_pgoceactual comparison url httpsyoutubeh7hu_pgoce src httpswwwyoutubecomembedh7hu_pgoceenablejsapi1amporiginhttps3a2f2ftheanalysisnews src gen httpswwwp pa relnofollow hrefhttpstheanalysisnewsbidenheadstocop26throttledbymanchinandtrumpistssourceap |
617b25244af2f3f8de4e68a6 | COVID Proves Andrew Yang's UBI Won't Work | div
picture
source sizesminwidth 600px 331px 100vw typeimagewebp srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads2021108136576_thumb2400x1350jpgwebp 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads2021108136576_thumb1200x675jpgwebp 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads2021108136576_thumb800x450jpgwebp 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads2021108136576_thumb600x338jpgwebp 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads2021108136576_thumb331x186jpgwebp 331w
source sizesminwidth 600px 331px 100vw typeimagejpeg srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads2021108136576_thumb2400x1350jpg 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads2021108136576_thumb1200x675jpg 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads2021108136576_thumb800x450jpg 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads2021108136576_thumb600x338jpg 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads2021108136576_thumb331x186jpg 331w
img width1200 alt8136576_thumb srchttpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads2021108136576_thumb800x450jpg height675
picture
div
pfears of automationinduced mass unemployment are at the heart of increasingly popular calls for a universal basic income ubip
pthough the idea has been kicking around a hrefhttpsreasoncom20170603theindestructibleideaofthefor centuriesa it really caught fire recently because of a hrefhttpsreasoncomtagandrewyangandrew yanga who ran for the democratic presidential nomination in 2020 and to be mayor of new york city in 2021 his a hrefhttpswwwandrewyangcomnew memoira and a hrefhttpswwwforwardpartycompolitical partya both called emforwardem put a ubi at the center of his agenda last year a hrefhttpsthehillcomhilltvwhatamericasthinking512099pollmajorityofvotersnowsaythegovernmentshouldhaveapolls showed a majority of votersa favoring the idea and cities like los angeles st paul atlanta and newark are experimenting with or considering local ubisp
pyang tells a hrefhttpsreasoncompeoplenickgillespienick gillespiea that cash payments are better than government programs for the same reason that the libertarian economist milton friedman advocated slashing social welfare in favor of direct subsidies to the poorbecause its more effective and humane to put unrestricted cash directly in the hands of those who need itp
pbut has automation actually led to fewer jobs in the past and what does americas experience with covidrelated stimulus checks that went to a hrefhttpswwwcnbccom202103251400dollarstimuluscheckswenttosomepeoplewhodonotneedthemhtml90 percent of householdsa and enhanced unemployment benefits suggest about the seriously negative effects of a ubi on labor force participation and the federal balance sheetp
pemrelatedem a hrefhttpsreasoncompodcast20211020andrewyangpoliticalviolenceisbecomingmoreandmoreofaninevitabilityquotandrew yang political violence is becoming more and more of an inevitabilityquotap
pemedited by john osterhoudt additional graphics by regan taylor isaac reese and lex villenaemp
pemphotos spana hrefhttpswwwfreepikcomphotosbackgroundmrsiraphola spana hrefhttpwwwfreepikcomspanwwwfreepikcomspanaspan gage skidmoreflickrcreative commons liu jie xinhua news agencynewscom gage skidmoreflickrcreative commons everett collectionnewscom gage skidmoreflickrcreative commons paul weaverzumapressnewscom gage skidmoreflickrcreative commons tesla richard b levinenewscom c neil decrescenzozuma press wirenewscom yichuan caosipa usanewscom mark reinsteinzuma wirenewscom lev radinpacific pressnewscomspanemp | div picture source sizesminwidth 600px 331px 100vw typeimagewebp srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads2021108136576_thumb2400x1350jpgwebp 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads2021108136576_thumb1200x675jpgwebp 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads2021108136576_thumb800x450jpgwebp 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads2021108136576_thumb600x338jpgwebp 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads2021108136576_thumb331x186jpgwebp 331w source sizesminwidth 600px 331px 100vw typeimagejpeg srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads2021108136576_thumb2400x1350jpg 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads2021108136576_thumb1200x675jpg 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads2021108136576_thumb800x450jpg 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads2021108136576_thumb600x338jpg 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads2021108136576_thumb331x186jpg 331w img width1200 alt8136576_thumb srchttpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads2021108136576_thumb800x450jpg height675 picture div pfears automationinduced mass unemployment heart increasingly popular calls universal basic income ubip pthough idea kicking hrefhttpsreasoncom20170603theindestructibleideaofthefor centuriesa caught fire recently hrefhttpsreasoncomtagandrewyangandrew yanga ran democratic presidential nomination 2020 mayor new york city 2021 hrefhttpswwwandrewyangcomnew memoira hrefhttpswwwforwardpartycompolitical partya called emforwardem ubi center agenda year hrefhttpsthehillcomhilltvwhatamericasthinking512099pollmajorityofvotersnowsaythegovernmentshouldhaveapolls showed majority votersa favoring idea cities like los angeles st paul atlanta newark experimenting considering local ubisp pyang tells hrefhttpsreasoncompeoplenickgillespienick gillespiea cash payments better government programs reason libertarian economist milton friedman advocated slashing social welfare favor direct subsidies poorbecause effective humane unrestricted cash directly hands need itp pbut automation actually led fewer jobs past americas experience covidrelated stimulus checks went hrefhttpswwwcnbccom202103251400dollarstimuluscheckswenttosomepeoplewhodonotneedthemhtml90 percent householdsa enhanced unemployment benefits suggest seriously negative effects ubi labor force participation federal balance sheetp pemrelatedem hrefhttpsreasoncompodcast20211020andrewyangpoliticalviolenceisbecomingmoreandmoreofaninevitabilityquotandrew yang political violence inevitabilityquotap pemedited john osterhoudt additional graphics regan taylor isaac reese lex villenaemp pemphotos spana hrefhttpswwwfreepikcomphotosbackgroundmrsiraphola spana hrefhttpwwwfreepikcomspanwwwfreepikcomspanaspan gage skidmoreflickrcreative commons liu jie xinhua news agencynewscom gage skidmoreflickrcreative commons everett collectionnewscom gage skidmoreflickrcreative commons paul weaverzumapressnewscom gage skidmoreflickrcreative commons tesla richard b levinenewscom c neil decrescenzozuma press wirenewscom yichuan caosipa usanewscom mark reinsteinzuma wirenewscom lev radinpacific pressnewscomspanemp |
617b25a64af2f3f8de4e68b0 | Chomsky and Pollin: COP26 Pledges Will Fail Unless Pushed by Mass Organizing | a hrefhttpstruthoutorgarticleschomskyandpollincop26pledgeswillfailunlesspushedbymassorganizingimg sizesmaxwidth 200px 100vw 200px srchttpstruthoutorgwpcontentuploads2021102021_1027chomskypollin200x124jpg width200 altrobert pollin and noam chomsky srcsethttpstruthoutorgwpcontentuploads2021102021_1027chomskypollin200x124jpg 200w httpstruthoutorgwpcontentuploads2021102021_1027chomskypollin400x248jpg 400w httpstruthoutorgwpcontentuploads2021102021_1027chomskypollin1200x744jpg 1200w httpstruthoutorgwpcontentuploads2021102021_1027chomskypollin800x496jpg 800w httpstruthoutorgwpcontentuploads2021102021_1027chomskypollin1536x953jpg 1536w httpstruthoutorgwpcontentuploads2021102021_1027chomskypollin2048x1270jpg 2048w httpstruthoutorgwpcontentuploads2021102021_1027chomskypollin2400x1489jpg 2400w classwppostimage height124apthe 26th session of the conference of the parties cop26 to the united nations framework convention on climate change unfccc which takes place in glasgow from october 31november 12 will bring together more than 120 world leaders for 12 days of talks aimed at forming an agreement on how to tackle the climate emergency the expectation is that countries will produce 2030 emissions reductions targets that will secure global net zero by 2050 for that to happen the phaseout of coal must be accelerated deforestation must be curtailed and investment in green energy must rise significantlyp
pthe urgency for action at cop26 cannot be overstated we are running out of chances to save the planet from a climate catastrophe but in order for the stated goals of cop26 to be attained it is imperative that narrow views of national interest be put aside and great powers steer clear of geopolitical confrontations indeed without international cooperation the continued use of fossil fuels is set to drive societies across the globe into climate chaos and collapsep
pso what can we expect from cop26 definite action or as greta thunberg recently put it more blah blah blah in this expansive and eyeopening interview leading scholars noam chomsky and robert pollin share their thoughts and insights about the upcoming global climate summit and what must ultimately be done to save humanity and the planet from a global climate catastrophe noam chomsky is institute professor emeritus at mit and currently laureate professor of linguistics and agnese nelms haury chair in the agnese nelms haury program in environment and social justice at the university of arizona chomsky one of the most cited scholars in history and long considered one of the uss voices of conscience is joined by one of the worlds leading economists of the left robert pollin distinguished professor and codirector of the political economy research institute at the university of massachusetts at amherst chomsky and pollin are coauthors of the recently published book emclimate crisis and the global green new deal the political economy to save the planetemp
pstrong cstrongstrongj polychroniou noam cop26 is believed to be our last best hope for meaningful action to tackle the climate crisis why is cop26 so important and wasnt pretty much the same thing said about cop21strongp
pstrongnoam chomskystrong it was indeed and correctly the concept of last best hope keeps narrowing whats the last best hope at one point is gone later and the remaining last best hope becomes far more difficult to realizep
pthats been true since the 1997 kyoto protocol ratified by 192 nations but not the us the senate would not accept it george w bush pulled out completely later canada did as well kyoto was the last best hope in 1997 if the us had joined the task of escaping devastating climate change would have been far easierp
pby 2015 the paris agreement cop21 the best hope was much more remote and difficult to realize again the us senate blocked it more precisely the plan was for a verifiable treaty but republicans would not accept that so it was reduced to toothless voluntary agreements and shortly after trump pulled out completely biden has formally rejoined but what that means remains to be seenp
pright now the republican commitment to destroying the planet in the interest of shortterm profit for their prime constituency of extreme wealth seems unassailable but it was not always so as weve a hrefhttpstruthoutorgarticleschomskyrepublicansarewillingtojeopardizehumansurvivaltoretakepowerdiscussed beforea in 2008 there were signs of a deviation towards minimal concern for the fate of humanity but it didnt last long a juggernaut by the huge koch brothers energy conglomerate quickly returned the party to obedience since unchangedp
pin defense of the stand of what was once a genuine political party we should take note of the fact that the us very rarely accepts international conventions and when it does so it is with reservations that render them inapplicable to the us thats even true of the genocide conventionp
pone may plausibly argue however that these fine distinctions are all irrelevant even when the us fully accepts international treaties it violates them at will hence also violating the us constitution which declares them to be the supreme law of the land binding on the political leadership the clearest case is the un charter the basis for modern international law it bans the threat or use of force in international affairs with reservations irrelevant to the constant violation of the treaty and the constitution by us presidentsp
asidethe us very rarely accepts international conventions and when it does so it is with reservations that render them inapplicable to the usaside
pso normal that it virtually never elicits a commentp
pdiscourse on international affairs has found a way around these inconvenient facts by devising the concept of a rulebased international order as contrasted with the oldfashioned unbased international order the former is preferred since the us can set the rules and determine how and when they can be enforced an interesting topic but not for nowp
pa treaty on climate change if it can be reached is in a different category survival is at stake the basic facts are brutally clear more so with each passing year they are laid out clearly enough in the latest intergovernmental panel on climate change ipcc report released on august 9 in brief any hope of avoiding disaster requires taking significant steps right away to reduce fossil fuel use continuing annually with the goal of effectively phasing out fossil fuel use by midcentury we are approaching a precipice a few steps more and we fall over it foreverp
pfalling off the precipice does not imply that everyone will die soon theres a long way down rather it means that irreversible tipping points will be reached and barring some nowunforeseen technological miracle the human species will be entering a new era one of inexorable decline with mounting horrors of the kind we can easily depict extrapolating realistically from what already surrounds us an optimistic estimate since nonlinear processes may begin to take off and dangers lurk that are only dimly perceivedp
pit will be an era of emsauve qui peutem run for your lives everyone for themselves material catastrophe heightened by social collapse and wholesale psychic trauma of a kind never before experienced and on the side an assault on nature of indescribable proportionsp
pall of this is understood at a very high level of confidence even a relic of rationality tells us that it is ridiculous to take a chance on its being mistaken considering the stakesp
pwe might tarry for a moment on the date of the release of the ipcc report august 9 whether by accident or design the choice is a momentous date in human affairs the anniversary of the atomic bombing of nagasaki putting aside the horrors and the dubious efforts at justification the hiroshima bombing a few days earlier demonstrated that human intelligence would soon reach the level of being able to destroy everything nagasaki demonstrated that the commitment to attain this goal was deeply entrenched in the reigning sociopolitical system and intellectual culture what remained open was whether human moral capacities and the institutions humans had created had the capacity to overcome what human intellect was on the verge of achieving total cataclysm after 75 frightening years the question still remains open even as prospects shrink for a hopeful answerp
pthe crisis of environmental destruction which extends well beyond the crime of global heating raises quite similar questionsp
pthe evidence at hand is not encouraging lets go back to august 9 2021 with its clear warning that we must begin now to reduce fossil fuel usep
pimmediately on receipt of this grim warning the president of the most powerful state in world history issued an appeal to the global oil cartel opec to emincreaseem production europe followed suit joined by the rest of what is called advanced society the reason is an energy crunch thats doubtless a problem one way to deal with it is to race towards the precipice another is for the rich in the rich societies the major culprits to tighten their belts while we sharply accelerate transition to sustainable energyp
pthe choice is unfolding before our eyesp
ppetroleum industry journals are euphoric announcing promising new discoveries that they can exploit to enhance production and reveling in the prospects for growing demand for their poisons a few examples fill in detailsp
pgermany is reacting to the august warning by joining in the call for increasing fossil fuel use and making its own contribution for example by a hrefhttpswwwwashingtonpostcomworld20211023germanycoalclimatecop26destroying villagesa to expand coal miningp
pturning to the us a mere a hrefhttpsclimatecommunicationyaleedupublicationspoliticsglobalwarmingseptember2021460 percenta of voters regard global warming as an urgent problem for government it is only the most urgent problem that humans have ever facedp
pthe party breakdown is the usual one among republicans 45 percent of liberalmoderate republicans see global warming as an urgent problem along with 17 percent of conservative republicans the persisting lethal denialism is not a great surprise in the light of pronouncements of the leadership and the media to which they are exposedp
pthanks to significant popular activism bidens major program now being torn to shreds in congress did include some useful steps on climate change nothing seems likely to survive republicans are 100 percent opposed democrats need unanimity to pass anything the senate chair of the committee on energy and natural resources is a rightwing democrat also a coal baron and the leading recipient of fossil fuel funding in congress joe manchin his position on climate concerns is simple a hrefhttpsbillmckibbensubstackcompjoemanchinstrulybrutalransomtokeneyj1c2vyx2lkijo0mzu0nde0nswicg9zdf9pzci6nde5mjg3mdesil8ioijuzw9rtcisimlhdci6mtyznta1mdixncwizxhwijoxnjm1mduzode0lcjpc3mioijwdwitndm4mtq2iiwic3viijoicg9zdc1yzwfjdglvbij9qpjf0jxerinpdeig4am9gb92mkpg5bi9hrmphkyehwspending on innovation not eliminationa straight out of the fossil fuel industry playbookp
asideturning to the us a mere 60 percent of voters regard global warming as an urgent problem for government it is only the most urgent problem that humans have ever facedaside
pin south america destruction of the amazon is proceeding apace for the benefit of the domestic and international corporate sector which has been hailing the policies of chicago school economics minister paulo guedes privatize everything and who cares about the consequences recent scientific studies a hrefhttpswwwreuterscominvestigatesspecialreportclimateunamazontippingpointhave founda that the southeastern amazon was releasing more carbon that it was absorbing even in rainy years when scientists had expected the forest to be in better health it meant a part of the rainforest was no longer helping to slow climate change but adding to the emissions driving itp
pthat is a disaster for brazil and indeed for the world given the role of the huge tropical forests in regulating the global climatep
pa a hrefhttpswwwbbccomnewsscienceenvironment58982445leaked reporta of governmental efforts to weaken the ipcc study shows that the usual scoundrels are at workp
psaudi arabia calls for eliminating such phrases as the need for urgent and accelerated mitigation actions at all scales and the focus of decarbonisation efforts in the energy systems sector needs to be on rapidly shifting to zerocarbon sources and actively phasing out fossil fuels it is joined by opec along with fossil fuel producers argentina and norwayp
psaudi officials elaborated further giving no details one saudi prince explained that a transition to netzero carbon emissions is welcome but it must be reached through a carbon circular economy a plan built around initiatives such as recycling and carbon removalp
pjust innovation no eliminationp
psaudi officials and the chief executive of saudi oil giant aramco a hrefhttpswwwwashingtonpostcomworldmiddle_eastsaudicarbonzerooilclimate202110234ddadae0340e11ec80367db255bff176_storyhtmlutm_campaignwp_post_mostutm_mediumemailutm_sourcenewsletterwpisrcnl_mostcartaurlhttps3a2f2fs2washingtonpostcom2fcarlntr2f3514e932f61757f579d2fda9d4121ca8d2f5977f250ae7e8a6816e8c2a12f372f722f61757f579d2fda9d4121ca8dthe press reportsa expect demand for oil to continue and for it to be the dominant energy source for decades to come and argue that reducing supply before demand drops risks a dangerous oil price spike hurting economies such as saudi arabias that are dependent on oil and gasp
pturning a hrefhttpswwwworldstopexportscomcoalexportscountryelsewherea a senior australian government official rejects the conclusion that closing coalfired power plants is necessary a stand that is perhaps related to australias position as the worlds leading coal exporterp
pcontinuing with the submissions to the ipcc brazil and argentina two of the biggest producers of beef products and animal feed crops in the world argue strongly against evidence in the draft report that reducing meat consumption is necessary to cut greenhouse gas emissions both countries call on the authors to delete or change some passages in the text referring to plantbased diets playing a role in tackling climate change or which describe beef as a high carbon foodp
pagain not surprisingly a significant number of switzerlands comments are directed at amending parts of the report that argue developing countries will need support particularly financial support from rich countries in order to meet emission reduction targetsp
pin brief as we fall off the precipice the nearuniform reaction is that emi want to grasp my share of the loot as doomsday approachesemp
preturning to the stillopen question posed by the august 9 anniversary do human moral capacities and the institutions humans have created have the capacity to overcome what human intellect and these institutions have shown themselves capable of achieving total cataclysmp
pthe answer will soon be knownp
asideif governments make pledges they wont implement them without extensive popular activismaside
pand while reflecting on the unanswered question we should never forget that human intellect has also forged feasible solutions to impending crises easily at hand though not for longp
pstronggiven our experience up to now with global climate talks should we really have high expectations about the outcome of cop26 after all in addition to everything you mentioned above global oil demand is booming china continues to build coalfired power plants around the world the us is bent on maintaining its hegemonic status in the world system and we not only have a divided world but a world where now the majority of citizens say that their countrys society is more divided than ever before indeed what can we realistically expect from cop26strongp
pstrongchomsky strongthe business press is generally fairly realistic its audience has a stake in knowing whats happening in the world so to answer the question it is useful to open todays october 24 business press and read the first paragraph of the a hrefhttpswwwnytimescom20211022businessstockscoalclimatechangehtmlmajor articlea on what we can realistically expect as the prospects for strong government action to curb climate change grow less certain energy shares and especially coal mining stocks are generating astonishing returns the article goes on to review the great opportunities for huge shortterm profits for the superrich while they destroy the diminishing hopes for a livable world for their children p
peconomists soberly explain that this is a market failure caused by externalities uncounted costs not false the article quotes a recent international monetary fund imf study that found that that marketbased fossil fuel prices in 2020 failed to account for 59 trillion in global environmental costs equivalent to 68 percent of global gross domestic product the imf estimated that the gap will rise to 74 percent of world gdp by 2025p
pnot false but misleading market failures occur all the time with increasing intensity since the heralded market revolution that has assaulted the world since ronald reagan opened the doors to wholesale robbery 40 years ago but the anodyne phrase market failure does not begin to do justice to the monstrous crime that statebacked capitalist institutions are perpetratingp
pthe business press gives little reason to be optimistic about the outcome of cop26 but its worth remembering that it does not consider what humans can accomplish if they choose with regard to human effort and action the outcome of cop26 doesnt matter all that much if governments make pledges they wont implement them without extensive popular activism if they dont make pledges they wont be driven to adopt and implement them without extensive popular activism the message is much the same whatever the outcome more work lots more on many fronts not excluding the longterm dedication to dismantle lethal institutions and the doctrines that chain people to themp
pstrongbob the economics of global warming and global climate stabilization are quite straightforward indeed a broad consensus has emerged about the economic impacts of global warming although there is disagreement among economists about the best solutions to achieve significant reductions in carbon emissions why is it so difficult to implement viable climate policies even at the national let alone the global level strongp
pstrongrobert pollinstrong lets start with the most obvious obstacle to advancing viable climate policies which is the implacable opposition of the fossil fuel companies here i refer to both the private companies such as exxonmobil and royal dutch shell as well as public corporations such as saudi aramco gazprom in russia and petrobras in brazil lets assume we are working with the target set out by the intergovernmental panel on climate change that we must stabilize the average global temperature at no more than 15 degrees celsius 15c above preindustrial levels within that framework the most recent a hrefhttpsscholarworksumasseducgiviewcontentcgiarticle3333contextdissertations_2careful researcha by tyler hansen shows that the extent of total fossil fuel assets owned by these corporations that are unburnable ie cannot be burned to produce energy if the world has a chance of achieving the 15c stabilization target amounts to between 1315 trillion of this total about 75 percent of these fossil fuel assets between about 1011 trillion are owned by the public corporations with the remaining 35 trillion owned by private corporations we should not be surprised that the fossil fuel companies are fighting by all means available to them to continue profiting lavishly from selling this oil coal and natural gas still in the ground they dont want to hear about dumping 15 trillion in assetsp
asidethe enactment of a robust just transition program in california led by the states labor unions will also provide a model for comparable measures to be adopted throughout the us and globallyaside
pits true that the publicly owned national companies controlling approximately 90 percent of the globes total fossil fuel reserves do not operate with precisely the same profit imperatives as big private energy corporations but lets be clear that this does not mean that they are prepared to commit to fighting climate change simply because their stated mission is to serve the public as opposed to private shareholders and because we the public face a global environmental emergency just as with the private companies producing and selling fossil fuel energy generates huge revenue flows for these publicly owned companies national development projects lucrative careers and political power all depend on continuing the flow of large fossil fuel revenuesp
poverall then there is no getting around that the interests of these fossil fuel companies will simply have to be defeated obviously that will not be easy to accomplish we are seeing this right now in the us with sen joe manchin of west virginia doing everything possible to kill even the minimally decent climate provisions of bidens build back better program manchin himself started his own coal brokerage company in the state and continues to a hrefhttpswwwnytimescom20210919climatemanchinclimatebidenhtmlreceive large profitsa from it we are also seeing it on a global scale with russian president vladimir putin issuing a hrefhttpswwwreuterscombusinessenergyputinwarnspossibleoilshortageduelackinvestment20211021dire warningsa of upcoming energy shortages if investments to expand fossil fuel supply do not increasep
pbut it is also critical to recognize that the fossil fuel companies are not the only obstacle to advancing a viable global climate stabilization project there is also the matter of pure inertia which cannot be overlooked we are faced with the challenge of building a new global energy infrastructure on the foundations of high efficiency and clean renewable energy while also phasing out our existing fossil fueldominant energy infrastructure this has to be a hugely challenging project even under the best of circumstances and even putting aside machinations of the fossil fuel companies i have experienced this firsthand for example in our project at umassamherst in which we built the first a hrefhttpswwwgazettenetcomcrottyhall8849235zeroemissions office buildinga in western massachusetts to house the economics department there are lots of new ways of doing things that need to be learned in terms of engineering use of materials and workers developing new skills it also requires people cooperating effectivelyp
pthere is also the absolutely critical question of just transition for workers and communities whose livelihoods are at present dependent on the fossil fuel industry in my view just transition has to be at the center of any global green new deal project there is no denying that these workers and communities throughout the world will lose out in the clean energy transition in order for the global clean energy project to succeed it must provide adequate transitional support for these workers and communities it is a matter of simple justice but it is also a matter of strategic politics without such adjustment assistance programs operating at a major scale the workers and communities facing retrenchment from the clean energy investment project will predictably and understandably fight to defend their communities and livelihoods this in turn will create unacceptable delays in proceeding with effective climate stabilization policiesp
pmy coworkers and i have estimated the costs of a very generous just transition program for all workers in the united states now tied to the fossil fuel and ancillary industries working with the assumption that all fossil fuel production will have been shut down by 2050 this program would include a reemployment guarantee with wages at least matching the workers current pay along with pension guarantees and as needed retraining and relocation support we a hrefhttpsirpcdnmultiscreensitecom6f2c9f57filesuploadedzerocarbonactionplanch03pdfestimateda these total costs as averaging about 3 billion per year this would be equal to roughly 1100 of one percent 001 percent of average us gdp between now and 2050 in other words in terms of financing it would be a trivial matter to establish this sort of just transition program throughout the us p
pin fact pathbreaking developments are occurring right now in california toward advancing a just transition program in the state this movement is being led by visionary labor leaders in the state including leaders of the states oil refinery workers union one such leader norman rogers a vice president of united steelworkers local 675 recently a hrefhttpswwwlatimescomopinionstory20211023oilgasjobscleanenergycaliforniawrotea in the emlos angeles timesem thatp
blockquote
pthough the energy transition is inevitable a just version is not workers know what happens when whole industries go away companies maneuver behind our backs squeeze every last drop of work out of a dying auto plant steel mill or coal mine and shutter it overnight devastating communities and stiffing workers out of jobs pensions and healthcare the fear is real of jobs lost with no plan for when operations begin to phase out p
blockquote
progers emphasizes that many speak of a just transition but weve never seen one no worker or community member will ever believe that an equitable transition is possible until we see detailed fully funded state a hrefhttpsstatic1squarespacecomstatic60b43a18079fdd42c6d01286t60bdc5bf6a007c14509e08871623049663256lns_pollinfactsheets_displacedworker_v2pdfsafety neta and job creation programs but he optimistically is arguing that with a fully funded equitable transition plan meeting the immediate need for a safety net for workers and communities and offering a bold vision to restructure our economy we can jumpstart recovery and move californias workers communities and the planet toward a more secure futurep
pthe enactment of a robust just transition program in california led by the states labor unions including its fossil fuel industry unions will also provide a model for comparable measures to be adopted throughout the us and globally supporting such initiatives should therefore be understood as an absolute firsttier priority for the us and the global climate movementstrong strongp
asidechina the us and the eu are responsible for 54 percent of all global emissionsaside
pstrongchina has emerged as a global economic superpower in the last couple of decades and in fact since 2008 tops the annual list of being the largest emitter of greenhouse gas carbon dioxide although we get a different picture if we look at carbon emissions per capita be that as it may what sort of finance conditions need to be introduced in countries like china and in emerging economies for a successful transition to clean energy resources without sacrificing economic and social development strongp
pstrongpollinstrong as of the most recent data global carbon dioxide emissions were at about 34 billion tons china is generating about 10 billion tons 30 percent of this total making it by far the country with the largest share of total emissions the us is next at about 5 billion tons 15 percent of the total the countries of the european union eu account for another 9 percent thus china the us and the eu are responsible for a hrefhttpsdataworldbankorgindicatorenatmco2ektviewchart54 percenta of all global emissions they all need to drive their emissions down to zero no later than 2050 for there to be any chance of meeting the ipccs global emissions reduction targets of a 45 percent decline by 2030 and a netzero global economy by 2050p
pits true that in terms of emissions per person chinas figure at 74 tons per person is still less than half the 152 tons per person figure for the united states but it remains the case that china must go from its current total emissions level of 10 billion tons down to zero by 2050 just as the us needs its emissions to fall absolutely from 5 billion tons to zerop
pit also follows that even if china the us and the eu managed to push their carbon dioxide emissions down to zero tomorrow we would still be only a bit more to halfway to achieving the global zero emissions goal since the rest of the world is today responsible for about 46 percent of all emissions it is therefore obvious that the transition to a global clean energy system has to be a global project the transition has to be advancing in india vietnam australia kenya puerto rico chile south korea south africa and mexico just as much as in china the us and eup
pbuilding clean energy infrastructures in developing economies will not entail sacrificing economic and social development indeed the green new deal remains focused on expanding good job opportunities raising mass living standards and fighting poverty along with driving emissions to zero all of these aims can be realistically accomplished since investments in clean energy will be a major engine of job creation moreover the costs of clean energy investments are already a hrefhttpswwwirenaorgnewsroompressreleases2021junmajorityofnewrenewablesundercutcheapestfossilfueloncostlowera on average than those for fossil fuels building a clean energy infrastructure will also support the expansion of a range of new public and private ownership forms this includes smallscale community ownership in rural lowincome communities such as in subsaharan africa to date roughly half of such communities still do not have access to electricity of any kind despite generations of promises made by politicians of all stripesp
pat the same time we cannot expect lowincome countries to finance their clean energy and just transition programs on their own i have sketched out a global financing framework in which there are four main components other approaches could also be viable these four funding sources are 1 a global carbon tax in which 75 percent of revenues are rebated back to the public but 25 percent are channeled into clean energy investment projects 2 transferring funds out of military budgets from all countries but primarily the us 3 eliminating all existing fossil fuel subsidies and channeling 25 percent of the funds into clean energy investments and 4 a green bond lending program initiated by the us federal reserve and european central bank with other major central banks in china the uk and japan also participating strong cases can be made for each of these funding measures but each proposal does also have vulnerabilities including around political feasibility the most sensible approach is therefore to combine the measures into a single package that minimizes their respective weaknesses as standalone measures p
pi work through some of the details of these proposals in our 2020 book a hrefhttpswwwversobookscombooks3239climatecrisisandtheglobalgreennewdealemclimate crisis and the global green new dealema but lets briefly consider the green bond financing proposal by way of illustration this program will not take money out of anyones pocket it rather involves the worlds major central banks effectively printing money as needed this would be just as they did during both the 200709 global financial crisis and during the covid recession except on a far more modest scale than the largesse that the central banks a hrefhttpsbostonreviewnetclassinequalityrobertpollingeraldepsteinneoliberalismsbailoutproblemshowered on wall street and global financial elitea to keep them afloat to be clear i am not suggesting that the us fed or european central bank should rely on this policy what is technically known as debt monetization on a routine basis but we need to be equally clear that this is a fully legitimate option that the major central banks have in their toolkit and that this option should indeed be brought into action under crisis conditions note here that the funds will be generated by the major central banks but then distributed globally on an equitable basis to underwrite the clean energy investment projects at scale in all regions of the globe public investment banks in all regions but especially in lowincome countries will then serve as primary conduits in moving specific investment projects forwardstrong strongp
pstrongwhat would you consider as the optimal outcome of the talks at the cop 26 summitstrongstrong strongp
pstrongpollinstrong the optimal outcome would be for the summit to not produce another round of what greta thunberg has accurately described as the blah blah blah which has resulted from previous such gatherings cop26 needs to establish truly binding commitments on all countries that would include the following p
ol
limeeting at least the ipccs emissions reduction targets of a 45 percent global emissions cut by 2030 and to achieve zero emissions by 2050li
limounting robust just transition programs in all countries and regions to support workers and communities that will be negatively impacted by the emissions reduction project andli
lipaying for these binding commitments through strongly egalitarian financing measuresli
ol
pstrongnoam the impact of human activities on the environment is so real and profound that past present and future are interlinked in such way that there can be no blurring between the empirical and the normative the climate crisis has created a global storm and cooperation and solidarity are essential prerequisites to the survival of the planet however given the daunting task that lays ahead shrinking and ultimately eliminating emissions while advancing at the same time a framework of development that embraces both developed and developing countries and guaranteeing a socially just transition how do we encourage activists and concerned citizens alike to remain committed to a struggle where the outcome is uncertain without succumbing to defeatism strongp
pstrongchomskystrong outcomes have always been uncertain defeatism is not an option it translates as species suicide bringing down much of life on earth with itp
pthere are steps forward crucially there is widespread understanding of the measures that can be take quite realistically to avert impending disaster and move on to a much better world that includes the comprehensive and detailed studies by our friend and colleague economist robert pollin by economist jeffrey sachs and by the international energy agency all coming to generally similar conclusions these results have also reached congress in a 2019 resolution recently reintroduced by its sponsors rep alexandria ocasiocortez and sen ed markey its all there to be acted uponp
pand while sen joe manchin is working assiduously to block any congressional action that departs from the no elimination death warrant issued by the energy corporations his constituents in west virginia are showing more concern for survival a a hrefhttpsgristorgenergyamericaslargestcoalminersunionsupportscleanenergywithconditionsrecent reporta of the united mine workers recognizes that change is coming whether we seek it or not too many inside and outside the coalfields have looked the other way when it comes to recognizing and addressing specifically what that change must be but we can look away no longerp
pthe union supports a transition to renewable energy rightly insisting that workers receive good jobs which should in fact be better jobs as can be readily accomplished along lines that bob pollin has laid out in his studies and conveyed to the public in his grassroots work in west virginia and other mining states where unions are moving in the same directionp
pthere has also been considerable progress since cop21 sharp reduction in cost of sustainable energy significant steps towards electrification and constant pressure to do more mostly by the young those who will have to endure the consequences of our folly and betrayal of their hopes the recent global climate strike was a noteworthy examplep
panother hopeful sign is the recovery of the labor movement from the statecorporate blows that were a salient feature of the neoliberal years from their outset with deep roots in the origins of neoliberal doctrine in interwar vienna thats a long and important story but there are many indications that it is underway somewhat reminiscent of the early 1930s the vibrant us labor movement had been almost crushed by statecorporate violence but as the depression hit it began to revive and spearheaded the new deal moves towards social democracy that greatly improved the lives of [many though not all] americans it wasnt until the late 1970s that the business counteroffensive became powerful enough to restore a system of radical inequality and suppression of the basic rights of the great majority today that assault is being challenged and may be overcome one sign of many is the massive refusal to return to the rotten dangerous precarious jobs offered to the workforce during the neoliberal class war the catastrophic market failure of environmental destruction is a catalyzing factorp
pif that happens we can hope for and try to nurture a revival of core features of labor activism from the early days of the industrial revolution among them solidarity and internationalism were all in this together not each alone trying to collect as many crumbs as we can for ourselves that consciousness is essential for survival at home and abroadp
pin particular there must be an end to provocative confrontations with china and a serious rethinking of the alleged china threat experiences weve been through before with dire consequences now literally a matter of survival the us and china will cooperate in approaching the urgent crises of today or were doomedp
pthe choices before us are stark they cannot be evaded or ignoredp
pemthis interview has been lightly edited for clarityemp | hrefhttpstruthoutorgarticleschomskyandpollincop26pledgeswillfailunlesspushedbymassorganizingimg sizesmaxwidth 200px 100vw 200px srchttpstruthoutorgwpcontentuploads2021102021_1027chomskypollin200x124jpg width200 altrobert pollin noam chomsky srcsethttpstruthoutorgwpcontentuploads2021102021_1027chomskypollin200x124jpg 200w httpstruthoutorgwpcontentuploads2021102021_1027chomskypollin400x248jpg 400w httpstruthoutorgwpcontentuploads2021102021_1027chomskypollin1200x744jpg 1200w httpstruthoutorgwpcontentuploads2021102021_1027chomskypollin800x496jpg 800w httpstruthoutorgwpcontentuploads2021102021_1027chomskypollin1536x953jpg 1536w httpstruthoutorgwpcontentuploads2021102021_1027chomskypollin2048x1270jpg 2048w httpstruthoutorgwpcontentuploads2021102021_1027chomskypollin2400x1489jpg 2400w classwppostimage height124apthe 26th session conference parties cop26 united nations framework convention climate change unfccc takes place glasgow october 31november 12 bring 120 world leaders 12 days talks aimed forming agreement tackle climate emergency expectation countries produce 2030 emissions reductions targets secure global net zero 2050 happen phaseout coal accelerated deforestation curtailed investment green energy rise significantlyp pthe urgency action cop26 overstated running chances save planet climate catastrophe order stated goals cop26 attained imperative narrow views national interest aside great powers steer clear geopolitical confrontations international cooperation continued use fossil fuels set drive societies globe climate chaos collapsep pso expect cop26 definite action greta thunberg recently blah blah blah expansive eyeopening interview leading scholars noam chomsky robert pollin share thoughts insights upcoming global climate summit ultimately save humanity planet global climate catastrophe noam chomsky institute professor emeritus mit currently laureate professor linguistics agnese nelms haury chair agnese nelms haury program environment social justice university arizona chomsky cited scholars history long considered uss voices conscience joined worlds leading economists left robert pollin distinguished professor codirector political economy research institute university massachusetts amherst chomsky pollin coauthors recently published book emclimate crisis global green new deal political economy save planetemp pstrong cstrongstrongj polychroniou noam cop26 believed best hope meaningful action tackle climate crisis cop26 important wasnt pretty thing said cop21strongp pstrongnoam chomskystrong correctly concept best hope keeps narrowing whats best hope point gone later remaining best hope far difficult realizep pthats true 1997 kyoto protocol ratified 192 nations senate accept george w bush pulled completely later canada kyoto best hope 1997 joined task escaping devastating climate change far easierp pby 2015 paris agreement cop21 best hope remote difficult realize senate blocked precisely plan verifiable treaty republicans accept reduced toothless voluntary agreements shortly trump pulled completely biden formally rejoined means remains seenp pright republican commitment destroying planet interest shortterm profit prime constituency extreme wealth unassailable weve hrefhttpstruthoutorgarticleschomskyrepublicansarewillingtojeopardizehumansurvivaltoretakepowerdiscussed beforea 2008 signs deviation minimal concern fate humanity didnt long juggernaut huge koch brothers energy conglomerate quickly returned party obedience unchangedp pin defense stand genuine political party note fact rarely accepts international conventions reservations render inapplicable thats true genocide conventionp pone plausibly argue fine distinctions irrelevant fully accepts international treaties violates violating constitution declares supreme law land binding political leadership clearest case un charter basis modern international law bans threat use force international affairs reservations irrelevant constant violation treaty constitution presidentsp asidethe rarely accepts international conventions reservations render inapplicable usaside pso normal virtually elicits commentp pdiscourse international affairs found way inconvenient facts devising concept rulebased international order contrasted oldfashioned unbased international order preferred set rules determine enforced interesting topic nowp pa treaty climate change reached different category survival stake basic facts brutally clear passing year laid clearly latest intergovernmental panel climate change ipcc report released august 9 brief hope avoiding disaster requires taking significant steps right away reduce fossil fuel use continuing annually goal effectively phasing fossil fuel use midcentury approaching precipice steps fall foreverp pfalling precipice imply die soon theres long way means irreversible tipping points reached barring nowunforeseen technological miracle human species entering new era inexorable decline mounting horrors kind easily depict extrapolating realistically surrounds optimistic estimate nonlinear processes begin dangers lurk dimly perceivedp pit era emsauve qui peutem run lives material catastrophe heightened social collapse wholesale psychic trauma kind experienced assault nature indescribable proportionsp pall understood high level confidence relic rationality tells ridiculous chance mistaken considering stakesp pwe tarry moment date release ipcc report august 9 accident design choice momentous date human affairs anniversary atomic bombing nagasaki putting aside horrors dubious efforts justification hiroshima bombing days earlier demonstrated human intelligence soon reach level able destroy nagasaki demonstrated commitment attain goal deeply entrenched reigning sociopolitical system intellectual culture remained open human moral capacities institutions humans created capacity overcome human intellect verge achieving total cataclysm 75 frightening years question remains open prospects shrink hopeful answerp pthe crisis environmental destruction extends crime global heating raises similar questionsp pthe evidence hand encouraging lets august 9 2021 clear warning begin reduce fossil fuel usep pimmediately receipt grim warning president powerful state world history issued appeal global oil cartel opec emincreaseem production europe followed suit joined rest called advanced society reason energy crunch thats doubtless problem way deal race precipice rich rich societies major culprits tighten belts sharply accelerate transition sustainable energyp pthe choice unfolding eyesp ppetroleum industry journals euphoric announcing promising new discoveries exploit enhance production reveling prospects growing demand poisons examples fill detailsp pgermany reacting august warning joining increasing fossil fuel use making contribution example hrefhttpswwwwashingtonpostcomworld20211023germanycoalclimatecop26destroying villagesa expand coal miningp pturning mere hrefhttpsclimatecommunicationyaleedupublicationspoliticsglobalwarmingseptember2021460 percenta voters regard global warming urgent problem government urgent problem humans facedp pthe party breakdown usual republicans 45 percent liberalmoderate republicans global warming urgent problem 17 percent conservative republicans persisting lethal denialism great surprise light pronouncements leadership media exposedp pthanks significant popular activism bidens major program torn shreds congress include useful steps climate change likely survive republicans 100 percent opposed democrats need unanimity pass senate chair committee energy natural resources rightwing democrat coal baron leading recipient fossil fuel funding congress joe manchin position climate concerns simple hrefhttpsbillmckibbensubstackcompjoemanchinstrulybrutalransomtokeneyj1c2vyx2lkijo0mzu0nde0nswicg9zdf9pzci6nde5mjg3mdesil8ioijuzw9rtcisimlhdci6mtyznta1mdixncwizxhwijoxnjm1mduzode0lcjpc3mioijwdwitndm4mtq2iiwic3viijoicg9zdc1yzwfjdglvbij9qpjf0jxerinpdeig4am9gb92mkpg5bi9hrmphkyehwspending innovation eliminationa straight fossil fuel industry playbookp asideturning mere 60 percent voters regard global warming urgent problem government urgent problem humans facedaside pin south america destruction amazon proceeding apace benefit domestic international corporate sector hailing policies chicago school economics minister paulo guedes privatize cares consequences recent scientific studies hrefhttpswwwreuterscominvestigatesspecialreportclimateunamazontippingpointhave founda southeastern amazon releasing carbon absorbing rainy years scientists expected forest better health meant rainforest longer helping slow climate change adding emissions driving itp pthat disaster brazil world given role huge tropical forests regulating global climatep pa hrefhttpswwwbbccomnewsscienceenvironment58982445leaked reporta governmental efforts weaken ipcc study shows usual scoundrels workp psaudi arabia calls eliminating phrases need urgent accelerated mitigation actions scales focus decarbonisation efforts energy systems sector needs rapidly shifting zerocarbon sources actively phasing fossil fuels joined opec fossil fuel producers argentina norwayp psaudi officials elaborated giving details saudi prince explained transition netzero carbon emissions welcome reached carbon circular economy plan built initiatives recycling carbon removalp pjust innovation eliminationp psaudi officials chief executive saudi oil giant aramco hrefhttpswwwwashingtonpostcomworldmiddle_eastsaudicarbonzerooilclimate202110234ddadae0340e11ec80367db255bff176_storyhtmlutm_campaignwp_post_mostutm_mediumemailutm_sourcenewsletterwpisrcnl_mostcartaurlhttps3a2f2fs2washingtonpostcom2fcarlntr2f3514e932f61757f579d2fda9d4121ca8d2f5977f250ae7e8a6816e8c2a12f372f722f61757f579d2fda9d4121ca8dthe press reportsa expect demand oil continue dominant energy source decades come argue reducing supply demand drops risks dangerous oil price spike hurting economies saudi arabias dependent oil gasp pturning hrefhttpswwwworldstopexportscomcoalexportscountryelsewherea senior australian government official rejects conclusion closing coalfired power plants necessary stand related australias position worlds leading coal exporterp pcontinuing submissions ipcc brazil argentina biggest producers beef products animal feed crops world argue strongly evidence draft report reducing meat consumption necessary cut greenhouse gas emissions countries authors delete change passages text referring plantbased diets playing role tackling climate change describe beef high carbon foodp pagain surprisingly significant number switzerlands comments directed amending parts report argue developing countries need support particularly financial support rich countries order meet emission reduction targetsp pin brief fall precipice nearuniform reaction emi want grasp share loot doomsday approachesemp preturning stillopen question posed august 9 anniversary human moral capacities institutions humans created capacity overcome human intellect institutions shown capable achieving total cataclysmp pthe answer soon knownp asideif governments pledges wont implement extensive popular activismaside pand reflecting unanswered question forget human intellect forged feasible solutions impending crises easily hand longp pstronggiven experience global climate talks high expectations outcome cop26 addition mentioned global oil demand booming china continues build coalfired power plants world bent maintaining hegemonic status world system divided world world majority citizens countrys society divided realistically expect cop26strongp pstrongchomsky strongthe business press generally fairly realistic audience stake knowing whats happening world answer question useful open todays october 24 business press read paragraph hrefhttpswwwnytimescom20211022businessstockscoalclimatechangehtmlmajor articlea realistically expect prospects strong government action curb climate change grow certain energy shares especially coal mining stocks generating astonishing returns article goes review great opportunities huge shortterm profits superrich destroy diminishing hopes livable world children p peconomists soberly explain market failure caused externalities uncounted costs false article quotes recent international monetary fund imf study found marketbased fossil fuel prices 2020 failed account 59 trillion global environmental costs equivalent 68 percent global gross domestic product imf estimated gap rise 74 percent world gdp 2025p pnot false misleading market failures occur time increasing intensity heralded market revolution assaulted world ronald reagan opened doors wholesale robbery 40 years ago anodyne phrase market failure begin justice monstrous crime statebacked capitalist institutions perpetratingp pthe business press gives little reason optimistic outcome cop26 worth remembering consider humans accomplish choose regard human effort action outcome cop26 doesnt matter governments pledges wont implement extensive popular activism dont pledges wont driven adopt implement extensive popular activism message outcome work lots fronts excluding longterm dedication dismantle lethal institutions doctrines chain people themp pstrongbob economics global warming global climate stabilization straightforward broad consensus emerged economic impacts global warming disagreement economists best solutions achieve significant reductions carbon emissions difficult implement viable climate policies national let global level strongp pstrongrobert pollinstrong lets start obvious obstacle advancing viable climate policies implacable opposition fossil fuel companies refer private companies exxonmobil royal dutch shell public corporations saudi aramco gazprom russia petrobras brazil lets assume working target set intergovernmental panel climate change stabilize average global temperature 15 degrees celsius 15c preindustrial levels framework recent hrefhttpsscholarworksumasseducgiviewcontentcgiarticle3333contextdissertations_2careful researcha tyler hansen shows extent total fossil fuel assets owned corporations unburnable ie burned produce energy world chance achieving 15c stabilization target amounts 1315 trillion total 75 percent fossil fuel assets 1011 trillion owned public corporations remaining 35 trillion owned private corporations surprised fossil fuel companies fighting means available continue profiting lavishly selling oil coal natural gas ground dont want hear dumping 15 trillion assetsp asidethe enactment robust transition program california led states labor unions provide model comparable measures adopted globallyaside pits true publicly owned national companies controlling approximately 90 percent globes total fossil fuel reserves operate precisely profit imperatives big private energy corporations lets clear mean prepared commit fighting climate change simply stated mission serve public opposed private shareholders public face global environmental emergency private companies producing selling fossil fuel energy generates huge revenue flows publicly owned companies national development projects lucrative careers political power depend continuing flow large fossil fuel revenuesp poverall getting interests fossil fuel companies simply defeated obviously easy accomplish seeing right sen joe manchin west virginia possible kill minimally decent climate provisions bidens build better program manchin started coal brokerage company state continues hrefhttpswwwnytimescom20210919climatemanchinclimatebidenhtmlreceive large profitsa seeing global scale russian president vladimir putin issuing hrefhttpswwwreuterscombusinessenergyputinwarnspossibleoilshortageduelackinvestment20211021dire warningsa upcoming energy shortages investments expand fossil fuel supply increasep pbut critical recognize fossil fuel companies obstacle advancing viable global climate stabilization project matter pure inertia overlooked faced challenge building new global energy infrastructure foundations high efficiency clean renewable energy phasing existing fossil fueldominant energy infrastructure hugely challenging project best circumstances putting aside machinations fossil fuel companies experienced firsthand example project umassamherst built hrefhttpswwwgazettenetcomcrottyhall8849235zeroemissions office buildinga western massachusetts house economics department lots new ways things need learned terms engineering use materials workers developing new skills requires people cooperating effectivelyp pthere absolutely critical question transition workers communities livelihoods present dependent fossil fuel industry view transition center global green new deal project denying workers communities world lose clean energy transition order global clean energy project succeed provide adequate transitional support workers communities matter simple justice matter strategic politics adjustment assistance programs operating major scale workers communities facing retrenchment clean energy investment project predictably understandably fight defend communities livelihoods turn create unacceptable delays proceeding effective climate stabilization policiesp pmy coworkers estimated costs generous transition program workers united states tied fossil fuel ancillary industries working assumption fossil fuel production shut 2050 program include reemployment guarantee wages matching workers current pay pension guarantees needed retraining relocation support hrefhttpsirpcdnmultiscreensitecom6f2c9f57filesuploadedzerocarbonactionplanch03pdfestimateda total costs averaging 3 billion year equal roughly 1100 percent 001 percent average gdp 2050 words terms financing trivial matter establish sort transition program p pin fact pathbreaking developments occurring right california advancing transition program state movement led visionary labor leaders state including leaders states oil refinery workers union leader norman rogers vice president united steelworkers local 675 recently hrefhttpswwwlatimescomopinionstory20211023oilgasjobscleanenergycaliforniawrotea emlos angeles timesem thatp blockquote pthough energy transition inevitable version workers know happens industries away companies maneuver backs squeeze drop work dying auto plant steel mill coal shutter overnight devastating communities stiffing workers jobs pensions healthcare fear real jobs lost plan operations begin phase p blockquote progers emphasizes speak transition weve seen worker community member believe equitable transition possible detailed fully funded state hrefhttpsstatic1squarespacecomstatic60b43a18079fdd42c6d01286t60bdc5bf6a007c14509e08871623049663256lns_pollinfactsheets_displacedworker_v2pdfsafety neta job creation programs optimistically arguing fully funded equitable transition plan meeting immediate need safety net workers communities offering bold vision restructure economy jumpstart recovery californias workers communities planet secure futurep pthe enactment robust transition program california led states labor unions including fossil fuel industry unions provide model comparable measures adopted globally supporting initiatives understood absolute firsttier priority global climate movementstrong strongp asidechina eu responsible 54 percent global emissionsaside pstrongchina emerged global economic superpower couple decades fact 2008 tops annual list largest emitter greenhouse gas carbon dioxide different picture look carbon emissions capita sort finance conditions need introduced countries like china emerging economies successful transition clean energy resources sacrificing economic social development strongp pstrongpollinstrong recent data global carbon dioxide emissions 34 billion tons china generating 10 billion tons 30 percent total making far country largest share total emissions 5 billion tons 15 percent total countries european union eu account 9 percent china eu responsible hrefhttpsdataworldbankorgindicatorenatmco2ektviewchart54 percenta global emissions need drive emissions zero later 2050 chance meeting ipccs global emissions reduction targets 45 percent decline 2030 netzero global economy 2050p pits true terms emissions person chinas figure 74 tons person half 152 tons person figure united states remains case china current total emissions level 10 billion tons zero 2050 needs emissions fall absolutely 5 billion tons zerop pit follows china eu managed push carbon dioxide emissions zero tomorrow bit halfway achieving global zero emissions goal rest world today responsible 46 percent emissions obvious transition global clean energy system global project transition advancing india vietnam australia kenya puerto rico chile south korea south africa mexico china eup pbuilding clean energy infrastructures developing economies entail sacrificing economic social development green new deal remains focused expanding good job opportunities raising mass living standards fighting poverty driving emissions zero aims realistically accomplished investments clean energy major engine job creation costs clean energy investments hrefhttpswwwirenaorgnewsroompressreleases2021junmajorityofnewrenewablesundercutcheapestfossilfueloncostlowera average fossil fuels building clean energy infrastructure support expansion range new public private ownership forms includes smallscale community ownership rural lowincome communities subsaharan africa date roughly half communities access electricity kind despite generations promises politicians stripesp pat time expect lowincome countries finance clean energy transition programs sketched global financing framework main components approaches viable funding sources 1 global carbon tax 75 percent revenues rebated public 25 percent channeled clean energy investment projects 2 transferring funds military budgets countries primarily 3 eliminating existing fossil fuel subsidies channeling 25 percent funds clean energy investments 4 green bond lending program initiated federal reserve european central bank major central banks china uk japan participating strong cases funding measures proposal vulnerabilities including political feasibility sensible approach combine measures single package minimizes respective weaknesses standalone measures p pi work details proposals 2020 book hrefhttpswwwversobookscombooks3239climatecrisisandtheglobalgreennewdealemclimate crisis global green new dealema lets briefly consider green bond financing proposal way illustration program money anyones pocket involves worlds major central banks effectively printing money needed 200709 global financial crisis covid recession far modest scale largesse central banks hrefhttpsbostonreviewnetclassinequalityrobertpollingeraldepsteinneoliberalismsbailoutproblemshowered wall street global financial elitea afloat clear suggesting fed european central bank rely policy technically known debt monetization routine basis need equally clear fully legitimate option major central banks toolkit option brought action crisis conditions note funds generated major central banks distributed globally equitable basis underwrite clean energy investment projects scale regions globe public investment banks regions especially lowincome countries serve primary conduits moving specific investment projects forwardstrong strongp pstrongwhat consider optimal outcome talks cop 26 summitstrongstrong strongp pstrongpollinstrong optimal outcome summit produce round greta thunberg accurately described blah blah blah resulted previous gatherings cop26 needs establish truly binding commitments countries include following p ol limeeting ipccs emissions reduction targets 45 percent global emissions cut 2030 achieve zero emissions 2050li limounting robust transition programs countries regions support workers communities negatively impacted emissions reduction project andli lipaying binding commitments strongly egalitarian financing measuresli ol pstrongnoam impact human activities environment real profound past present future interlinked way blurring empirical normative climate crisis created global storm cooperation solidarity essential prerequisites survival planet given daunting task lays ahead shrinking ultimately eliminating emissions advancing time framework development embraces developed developing countries guaranteeing socially transition encourage activists concerned citizens alike remain committed struggle outcome uncertain succumbing defeatism strongp pstrongchomskystrong outcomes uncertain defeatism option translates species suicide bringing life earth itp pthere steps forward crucially widespread understanding measures realistically avert impending disaster better world includes comprehensive detailed studies friend colleague economist robert pollin economist jeffrey sachs international energy agency coming generally similar conclusions results reached congress 2019 resolution recently reintroduced sponsors rep alexandria ocasiocortez sen ed markey acted uponp pand sen joe manchin working assiduously block congressional action departs elimination death warrant issued energy corporations constituents west virginia showing concern survival hrefhttpsgristorgenergyamericaslargestcoalminersunionsupportscleanenergywithconditionsrecent reporta united workers recognizes change coming seek inside outside coalfields looked way comes recognizing addressing specifically change look away longerp pthe union supports transition renewable energy rightly insisting workers receive good jobs fact better jobs readily accomplished lines bob pollin laid studies conveyed public grassroots work west virginia mining states unions moving directionp pthere considerable progress cop21 sharp reduction cost sustainable energy significant steps electrification constant pressure young endure consequences folly betrayal hopes recent global climate strike noteworthy examplep panother hopeful sign recovery labor movement statecorporate blows salient feature neoliberal years outset deep roots origins neoliberal doctrine interwar vienna thats long important story indications underway somewhat reminiscent early 1930s vibrant labor movement crushed statecorporate violence depression hit began revive spearheaded new deal moves social democracy greatly improved lives [many all] americans wasnt late 1970s business counteroffensive powerful restore system radical inequality suppression basic rights great majority today assault challenged overcome sign massive refusal return rotten dangerous precarious jobs offered workforce neoliberal class war catastrophic market failure environmental destruction catalyzing factorp pif happens hope try nurture revival core features labor activism early days industrial revolution solidarity internationalism trying collect crumbs consciousness essential survival home abroadp pin particular end provocative confrontations china rethinking alleged china threat experiences weve dire consequences literally matter survival china cooperate approaching urgent crises today doomedp pthe choices stark evaded ignoredp pemthis interview lightly edited clarityemp |
617b25c14af2f3f8de4e68b6 | Rich Nations Have Received 16 Times More Vaccine Doses Per Person Than Poor | a hrefhttpstruthoutorgvideorichnationshavereceived16timesmorevaccinedosesperpersonthanpoorimg sizesmaxwidth 200px 100vw 200px srchttpstruthoutorgwpcontentuploads202110seg2gandhi200x113jpg width200 altrich nations have received 16x more vaccine doses per person than poor srcsethttpstruthoutorgwpcontentuploads202110seg2gandhi200x113jpg 200w httpstruthoutorgwpcontentuploads202110seg2gandhi400x225jpg 400w httpstruthoutorgwpcontentuploads202110seg2gandhi1200x675jpg 1200w httpstruthoutorgwpcontentuploads202110seg2gandhi800x450jpg 800w httpstruthoutorgwpcontentuploads202110seg2gandhi1536x864jpg 1536w httpstruthoutorgwpcontentuploads202110seg2gandhijpg 1920w classwppostimage height113apwealthy nations have received over 16 times more spancovidspan19 vaccines per person than poorer nations dependent on the spancovaxspan program backed by the word health organization according to a new emfinancial timesem analysis spancovaxspan which was set up to ensure global equitable access to vaccines has delivered only 400 million doses after promising 14 billion this year higherincome countries struck separate vaccine deals with manufacturers leaving spancovaxspan with less negotiating power while the united states rolls out booster shots and stockpiles six vaccines per person less than 3 of people in lowincome countries have received at least a single dose infectious disease expert dr monica gandhi says she will not receive a booster as a healthcare worker because of the global vaccine inequity and argues the push for boosters detracts from the fact that we in no way have fulfilled a moral and ethical obligation to the world we also speak with kate elder senior vaccines adviser for doctors without borders who says that it is a structural issue caused by global leaders who are not equitably sharing vaccines around the worldp
h2transcripth2
pemthis is a rush transcript copy may not be in its final formemp
div
pstrongspanamyspan spangoodmanspanstrong this is emdemocracy nowem im amy goodman with nermeen shaikhp
prich countries received 16 times more spancovidspan19 vaccines per person than poorer nations dependent on the spanwhospanbacked spancovaxspan program which was set up last year to give people in poor countries equitable access to vaccines thats according to a emfinancial timesem a hrefhttpswwwftcomcontent0e240929033a457fa735ec7cf93b2f3cdata analysisa compiled by spanunicefspan officials in the african union predict spancovaxspan will deliver less than a quarter of the twoshot vaccine doses needed for more than 13 billion people in africa by the end of the year as here in the united states the discussion moves from third to fourth booster shots for the immunocompromisedp
pwe look now at how less than 3 of people in lowincome countries have received even a single dose of the vaccine were joined by two guests in new york kate elder is with us senior vaccines adviser for doctors without borders and in san francisco dr monica gandhi an infectious disease physician professor of medicine at spanucsfspansan francisco general hospitalp
pdr gandhi youve said you will not receive a booster as a healthcare worker because of the global vaccine inequity explainp
pstrongdr spanmonicaspan spangandhispanstrong yes so when president biden announced that every american should get a booster by september 20th in midaugust it was actually a huge surprise to many infectious disease experts for two reasons one is that the vaccines are actually holding up extremely well especially in those less than 65 against severe disease and in fact that kind of messaging can reduce confidence in the vaccinesp
pthe second reason was the incredible global vaccine inequity that there are many promises made by rich countries and the administration at the g7 meeting in early june the rich countries pledged that there would be a 2 billion dose donation to other countries and that hasnt really even been touched in terms of fulfilling that pledge and then at highlevel meetings like the un meeting in september these pledges are made again but we have about six doses for every american stored up we have thats true of many rich countries and it just the complete ignoring of that sort of lets that moral and ethical failing blew a lot of peoples minds to be honest to talk about boostersp
pand then if we think about whats been going on in this country for the last three months the conversation has been almost exclusively about boosters and how to mix and how to match and you know its important its important for johnson amp johnson people its important for those over 65 i think those are the two groups that the data is very clear but what it does is it detracts from the fact that we in no way have fulfilled a moral and ethical obligation to the world and lets forget about moral and ethics just for a minute it is where do variants come from they come from places in the world with high transmission so we are also not doing the right thing by public healthp
pso right i am not you know this is a very public stance but i am a healthcare worker i am fully vaccinated i got vaccinated early and i cant bring myself to take a booster unless some of this gets better and is correctedp
pstrongspannermeenspan spanshaikhspanstrong well kate elder youve been working on this issue of vaccine equity since the pandemic began of spancovidspan19 vaccine equity just lay out what are the main obstacles to enabling more of the world to gain access to these vaccines and what is preventing to this day pharmaceutical companies from sharing their technology with the world health organizations mrna tech hub and other capable manufacturers around the worldp
pstrongspankatespan spanelderspanstrong yeah good morning thanks very much for talking about this important issuep
pi mean as dr gandhi just said very very clearly right now were in a global crisis not only of moral and ethical magnitude but really just of a rationale a scientific rationale for emerging from this pandemic everybody around the world of course wants to emerge from this pandemic and global leaders have not decided to take the route thats most scientifically sound to do that which is equitably sharing vaccines around the worldp
pfrom the start of this pandemic although there were very lofty claims and platitudes about future spancovidspan19 vaccines at that time vaccines of course werent available but there were global leaders that came together from the european union with the leadership of spanwhospan to say that future spancovidspan19 vaccines would be considered global public goods and they would be shared equitably around the world and we would not repeat mistakes of the past you know unfortunately those declarations were made and then highincome country governments turned around and went forward in the pursuit of shoring up stocks for their domestic use at an incredible speed which saw us that in a very short period of time we had most of these theoretical vaccines at that time already spoken for by highincome country governments by the wealthiest governments so that when we did see these vaccines start coming off the line the production line they were already promised to the wealthy and thats why were in this situation right now where you know about 60 of adults in the wealthiest countries have received their first dose whereas just about 3 of people in lowincome countries in the poorest countries of the world have received their first dosep
pnow i mean the barriers to really rectifying this its very clear i mean first we need the vaccines that are available that are sitting in cold storage rooms that are not being used urgently redistributed to places where we need them there is a tremendous volume of excess doses right now here in the united states we calculate that by the end of 2021 the us government might have about half a billion excess doses here in the us thats including if people get their boosters we need to redistribute those doses rapidly to the places that are begging for supply thats the acute step that needs to happenp
psecondly we need to make sure that the places the regions that have been left behind regions like the africa region the middle east are given the tools to make vaccines themselves right so theres an issue of supply and theres an issue of being able to make more supply now and for potential future pandemics as well so regions like the afro region governments like south africa have been asking for the technology to be able to make these vaccines themselves now that would be the second step that needs to happen we need the transfer of technology and the supporting elements around it the knowhow the training to be transferred from the companies that have it to the places that are capable for making these vaccinesp
pand then thirdly we need the intellectual property barriers lifted right there are ip barriers around these vaccines and we need those immediately waived so that governments and other manufacturers can pursue making these vaccines themselves so that we dont perpetuate this crisisp
pnow the reason i think it its very straightforward the reason why the technology transfer is not happening despite the call from spanwhospan and of course the world health organization is the global custodian of health they know the best route for emerging from this pandemic they have established these mrna technology transfer hubs and invited companies to share their technology with them and there are a number of companies that have lined up are waiting in the queue to receive this technology of course the originator companies are not sharing willingly that technology i mean you know they what to hold onto it for their own commercial interestsp
pbut its important to remember that much of this technology was developed with public financing us taxpayers just using one company as an example moderna moderna received about 10 billion in us taxpayer funding to stimulate the research and development and also in advance purchases of those vaccines so really the public has a very high stake but of course the companies are looking to hold onto that technology its very lucrative pfizer is estimated to make 33 billion in 2021 i think the estimates for moderna are about 20 billion in revenue so theyre going to really hold onto that technology despite it being in the worlds best interest for it to be sharedp
pstrongspanamyspan spangoodmanspanstrong i want to underscore this point of the amount of us funding that has gone into the development of these vaccines yet they have kept their recipes proprietary private and i want to put this question to dr monica gandhi the sammies were just announced the sort of oscars to people in government service among those who won for federal employee of the year dr kizzmekia corbett an amazing african american woman a scientist and barney graham for their work both of which led to the development of the coronavirus vaccine at record speed both at the vaccine research center of the former national institutes of health they were working for the us government how is it possible that at this point when even if you just look at the united states completely in a selfish way if you will just protect the united states we have learned from this pandemic if you dont deal with this pandemic globally the us can never be protected the idea that the us has poured so much funding in the research of these vaccines and guaranteed buying of these vaccines in the case of pfizer and yet they refuse to make available the secret sauce the recipe that would allow many pharmaceutical companies to make these vaccines around the worldp
pstrongdr spanmonicaspan spangandhispanstrong yes i mean i think theres two comparisons that come to mind one is the field of preexposure prophylaxis prep to prevent spanhivspan infection in this case actually there was a drug that was made by a pharmaceutical company but that was only the tip of the iceberg the us government funded all the clinical trials to show that tenofovir disoproxil fumarateemtricitabine which is this drug that gilead had was effective to prevent spanhivspan infection there have been many congressional urging of gilead to make this drug freely available since these were essentially all the major clinical trials were funded by the us government and the company very promptly made a more expensive drug and marketed that it is critical to say that we funded especially moderna there was public funding put into this and it was literally like you just said with our taxpayer dollars and the fact that they wont share this technology with places that are just ready and willing to receive it so that they will not only make it for their own countries but make it for others is one of the i mean i just have to say that my mind is constantly blown by this degree of injusticep
pand then you know the other thing that i want to remind us is october 2020 was the time when india and south africa appealed to the world trade organization they anticipated that there could be waves in their country india had been spared actually up til that point they knew the technology was coming and they said to the world trade organization ensure please that we get a waiver that theres a waiver made on the intellectual property of these lifesaving vaccines because there is a waiver thats possible in the setting of lifesaving technology in the middle of something as globally urgent as a pandemic the spanwtospan said no and then on march 7th you can literally watch the wall of new infections that happened in india and the subsequent death and suffering for the next two months that could have been completely averted by having that request honored this is so reminiscent of spanhivspan infection that it is a living nightmare to watch that 10 years into spanhivspan when most of the problem was in subsaharan africa that we were still arguing over spantripsspan and patent waiversp
pand one thing i do want to say about pfizer pfizer makes a very lifesaving medication called fluconazole which was essential to prevent one of the severe opportunistic infections in spanaidsspan and in the late 90s they made a billion dollars in one year over this lifesaving easytomake medication so this is not new the problem is its tragic and right now were getting lots of boosters into americans arms so that they can you know travel and not have a positive test and like theres something really incorrect going on here so youre right about the public investmentp
pstrongspannermeenspan spanshaikhspanstrong and kate elder can you talk about one effort that was made earlier this week on tuesday biontech signed an agreement with rwanda and with senegal and a senegalbased manufacturer to begin construction of an mrna vaccine manufacturing facility in africa by the middle of next year mid2022 but this is bypassing the world health organizations mrna vaccine tech transfer hub in south africa could you comment on that and whether you think its significant and may have a significant effect an important effect on vaccinating africa which is one of the lowest has one of the lowest rates of vaccinationp
pstrongspankatespan spanelderspanstrong i think it is you know its an interesting development its probably partially in response to the tremendous pressure that has been mounted by civil society by advocates for access to spancovidspan19 vaccines in the face of companies really acting very reprehensibly in terms of prioritizing sales to the wealthiest and prioritizing their supply to the wealthiest while the developing world goes without so it is a notable developmentp
pthere are challenges with it however there are limitations i mean one you know what is the scope of this agreement the challenge with having it be so privately brokered with no transparency is that we dont know the terms and conditions around it will that facility ultimately have the ability to share with others will that facility have the ability to sell beyond africa or will there be a very certain limitation of where the doses can go this is the challenge when deals are brokered in secrecy and theres no transparency around the ultimate what ultimately comes out in the contracts is you just dont know the terms and the scope of it so i mean many of these what we would call voluntary technology transfer or voluntary initiatives by industry come with significant limitations they come with limitations of geographic scope they come with limitations of what the recipient company can do with that product with that technology so although it is notable and its exciting to hear that a plant will be developed in rwanda and there will be partnership in west africa to senegal theres a lot of questionsp
pi mean i think we have to go back to the point of there are globally agreedupon forum and processes that are done intergovernmentally led by developing countries themselves that have been established with the support of the world health organization which you know of course spanwhospan truly knows whats needed in the face of this pandemic the mrna hub led by the south african government with support from spanwhospan is an endtoend plan an endtoend plan where it included components of training staff it included components of making sure the regulatory landscape was set for these vaccines it had a longerterm vision as well i mean that is the process that we need to look towards that is the process that has the future in mind rather than something that is you know fully steered and controlled by pharmaceutical companies because at the end of the day we know pharmaceutical corporations have a very specific mandate i mean their mandate is to serve their shareholders and to commercialize to the extent possible their products so i mean i think its notable but we need a lot more and its particularly notable that spanwhospan has set up this tech transfer hub and yet none of these originator companies have volunteered to come forward and actually participatep
pstrongspanamyspan spangoodmanspanstrong finally dr monica gandhi your thoughts on the merck story that said it will share the formula for its spancovidspan19 drug molnupiravir with poor countries allowing manufacturers to produce the cheap genericp
pstrongdr spanmonicaspan spangandhispanstrong yeah i mean im excited about merck making that announcement one thing is that molnupiravir is a treatment and at that point youve already contracted the spancovidspan19 infection prevention is always better than treatment so vaccine availability would be better than treatment but yes this is an example at least to the other pharmaceutical companies about what to dop
pstrongspanamyspan spangoodmanspanstrong well i want to thank you both for being with us dr monica gandhi infectious disease physician at spanucsfspansan francisco general hospital and kate elder senior vaccines adviser with doctors without borders mdecins sans frontiresp
pand that does it for our show on saturday afternoon ill be moderating a a hrefhttpswwwdemocracynoworgevents202110amy_goodman_moderates_panel_with_ed_snowden_laura_poitras_and_glenn_greenwald_1555live discussiona with edward snowden laura poitras and glenn greenwald as part of the virtual war on terror film festival it will be 130 eastern standard time you can check out the details at democracynoworgp
pemdemocracy nowem is currently accepting applications for two positions a hrefhttpswwwdemocracynoworgaboutjobsdirectorfinadminop472095directoroffinanceandadministrationdirector of finance and administrationa and a hrefhttpswwwdemocracynoworgaboutjobshrmanagerop472094humanresourcesmanagerhuman resources managera learn more and apply immediately at democracynoworgp
pemdemocracy nowem produced with rene feltz mike burke deena guzder messiah rhodes mara taracena tami woronoff charina nadura sam alcoff teymarie astudillo john hamilton robby karran special thanks to julie crosby miriam barnard denis moynihan im amy goodman with nermeen shaikhp
div | hrefhttpstruthoutorgvideorichnationshavereceived16timesmorevaccinedosesperpersonthanpoorimg sizesmaxwidth 200px 100vw 200px srchttpstruthoutorgwpcontentuploads202110seg2gandhi200x113jpg width200 altrich nations received 16x vaccine doses person poor srcsethttpstruthoutorgwpcontentuploads202110seg2gandhi200x113jpg 200w httpstruthoutorgwpcontentuploads202110seg2gandhi400x225jpg 400w httpstruthoutorgwpcontentuploads202110seg2gandhi1200x675jpg 1200w httpstruthoutorgwpcontentuploads202110seg2gandhi800x450jpg 800w httpstruthoutorgwpcontentuploads202110seg2gandhi1536x864jpg 1536w httpstruthoutorgwpcontentuploads202110seg2gandhijpg 1920w classwppostimage height113apwealthy nations received 16 times spancovidspan19 vaccines person poorer nations dependent spancovaxspan program backed word health organization according new emfinancial timesem analysis spancovaxspan set ensure global equitable access vaccines delivered 400 million doses promising 14 billion year higherincome countries struck separate vaccine deals manufacturers leaving spancovaxspan negotiating power united states rolls booster shots stockpiles vaccines person 3 people lowincome countries received single dose infectious disease expert dr monica gandhi says receive booster healthcare worker global vaccine inequity argues push boosters detracts fact way fulfilled moral ethical obligation world speak kate elder senior vaccines adviser doctors borders says structural issue caused global leaders equitably sharing vaccines worldp h2transcripth2 pemthis rush transcript copy final formemp div pstrongspanamyspan spangoodmanspanstrong emdemocracy nowem im amy goodman nermeen shaikhp prich countries received 16 times spancovidspan19 vaccines person poorer nations dependent spanwhospanbacked spancovaxspan program set year people poor countries equitable access vaccines thats according emfinancial timesem hrefhttpswwwftcomcontent0e240929033a457fa735ec7cf93b2f3cdata analysisa compiled spanunicefspan officials african union predict spancovaxspan deliver quarter twoshot vaccine doses needed 13 billion people africa end year united states discussion moves fourth booster shots immunocompromisedp pwe look 3 people lowincome countries received single dose vaccine joined guests new york kate elder senior vaccines adviser doctors borders san francisco dr monica gandhi infectious disease physician professor medicine spanucsfspansan francisco general hospitalp pdr gandhi youve said receive booster healthcare worker global vaccine inequity explainp pstrongdr spanmonicaspan spangandhispanstrong yes president biden announced american booster september 20th midaugust actually huge surprise infectious disease experts reasons vaccines actually holding extremely especially 65 severe disease fact kind messaging reduce confidence vaccinesp pthe second reason incredible global vaccine inequity promises rich countries administration g7 meeting early june rich countries pledged 2 billion dose donation countries hasnt touched terms fulfilling pledge highlevel meetings like un meeting september pledges doses american stored thats true rich countries complete ignoring sort lets moral ethical failing blew lot peoples minds honest talk boostersp pand think whats going country months conversation exclusively boosters mix match know important important johnson amp johnson people important 65 think groups data clear detracts fact way fulfilled moral ethical obligation world lets forget moral ethics minute variants come come places world high transmission right thing public healthp pso right know public stance healthcare worker fully vaccinated got vaccinated early cant bring booster gets better correctedp pstrongspannermeenspan spanshaikhspanstrong kate elder youve working issue vaccine equity pandemic began spancovidspan19 vaccine equity lay main obstacles enabling world gain access vaccines preventing day pharmaceutical companies sharing technology world health organizations mrna tech hub capable manufacturers worldp pstrongspankatespan spanelderspanstrong yeah good morning thanks talking important issuep pi mean dr gandhi said clearly right global crisis moral ethical magnitude rationale scientific rationale emerging pandemic everybody world course wants emerge pandemic global leaders decided route thats scientifically sound equitably sharing vaccines worldp pfrom start pandemic lofty claims platitudes future spancovidspan19 vaccines time vaccines course werent available global leaders came european union leadership spanwhospan future spancovidspan19 vaccines considered global public goods shared equitably world repeat mistakes past know unfortunately declarations highincome country governments turned went forward pursuit shoring stocks domestic use incredible speed saw short period time theoretical vaccines time spoken highincome country governments wealthiest governments vaccines start coming line production line promised wealthy thats situation right know 60 adults wealthiest countries received dose 3 people lowincome countries poorest countries world received dosep pnow mean barriers rectifying clear mean need vaccines available sitting cold storage rooms urgently redistributed places need tremendous volume excess doses right united states calculate end 2021 government half billion excess doses thats including people boosters need redistribute doses rapidly places begging supply thats acute step needs happenp psecondly need sure places regions left regions like africa region middle east given tools vaccines right theres issue supply theres issue able supply potential future pandemics regions like afro region governments like south africa asking technology able vaccines second step needs happen need transfer technology supporting elements knowhow training transferred companies places capable making vaccinesp pand thirdly need intellectual property barriers lifted right ip barriers vaccines need immediately waived governments manufacturers pursue making vaccines dont perpetuate crisisp pnow reason think straightforward reason technology transfer happening despite spanwhospan course world health organization global custodian health know best route emerging pandemic established mrna technology transfer hubs invited companies share technology number companies lined waiting queue receive technology course originator companies sharing willingly technology mean know hold commercial interestsp pbut important remember technology developed public financing taxpayers company example moderna moderna received 10 billion taxpayer funding stimulate research development advance purchases vaccines public high stake course companies looking hold technology lucrative pfizer estimated 33 billion 2021 think estimates moderna 20 billion revenue theyre going hold technology despite worlds best interest sharedp pstrongspanamyspan spangoodmanspanstrong want underscore point funding gone development vaccines kept recipes proprietary private want question dr monica gandhi sammies announced sort oscars people government service won federal employee year dr kizzmekia corbett amazing african american woman scientist barney graham work led development coronavirus vaccine record speed vaccine research center national institutes health working government possible point look united states completely selfish way protect united states learned pandemic dont deal pandemic globally protected idea poured funding research vaccines guaranteed buying vaccines case pfizer refuse available secret sauce recipe allow pharmaceutical companies vaccines worldp pstrongdr spanmonicaspan spangandhispanstrong yes mean think theres comparisons come mind field preexposure prophylaxis prep prevent spanhivspan infection case actually drug pharmaceutical company tip iceberg government funded clinical trials tenofovir disoproxil fumarateemtricitabine drug gilead effective prevent spanhivspan infection congressional urging gilead drug freely available essentially major clinical trials funded government company promptly expensive drug marketed critical funded especially moderna public funding literally like said taxpayer dollars fact wont share technology places ready willing receive countries mean mind constantly blown degree injusticep pand know thing want remind october 2020 time india south africa appealed world trade organization anticipated waves country india spared actually til point knew technology coming said world trade organization ensure waiver theres waiver intellectual property lifesaving vaccines waiver thats possible setting lifesaving technology middle globally urgent pandemic spanwtospan said march 7th literally watch wall new infections happened india subsequent death suffering months completely averted having request honored reminiscent spanhivspan infection living nightmare watch 10 years spanhivspan problem subsaharan africa arguing spantripsspan patent waiversp pand thing want pfizer pfizer makes lifesaving medication called fluconazole essential prevent severe opportunistic infections spanaidsspan late 90s billion dollars year lifesaving easytomake medication new problem tragic right getting lots boosters americans arms know travel positive test like theres incorrect going youre right public investmentp pstrongspannermeenspan spanshaikhspanstrong kate elder talk effort earlier week tuesday biontech signed agreement rwanda senegal senegalbased manufacturer begin construction mrna vaccine manufacturing facility africa middle year mid2022 bypassing world health organizations mrna vaccine tech transfer hub south africa comment think significant significant effect important effect vaccinating africa lowest lowest rates vaccinationp pstrongspankatespan spanelderspanstrong think know interesting development probably partially response tremendous pressure mounted civil society advocates access spancovidspan19 vaccines face companies acting reprehensibly terms prioritizing sales wealthiest prioritizing supply wealthiest developing world goes notable developmentp pthere challenges limitations mean know scope agreement challenge having privately brokered transparency dont know terms conditions facility ultimately ability share facility ability sell africa certain limitation doses challenge deals brokered secrecy theres transparency ultimate ultimately comes contracts dont know terms scope mean voluntary technology transfer voluntary initiatives industry come significant limitations come limitations geographic scope come limitations recipient company product technology notable exciting hear plant developed rwanda partnership west africa senegal theres lot questionsp pi mean think point globally agreedupon forum processes intergovernmentally led developing countries established support world health organization know course spanwhospan truly knows whats needed face pandemic mrna hub led south african government support spanwhospan endtoend plan endtoend plan included components training staff included components making sure regulatory landscape set vaccines longerterm vision mean process need look process future mind know fully steered controlled pharmaceutical companies end day know pharmaceutical corporations specific mandate mean mandate serve shareholders commercialize extent possible products mean think notable need lot particularly notable spanwhospan set tech transfer hub originator companies volunteered come forward actually participatep pstrongspanamyspan spangoodmanspanstrong finally dr monica gandhi thoughts merck story said share formula spancovidspan19 drug molnupiravir poor countries allowing manufacturers produce cheap genericp pstrongdr spanmonicaspan spangandhispanstrong yeah mean im excited merck making announcement thing molnupiravir treatment point youve contracted spancovidspan19 infection prevention better treatment vaccine availability better treatment yes example pharmaceutical companies dop pstrongspanamyspan spangoodmanspanstrong want thank dr monica gandhi infectious disease physician spanucsfspansan francisco general hospital kate elder senior vaccines adviser doctors borders mdecins sans frontiresp pand saturday afternoon ill moderating hrefhttpswwwdemocracynoworgevents202110amy_goodman_moderates_panel_with_ed_snowden_laura_poitras_and_glenn_greenwald_1555live discussiona edward snowden laura poitras glenn greenwald virtual war terror film festival 130 eastern standard time check details democracynoworgp pemdemocracy nowem currently accepting applications positions hrefhttpswwwdemocracynoworgaboutjobsdirectorfinadminop472095directoroffinanceandadministrationdirector finance administrationa hrefhttpswwwdemocracynoworgaboutjobshrmanagerop472094humanresourcesmanagerhuman resources managera learn apply immediately democracynoworgp pemdemocracy nowem produced rene feltz mike burke deena guzder messiah rhodes mara taracena tami woronoff charina nadura sam alcoff teymarie astudillo john hamilton robby karran special thanks julie crosby miriam barnard denis moynihan im amy goodman nermeen shaikhp div |
617b25ea4af2f3f8de4e68ba | How long does the Covid vaccine last – and is natural immunity better? | pas we head into what might ora relnoreferrer noopener hrefhttpswwwbbccomnewshealth59039739 target_blank might nota be a perilous winter it would be nice to have the answer to some vaccine questions depending on how long ago you had yours how protected against covid19 are you emright nowem has your vaccine waned in its effectiveness what if you had covid at some point this year are you better off having had one brand of vaccine versus another and how much do you need a booster shotp
pthese are difficult questions to answer as case numbers go up and down as peoples behaviour changes and as natural immunity levels rise it becomes increasingly messy to draw conclusions different groups of people were offered different vaccines as the rollout went on adding a potential a relnoreferrer noopener hrefhttpscatalogofbiasorgbiasesconfounding target_blankconfoundera into any analysis and lets not forget the different variants studies have to ask whether any decline in protection is due to the vaccine actually waning or the older virus being replaced with the more dangerous delta variant in that case the waning presumably wouldnt continue if no new variants of concern appearp
h4how much does vaccine efficacy actually declineh4
pon 23 october a relnoreferrer noopener hrefhttpswwwmedrxivorgcontent1011012021091221263448v2 target_blanka papera appeared in preprint that is not yet peerreviewed form it reported an analysis of every single severe covid case in scotland since the introduction of vaccines in december that severe part is important in this study were talking about people who ended up in intensive care or who died due to the virusp
ptheres good news and bad news vaccines efficacy emdidem seem to decline whether that was due to the appearance of the delta variant or for other reasons a doublevaxxed person who had 92 per cent protection against severe covid no matter which vaccine they received saw that protection decrease steadily in approximately the first ten weeks nearly twoandahalf months after the second dose the good news is that the mrna vaccines pfizer and moderna only declined slightly and seemed to stabilise after that point they levelled out at about 90 per cent efficacy against severe disease after 20 weeks alas in this study at least the astrazeneca vaccine kept reducing in its efficacy by 20 weeks its protection against severe disease was as low as 60 per centp
pwhat about the longer term does astrazeneca just wane and wane to absolute zero or does its efficacy drop for a while and then level out like the mrna vaccines the authors did some extrapolation they produced models of what their data predicted would happen in future this is educated guesswork but nevertheless one of their models implied astrazeneca would keep declining to the point that by 30 weeks almost seven months people who got it would have essentially no difference in risk from someone who hadnt been vaccinated at all this seems unlikely to be true but the fact that the data even points in this direction should make us concerned about the astrazeneca shot in the long termp
pit suggests an obvious policy give booster shots as soon as possible to those who have had astrazeneca but not necessarily pfizer or moderna and thats what the scientists argued in their paperp
h4do i need a booster vaccineh4
pthat scottish study looked at severe disease but covid short of hospitalisation is hardly fun in a great many cases frustratingly a relnoreferrer noopener hrefhttpswwwmedrxivorgcontent1011012021081821262237v1 target_blankthe best studya also still a nonreviewed preprint of the effectiveness of mrna versus astrazeneca for infection in general rather than severe disease only goes up to 16 weeks just embeforeem the severe disease study started seeing substantial differences in the waning trajectories of the vaccine types but that study does show a waning effect for both pfizer and astrazeneca in terms of reducing infectionp
pyou can see why theres been handwringing about booster shots if we want to contain covid we want to a hrefhttpswwwnewstatesmancomhealthscience202108whatdoesfadingvaccineefficacymeanforthefightagainstcovid19exceed the herd immunity thresholda and ensure everyone has the highest degree of protection we know that for pfizer at least a booster dose a relnoreferrer noopener hrefhttpswwwpfizercomnewspressreleasepressreleasedetailpfizerandbiontechannouncephase3trialdatashowing target_blankincreases the protectiona again to over 95 per cent but a stable 90 per cent is pretty good going boosters dont seem anywhere near as crucial for those whove had mrna vaccines for astrazeneca vaccines though the boosters are much more urgent although booster shots in the uk dont currently discriminate by the original vaccine type perhaps they should the encouragement to come along for your third shot should perhaps be targeted more strongly at those who had the less effective fasterwaning vaccinep
h4do i need a vaccine if ive already had covid is natural immunity betterh4
pit doesnt help that the natural immunity issue has become a relnoreferrer noopener hrefhttpswwwbmjcomcontent374bmjn2101full target_blankpolitically polariseda especially in the us in israel a relnoreferrer noopener hrefhttpswwwmedrxivorgcontent1011012021082421262415v1 target_blankone papera again not yet peerreviewed caused a stir by arguing that natural immunity was both longerlasting and stronger than that induced by the pfizer vaccine but that is inconsistent with other research including a a relnoreferrer noopener hrefhttpspapersssrncomsol3paperscfmabstract_id3790399 target_blankpublic health england preprinta from february and a uk a relnoreferrer noopener hrefhttpswwwonsgovukpeoplepopulationandcommunityhealthandsocialcareconditionsanddiseasesarticlescoronaviruscovid19infectionsurveytechnicalarticleimpactofvaccinationontestingpositiveintheuklatest target_blankoffice for national statistics reporta from last week 18 october that implies the immunity levels from prior infection are worse or about the same as those from vaccinationp
pat the moment its hard to draw strong conclusions about natural immunity its unclear why the studies vary so much but theres an odd circularity in the natural immunity over vaccines argument to get the protection natural immunity provides you have to have already had the disease you want to be protected against with all the risks that entailsp
plets return to our questions from the start your vaccine is probably less effective than it was when you first got it especially if you had it before delta became the dominant variant if you had an mrna vaccine a few months ago it seems you have a lower but fairly constant level of protection if you had astrazeneca though the models suggest you should apply for your booster shot sooner rather than laterp
pstrongem[see also a hrefhttpswwwnewstatesmancompoliticspolling202110wouldthebritishpublicsupportanothercovid19lockdownwould the british public support another covid19 lockdowna]emstrongp | pas head ora relnoreferrer noopener hrefhttpswwwbbccomnewshealth59039739 target_blank nota perilous winter nice answer vaccine questions depending long ago protected covid19 emright nowem vaccine waned effectiveness covid point year better having brand vaccine versus need booster shotp pthese difficult questions answer case numbers peoples behaviour changes natural immunity levels rise increasingly messy draw conclusions different groups people offered different vaccines rollout went adding potential relnoreferrer noopener hrefhttpscatalogofbiasorgbiasesconfounding target_blankconfoundera analysis lets forget different variants studies ask decline protection vaccine actually waning older virus replaced dangerous delta variant case waning presumably wouldnt continue new variants concern appearp h4how vaccine efficacy actually declineh4 pon 23 october relnoreferrer noopener hrefhttpswwwmedrxivorgcontent1011012021091221263448v2 target_blanka papera appeared preprint peerreviewed form reported analysis single severe covid case scotland introduction vaccines december severe important study talking people ended intensive care died virusp ptheres good news bad news vaccines efficacy emdidem decline appearance delta variant reasons doublevaxxed person 92 cent protection severe covid matter vaccine received saw protection decrease steadily approximately weeks nearly twoandahalf months second dose good news mrna vaccines pfizer moderna declined slightly stabilise point levelled 90 cent efficacy severe disease 20 weeks alas study astrazeneca vaccine kept reducing efficacy 20 weeks protection severe disease low 60 centp pwhat longer term astrazeneca wane wane absolute zero efficacy drop level like mrna vaccines authors extrapolation produced models data predicted happen future educated guesswork models implied astrazeneca declining point 30 weeks seven months people got essentially difference risk hadnt vaccinated unlikely true fact data points direction concerned astrazeneca shot long termp pit suggests obvious policy booster shots soon possible astrazeneca necessarily pfizer moderna thats scientists argued paperp h4do need booster vaccineh4 pthat scottish study looked severe disease covid short hospitalisation hardly fun great cases frustratingly relnoreferrer noopener hrefhttpswwwmedrxivorgcontent1011012021081821262237v1 target_blankthe best studya nonreviewed preprint effectiveness mrna versus astrazeneca infection general severe disease goes 16 weeks embeforeem severe disease study started seeing substantial differences waning trajectories vaccine types study waning effect pfizer astrazeneca terms reducing infectionp pyou theres handwringing booster shots want contain covid want hrefhttpswwwnewstatesmancomhealthscience202108whatdoesfadingvaccineefficacymeanforthefightagainstcovid19exceed herd immunity thresholda ensure highest degree protection know pfizer booster dose relnoreferrer noopener hrefhttpswwwpfizercomnewspressreleasepressreleasedetailpfizerandbiontechannouncephase3trialdatashowing target_blankincreases protectiona 95 cent stable 90 cent pretty good going boosters dont near crucial whove mrna vaccines astrazeneca vaccines boosters urgent booster shots uk dont currently discriminate original vaccine type encouragement come shot targeted strongly effective fasterwaning vaccinep h4do need vaccine ive covid natural immunity betterh4 pit doesnt help natural immunity issue relnoreferrer noopener hrefhttpswwwbmjcomcontent374bmjn2101full target_blankpolitically polariseda especially israel relnoreferrer noopener hrefhttpswwwmedrxivorgcontent1011012021082421262415v1 target_blankone papera peerreviewed caused stir arguing natural immunity longerlasting stronger induced pfizer vaccine inconsistent research including relnoreferrer noopener hrefhttpspapersssrncomsol3paperscfmabstract_id3790399 target_blankpublic health england preprinta february uk relnoreferrer noopener hrefhttpswwwonsgovukpeoplepopulationandcommunityhealthandsocialcareconditionsanddiseasesarticlescoronaviruscovid19infectionsurveytechnicalarticleimpactofvaccinationontestingpositiveintheuklatest target_blankoffice national statistics reporta week 18 october implies immunity levels prior infection worse vaccinationp pat moment hard draw strong conclusions natural immunity unclear studies vary theres odd circularity natural immunity vaccines argument protection natural immunity provides disease want protected risks entailsp plets return questions start vaccine probably effective got especially delta dominant variant mrna vaccine months ago lower fairly constant level protection astrazeneca models suggest apply booster shot sooner laterp pstrongem[see hrefhttpswwwnewstatesmancompoliticspolling202110wouldthebritishpublicsupportanothercovid19lockdownwould british public support covid19 lockdowna]emstrongp |
617b26444af2f3f8de4e68be | What if Clinton had come clean? | pwhat if bill clinton had told the truth would americas sexual and political history be different the thought occurs because of the new tv drama emimpeachmentem about the monica lewinsky affairp
psomewhat unfairly to both main parties it is part of the emamerican crime storyem series previous subjects have included oj simpson and andrew cunanan who killed gianni versace its a bit rich putting bill clinton in the same bracket as these murder cases nonetheless the result is intriguing not just because of the magnificent acting and production and not only because in the quarter of a century since the worlds most famous blowjob a certain axis of society seems to have turnedp
pback then monica lewinsky was the butt of every joke in the ancientmodern parlance she was shamed latenight comedians like everyone else on the planet did jokes you can still rattle off girl in her class voted most likely to suckseed that sort of thing a friend was at a postoscars party in 2001 the year bjork came dressed as a swan shortly afterwards monica lewinsky entered the room should have come as a swallow my friend quippedp
pof course in the light of metoo all that has changed now bill clinton played by clive owen is a brooding menace he literally comes out of the shadows every time they meet he is the abuser she the abused because that is how all malefemale power relations have been reformulated in recent times it doesnt hurt that lewinsky is a producer on the show allowing herself to come across almost wholly as an innocent little victim personally this grates with me because as well as being an obsessive and a nut the woman playing lewinsky looks like that actress from emhairsprayem who made me grind my teeth and turn off in under five minutesp
pbut none of this is what is interesting what is interesting is the question that has only come up once in the show so far what as i say if bill clinton had told the truthp
pthe scene where this is made explicit comes when clinton has already perjured himself by telling the special prosecutors office that he did not have sexual relations with his former intern or anyone else he then calls in the pollster dick morris and asks what would happen if he fessed up morris lays it out with some secret opinion polling here are the approval ratings if you admit to having had an affair not disastrous here are the approval ratings if you admit that while president of the united states you committed perjury the numbers are through the floor so in the drama at least clinton knows hes going to have to push on with the liep
pbut that same thought keeps occurring what if hed just admitted to it earlier what if the moment the lewinsky affair started to come out he had just said it was true people say he couldnt have done that because of hillary yet if you are married to a man like bill i would say that you can work out pretty quickly what kind of a guy youve got ive only met him once but i have heard the most surprising women say what they would like to do if they got him in a room alone and none of it was remotely vengeful hes one of those highly sexual people who when theyre attractive have people flinging themselves at them when theyre not attractive we just warn our friends that theyre not safe in taxisp
pimagine if 23 years ago clinton had said something like this look im not especially proud of it and im deeply sorry to have embarrassed my wife but you know were all human and about half of us in this country are men and well things happen and although marriage vows are sacred and people should stick to them not everybody does or can and thats just a fact of life not the best thing in the world and not the worst now lets try to sort out healthcarep
pi dont know what it would have done for him in the polls or for relations with hillary but for the countryp
pin france the public and politicians have a famously more grownup attitude towards human sexual relations they recognize that adults have sex and that it isnt a matter of perennial amazement or much of anyone elses business in britain we remain stuck somewhere in the era of adolescence viewing sex when it is mentioned as mainly a subject for humor like some other embarrassing bodily functionsp
div
a hrefhttpsspectatorworldcomsubscribethedcdiaryimg alt srchttpsspectatorworldcomwpcontentuploads202110emailnewslettermobpng classwpimage29949a div
pbut in america wow is america screwed up about sex in public life perhaps the most sexualized society in the world still views sex through a presbyterian prism in which sex outside marriage is seen as a scandalous potentially imprisonable matterp
pit is one of many things that helps destroy american politics after the clinton affair it turned out that one of clintons biggest republican pursuers the speaker of the house newt gingrich had cheated on both his first and second wives democrat al franken resigned from the senate three years ago after a photo of him emerged doing a comedy skit pretending to cup a womans breasts donald trump somehow got away with pretending to be some godfearing monogamist and just this august the democratic governor of new york andrew cuomo had to go when it transpired that among other transgressions he had put a hand on a womans cheek at a wedding and asked if he could kiss her there is so much to blame cuomo for his administrations coverup of covid nursinghome deaths is one thing that springs to mind but a sex scandal in which no sex occurred was what did it for himp
pso i wonder what would have happened if clinton had come clean all those years ago true a few more vases might have been airborne in the white house that night but gosh it could have helped the nation fracture a bit lessp
pemthis article was originally published in ema hrefhttpspectatorcoukarticlewhatifclintonhadcomecleanthe spectatoraems uk magazine a hrefhttpsspectatorworldcomsubscribenowsubscribe to the world edition hereaemp
pthe post a relnofollow hrefhttpsspectatorworldcomtopicbillclintoncomecleanaffairimpeachmentwhat if clinton had come cleana appeared first on a relnofollow hrefhttpsspectatorworldcomthe spectator worldap | pwhat bill clinton told truth americas sexual political history different thought occurs new tv drama emimpeachmentem monica lewinsky affairp psomewhat unfairly main parties theemamerican crime storyem series previous subjects included oj simpson andrew cunanan killed gianni versace bit rich putting bill clinton bracket murder cases nonetheless result intriguing magnificent acting production quarter century worlds famous blowjob certain axis society turnedp pback monica lewinsky butt joke ancientmodern parlance shamed latenight comedians like planet jokes rattle girl class voted likely suckseed sort thing friend postoscars party 2001 year bjork came dressed swan shortly monica lewinsky entered room come swallow friend quippedp pof course light metoo changed bill clinton played clive owen brooding menace literally comes shadows time meet abuser abused malefemale power relations reformulated recent times doesnt hurt lewinsky producer allowing come wholly innocent little victim personally grates obsessive nut woman playing lewinsky looks like actress fromemhairsprayemwho grind teeth turn minutesp pbut interesting interesting question come far bill clinton told truthp pthe scene explicit comes clinton perjured telling special prosecutors office sexual relations intern calls pollster dick morris asks happen fessed morris lays secret opinion polling approval ratings admit having affair disastrous approval ratings admit president united states committed perjury numbers floor drama clinton knows hes going push liep pbut thought keeps occurring hed admitted earlier moment lewinsky affair started come said true people couldnt hillary married man like bill work pretty quickly kind guy youve got ive met heard surprising women like got room remotely vengeful hes highly sexual people theyre attractive people flinging theyre attractive warn friends theyre safe taxisp pimagine 23 years ago clinton said like look im especially proud im deeply sorry embarrassed wife know human half country men things happen marriage vows sacred people stick everybody thats fact life best thing world worst lets try sort healthcarep pi dont know polls relations hillary countryp pin france public politicians famously grownup attitude human sexual relations recognize adults sex isnt matter perennial amazement elses business britain remain stuck era adolescence viewing sex mentioned mainly subject humor like embarrassing bodily functionsp div hrefhttpsspectatorworldcomsubscribethedcdiaryimg alt srchttpsspectatorworldcomwpcontentuploads202110emailnewslettermobpng classwpimage29949a div pbut america wow america screwed sex public life sexualized society world views sex presbyterian prism sex outside marriage seen scandalous potentially imprisonable matterp pit things helps destroy american politics clinton affair turned clintons biggest republican pursuers speaker house newt gingrich cheated second wives democrat al franken resigned senate years ago photo emerged comedy skit pretending cup womans breasts donald trump got away pretending godfearing monogamist august democratic governor new york andrew cuomo transpired transgressions hand womans cheek wedding asked kiss blame cuomo administrations coverup covid nursinghome deaths thing springs mind sex scandal sex occurred himp pso wonder happened clinton come clean years ago true vases airborne white house night gosh helped nation fracture bit lessp pemthis article originally published inema hrefhttpspectatorcoukarticlewhatifclintonhadcomecleanthe spectatoraemsuk magazinea hrefhttpsspectatorworldcomsubscribenowsubscribe world edition hereaemp pthe post relnofollow hrefhttpsspectatorworldcomtopicbillclintoncomecleanaffairimpeachmentwhat clinton come cleana appeared relnofollow hrefhttpsspectatorworldcomthe spectator worldap |
617b26be4af2f3f8de4e68c8 | Further evidence that mobility shocks are positive | pthis time the work is from emi nakamura jsef sigurdsson jn steinsson a relnoopener hrefhttpsacademicoupcomrestudadvancearticleabstractdoi101093restudrdab0626372705redirectedfromfulltext target_blankin the review of economic studiesap
blockquotepwe exploit a volcanic experiment to study the costs and benefits of geographic mobility in our experiment a third of the houses in a town were covered by lava people living in these houses were much more likely to move away permanently for the dependents in a household children our estimates suggest that being induced to move by the lava shock dramatically raised lifetime earnings and education while large these estimates come with a substantial amount of statistical uncertainty the benefits of moving were very unequally distributed across generations the household heads parents were made slightly worse off by the shock these results suggest large barriers to moving for the children which imply that labour does not flow to locations where it earns the highest returns the large gains from moving for the young are surprising in light of the fact that the town affected by our volcanic experiment was and is a relatively high income town we interpret our findings as evidence of the importance of comparative advantage the gains to moving may be very large for those badly matched to the location they happened to be born in even if differences in average income are smallpblockquote
pand here are a relnoopener hrefhttpsmarginalrevolutioncomskatrina target_blanksome earlier mobility resultsa related to hurricane katrina another exogenous shock that forced many people out make that change in your life nowp
pvia a relnoopener hrefhttpstwittercompaulnovosad target_blankpaul novosadap
pthe post a relnofollow hrefhttpmarginalrevolutioncommarginalrevolution202110furtherevidencethatmobilityshocksarepositivehtmlfurther evidence that mobility shocks are positivea appeared first on a relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap | pthis time work emi nakamura jsef sigurdsson jn steinsson relnoopener hrefhttpsacademicoupcomrestudadvancearticleabstractdoi101093restudrdab0626372705redirectedfromfulltext target_blankin review economic studiesap blockquotepwe exploit volcanic experiment study costs benefits geographic mobility experiment houses town covered lava people living houses likely away permanently dependents household children estimates suggest induced lava shock dramatically raised lifetime earnings education large estimates come substantial statistical uncertainty benefits moving unequally distributed generations household heads parents slightly worse shock results suggest large barriers moving children imply labour flow locations earns highest returns large gains moving young surprising light fact town affected volcanic experiment relatively high income town interpret findings evidence importance comparative advantage gains moving large badly matched location happened born differences average income smallpblockquote pand relnoopener hrefhttpsmarginalrevolutioncomskatrina target_blanksome earlier mobility resultsa related hurricane katrina exogenous shock forced people change life nowp pvia relnoopener hrefhttpstwittercompaulnovosad target_blankpaul novosadap pthe post relnofollow hrefhttpmarginalrevolutioncommarginalrevolution202110furtherevidencethatmobilityshocksarepositivehtmlfurther evidence mobility shocks positivea appeared relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap |
617b26d44af2f3f8de4e68ca | Why I remain on Team Transitory | pthat is the topic of a relnoopener hrefhttpswwwbloombergcomopinionarticles20211027inflationisntheretostayandherearethreereasonswhysrndopinionsrefhtohjx5y target_blankmy latest bloomberg columna here is one excerptp
blockquotepthe case for team transitory is not about whether the next pending inflation numbers will come in high or low instead it consists of the following two propositionspblockquote
ul
lithe federal reserve can control the rate of price inflationli
lithe federal reserve does not want inflation to be very highli
ul
pandp
blockquotepperhaps most important there is the markets perspective and the market expects the fed to bring down inflation rates as i write the 10year treasury a relnoopener hrefhttpswwwbloombergcommarketsratesbondsgovernmentbondsus target_blankyielda is 164 that yield has been rising but it hardly seems to predict hyperinflation or even 5 inflation for the next 10 years the most negative piece of evidence so far is from the tips market which a relnoopener hrefhttpswwwnytimescom20211026businessinflationinterestratestreasurybondshtml target_blankis predictinga inflation of about 3 over the next five yearsp
pyou might be wondering whether the market understands inflation and the fed well investors are obsessed with the fed and study it closely when i encounter team transitory skeptics i ask them what is it that you understand about the fed that the broader market does not i have yet to receive a compelling answerpblockquote
pas an addon note a relnoopener hrefhttpseconbrowsercomarchives202110becarefulwithsimpletreasurytipsspreads target_blankproperly interpreteda those tips data probably are suggesting expected inflation rates of less than three percent perhaps even closer to two percent looking fowardp
p p
pthe post a relnofollow hrefhttpmarginalrevolutioncommarginalrevolution202110whyiremainonteamtransitoryhtmlwhy i remain on team transitorya appeared first on a relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap | pthat topic relnoopener hrefhttpswwwbloombergcomopinionarticles20211027inflationisntheretostayandherearethreereasonswhysrndopinionsrefhtohjx5y target_blankmy latest bloomberg columna excerptp blockquotepthe case team transitory pending inflation numbers come high low instead consists following propositionspblockquote ul lithe federal reserve control rate price inflationli lithe federal reserve want inflation highli ul pandp blockquotepperhaps important markets perspective market expects fed bring inflation rates write 10year treasurya relnoopener hrefhttpswwwbloombergcommarketsratesbondsgovernmentbondsus target_blankyieldais 164 yield rising hardly predict hyperinflation 5 inflation 10 yearsthe negative piece evidence far tips market whicha relnoopener hrefhttpswwwnytimescom20211026businessinflationinterestratestreasurybondshtml target_blankis predictingainflation 3 yearsp pyou wondering market understands inflation fed investors obsessed fed study closely encounter team transitory skeptics ask understand fed broader market receive compelling answerpblockquote pas addon note relnoopener hrefhttpseconbrowsercomarchives202110becarefulwithsimpletreasurytipsspreads target_blankproperly interpreteda tips data probably suggesting expected inflation rates percent closer percent looking fowardp pp pthe post relnofollow hrefhttpmarginalrevolutioncommarginalrevolution202110whyiremainonteamtransitoryhtmlwhy remain team transitorya appeared relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap |
617dc7bcfc4bbe18c2028aa9 | Why Are Relatively Poor People Not More Supportive of Redistribution? | blockquotepwe test a key assumption underlying seminal theories about preferences for redistribution which is that relatively poor people should be the most in favor of redistribution we conduct a randomized survey experiment with over 30000 participants across 10 countries half of whom are informed of their position in the national income distribution contrary to prevailing wisdom people who are told they are relatively poorer than they thought are less concerned about inequality and are not more supportive of redistribution this finding is consistent with people using their own living standard as a benchmark for what they consider acceptable for otherspblockquote
pthat is from a relnoopener hrefhttpspubsaeaweborgdoipdfplus101257pol20190276 target_blanka newly published papera by christopher hoy and franziska magerp
pthe post a relnofollow hrefhttpmarginalrevolutioncommarginalrevolution202110whyarerelativelypoorpeoplenotmoresupportiveofredistributionhtmlwhy are relatively poor people not more supportive of redistributiona appeared first on a relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap | blockquotepwe test key assumption underlying seminal theories preferences redistribution relatively poor people favor redistribution conduct randomized survey experiment 30000 participants 10 countries half informed position national income distribution contrary prevailing wisdom people told relatively poorer thought concerned inequality supportive redistribution finding consistent people living standard benchmark consider acceptable otherspblockquote pthat relnoopener hrefhttpspubsaeaweborgdoipdfplus101257pol20190276 target_blanka newly published papera christopher hoy franziska magerp pthe post relnofollow hrefhttpmarginalrevolutioncommarginalrevolution202110whyarerelativelypoorpeoplenotmoresupportiveofredistributionhtmlwhy relatively poor people supportive redistributiona appeared relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap |
61806af453f78f470bd63fbd | COP 26: End the Cynicism and Denial – Pt1 | a relnofollow hrefhttpstheanalysisnewscop26endthecynicismanddenialpt1 titlecop 26 end the cynicism and denial pt1img sizesmaxwidth 1024px 100vw 1024px srchttpstheanalysisnewswpcontentuploads202111cop1024x577jpg width1024 alt srcsethttpstheanalysisnewswpcontentuploads202111cop1024x577jpg 1024w httpstheanalysisnewswpcontentuploads202111cop300x169jpg 300w httpstheanalysisnewswpcontentuploads202111cop768x433jpg 768w httpstheanalysisnewswpcontentuploads202111copjpg 1267w classwebfeedsfeaturedvisual wppostimage height577aparve error src mismatch url httpsyoutube1twyoqo13lk src in httpswwwyoutubecomembed1twyoqo13lkfeatureoembedampenablejsapi1amporiginhttpstheanalysisnews src gen httpswwwyoutubecomembed1twyoqo13lkactual comparison url httpsyoutube1twyoqo13lk src in httpswwwyoutubecomembed1twyoqo13lkenablejsapi1amporiginhttps3a2f2ftheanalysisnews src gen httpswwwp
pa relnofollow hrefhttpstheanalysisnewscop26endthecynicismanddenialpt1sourceap | relnofollow hrefhttpstheanalysisnewscop26endthecynicismanddenialpt1 titlecop 26 end cynicism denial pt1img sizesmaxwidth 1024px 100vw 1024px srchttpstheanalysisnewswpcontentuploads202111cop1024x577jpg width1024 alt srcsethttpstheanalysisnewswpcontentuploads202111cop1024x577jpg 1024w httpstheanalysisnewswpcontentuploads202111cop300x169jpg 300w httpstheanalysisnewswpcontentuploads202111cop768x433jpg 768w httpstheanalysisnewswpcontentuploads202111copjpg 1267w classwebfeedsfeaturedvisual wppostimage height577aparve error src mismatch url httpsyoutube1twyoqo13lk src httpswwwyoutubecomembed1twyoqo13lkfeatureoembedampenablejsapi1amporiginhttpstheanalysisnews src gen httpswwwyoutubecomembed1twyoqo13lkactual comparison url httpsyoutube1twyoqo13lk src httpswwwyoutubecomembed1twyoqo13lkenablejsapi1amporiginhttps3a2f2ftheanalysisnews src gen httpswwwp pa relnofollow hrefhttpstheanalysisnewscop26endthecynicismanddenialpt1sourceap |
61806b2553f78f470bd63fc3 | OnlySubs: James Lindsay on the Dr. Phil Show | pemonlysubs episode 67 james lindsay on the dr phil showspan datatagposttitle spanemis now available exclusively for new discourses contributors on the following platformsbr
a relnoopener hrefhttpsnewdiscourseslocalscompost1242912jameslindsayonthedrphilshowonlysubswithjameslindsayep67 target_blanklocalsabr
a relnoopener hrefhttpswwwpatreoncompostsjameslindsayon58165358 target_blankpatreonabr
a relnoopener hrefhttpswwwsubscribestarcomposts454972 target_blanksubscribestarabr
a relnoopener hrefhttpsyoutube_tdf7zacvpy target_blankyoutube membersabr
a relnoopener hrefhttpsthinkspotcomonline_contentnewdiscoursesjameslindsayonthedrphilshowonlysubswithjameslindsayep67abukq5devent target_blankthinkspotap
divat the end of august dear contributors i was invited to appear on the dr phil show along with a handful of other heroes in the fight against critical race theory thats been over two months ago though and the episode still hasnt been aired in fact we havent heard a word maybe its just slow in production or maybe there are other reasons but since so much time has passed i thought it would be of some interest to share with you all what happened on that little trip to southern california and to expose the game that was being set up for us there did i mess it all up tune in to this episode of james lindsay onlysubs my subscribersonly podcast to hear the storydiv
pprevious episodes of emonlysubsem can be found a hrefhttpsnewdiscoursescomtagonlysubshereap
pthe post a relnofollow hrefhttpsnewdiscoursescom202111onlysubsjameslindsayonthedrphilshowonlysubs james lindsay on the dr phil showa appeared first on a relnofollow hrefhttpsnewdiscoursescomnew discoursesap | pemonlysubs episode 67 james lindsay dr phil showspan datatagposttitlespanemis available exclusively new discourses contributors following platformsbr relnoopener hrefhttpsnewdiscourseslocalscompost1242912jameslindsayonthedrphilshowonlysubswithjameslindsayep67 target_blanklocalsabr relnoopener hrefhttpswwwpatreoncompostsjameslindsayon58165358 target_blankpatreonabr relnoopener hrefhttpswwwsubscribestarcomposts454972 target_blanksubscribestarabr relnoopener hrefhttpsyoutube_tdf7zacvpy target_blankyoutube membersabr relnoopener hrefhttpsthinkspotcomonline_contentnewdiscoursesjameslindsayonthedrphilshowonlysubswithjameslindsayep67abukq5devent target_blankthinkspotap divat end august dear contributors invited appear dr phil handful heroes fight critical race theory thats months ago episode hasnt aired fact havent heard word maybe slow production maybe reasons time passed thought interest share happened little trip southern california expose game set mess tune episode james lindsay onlysubs subscribersonly podcast hear storydiv pprevious episodes emonlysubsem found hrefhttpsnewdiscoursescomtagonlysubshereap pthe post relnofollow hrefhttpsnewdiscoursescom202111onlysubsjameslindsayonthedrphilshowonlysubs james lindsay dr phil showa appeared relnofollow hrefhttpsnewdiscoursescomnew discoursesap |
61806b6b53f78f470bd63fcb | Supreme Court Rebuffs Attempt To Open Up Access to Classified FISA Court Reports | div
picture
source sizesminwidth 600px 331px 100vw typeimagewebp srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202111snowdenprotesters_1161x653jpgwebp 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202111snowdenprotesters_1161x653jpgwebp 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202111snowdenprotesters_1161x653800x450jpgwebp 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202111snowdenprotesters_1161x653600x338jpgwebp 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202111snowdenprotesters_1161x653331x186jpgwebp 331w
source sizesminwidth 600px 331px 100vw typeimagejpeg srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202111snowdenprotesters_1161x653jpg 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202111snowdenprotesters_1161x653jpg 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202111snowdenprotesters_1161x653800x450jpg 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202111snowdenprotesters_1161x653600x338jpg 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202111snowdenprotesters_1161x653331x186jpg 331w
img width1200 altsnowdenprotesters_1161x653 srchttpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202111snowdenprotesters_1161x653800x450jpg height675
picture
div
pfor nearly a decade activists have been trying to get the federal government to determine how much a secretive surveillance court can keep its conclusions out of the public eye today the supreme court a hrefhttpswwwsupremecourtgovorderscourtorders110121zor_k5flpdfdeclined to hear the caseap
psince 2013 the american civil liberties union aclu has been a hrefhttpswwwacluorgcasesacluvunitedstatesfirstamendmentrightaccesssecretsurveillancecourtdecisionsfiling motionsa to get the federal foreign intelligence surveillance court fisc to release secret opinion connected to the collection of americans communications data the first motions began after a hrefhttpsreasoncom20191105iwenttoworkforthegovernmentandifoundedward snowdens disclosuresa that the national security agency nsa was using section 215 of the patriot act to scoop up millions of americans internet and phone records without warrants and without the targets knowledge allegedly as part of the post911 war on terrorismp
pmuch of what the fisc authorized by the foreign intelligence surveillance act does is classified because part of its purpose is to permit the covert observation of people who may represent a threat to national security but another part of the courts purpose is to make sure that americans are protected from unauthorized secret surveillance snowdens disclosures suggested a breakdown in those protectionsp
pthe aclu hoped to uncover the legal justification for this use of the patriot act when section 215 was replaced by the usa freedom act in 2015 the group filed a new motion under the new guidelines and in april of this year the aclu along with the knight first amendment institute at columbia university and the law firm gibson dunn filed a petition to the supreme court a hrefhttpswwwacluorgcasesacluvunitedstatesfirstamendmentrightaccesssecretsurveillancecourtdecisionsasking the justicesa quotto recognize a first amendment right of public access to the fiscs opinionsensuring that the opinions are released with only those redactions necessary to prevent genuine harm to national securityquotp
pin this mornings orders the supreme court declined to consider the argument the justices didnt explain why they turned it down which is typical but justice neil gorsuch penned a notable dissent that was joined by justice sonia sotomayorp
pthe federal government has a hrefhttpswwwacluorgfilesassetsgovt_opposition_to_aclu_fisc_motionpdfargueda that because these reports are so heavily classified its the sole province of the executive branchnot the judicial branchto determine what may be released indeed it has argued that the judicial branch doesnt have any role to play in this process at all aside from fisc which has ruled that it doesnt have the authority to consider whether reports should be released this did not sit well with gorsuch who writesp
blockquotepthis case presents questions about the right of public access to article iii judicial proceedings of grave national importance maybe even more fundamentally this case involves a governmental challenge to the power of this court to review the work of article iii judges in a subordinate court if these matters are not worthy of our time what ispblockquote
pthe aclu and knight first amendment institute put out a joint release expressing disappointment at the courts rejection of the petitionp
pquotthe supreme court has left in place a system that makes informed public debate about government surveillance exceedingly difficultquot writes alex abdo the knight institutes litigation director quotwithout access to the fiscs opinions the public cannot evaluate the powers that the governments surveillance agencies are exercising in its name the fisc shouldnt be exempt from the constitutional right of access that applies to other courts its past due for the court to establish this principlequotp
pin the meantime well have to keep relying on the whistleblowersp | div picture source sizesminwidth 600px 331px 100vw typeimagewebp srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202111snowdenprotesters_1161x653jpgwebp 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202111snowdenprotesters_1161x653jpgwebp 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202111snowdenprotesters_1161x653800x450jpgwebp 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202111snowdenprotesters_1161x653600x338jpgwebp 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202111snowdenprotesters_1161x653331x186jpgwebp 331w source sizesminwidth 600px 331px 100vw typeimagejpeg srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202111snowdenprotesters_1161x653jpg 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202111snowdenprotesters_1161x653jpg 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202111snowdenprotesters_1161x653800x450jpg 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202111snowdenprotesters_1161x653600x338jpg 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202111snowdenprotesters_1161x653331x186jpg 331w img width1200 altsnowdenprotesters_1161x653 srchttpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202111snowdenprotesters_1161x653800x450jpg height675 picture div pfor nearly decade activists trying federal government determine secretive surveillance court conclusions public eye today supreme court hrefhttpswwwsupremecourtgovorderscourtorders110121zor_k5flpdfdeclined hear caseap psince 2013 american civil liberties union aclu hrefhttpswwwacluorgcasesacluvunitedstatesfirstamendmentrightaccesssecretsurveillancecourtdecisionsfiling motionsa federal foreign intelligence surveillance court fisc release secret opinion connected collection americans communications data motions began hrefhttpsreasoncom20191105iwenttoworkforthegovernmentandifoundedward snowdens disclosuresa national security agency nsa section 215 patriot act scoop millions americans internet phone records warrants targets knowledge allegedly post911 war terrorismp pmuch fisc authorized foreign intelligence surveillance act classified purpose permit covert observation people represent threat national security courts purpose sure americans protected unauthorized secret surveillance snowdens disclosures suggested breakdown protectionsp pthe aclu hoped uncover legal justification use patriot act section 215 replaced usa freedom act 2015 group filed new motion new guidelines april year aclu knight amendment institute columbia university law firm gibson dunn filed petition supreme court hrefhttpswwwacluorgcasesacluvunitedstatesfirstamendmentrightaccesssecretsurveillancecourtdecisionsasking justicesa quotto recognize amendment right public access fiscs opinionsensuring opinions released redactions necessary prevent genuine harm national securityquotp pin mornings orders supreme court declined consider argument justices didnt explain turned typical justice neil gorsuch penned notable dissent joined justice sonia sotomayorp pthe federal government hrefhttpswwwacluorgfilesassetsgovt_opposition_to_aclu_fisc_motionpdfargueda reports heavily classified sole province executive branchnot judicial branchto determine released argued judicial branch doesnt role play process aside fisc ruled doesnt authority consider reports released sit gorsuch writesp blockquotepthis case presents questions right public access article iii judicial proceedings grave national importance maybe fundamentally case involves governmental challenge power court review work article iii judges subordinate court matters worthy time ispblockquote pthe aclu knight amendment institute joint release expressing disappointment courts rejection petitionp pquotthe supreme court left place system makes informed public debate government surveillance exceedingly difficultquot writes alex abdo knight institutes litigation director quotwithout access fiscs opinions public evaluate powers governments surveillance agencies exercising fisc shouldnt exempt constitutional right access applies courts past court establish principlequotp pin meantime relying whistleblowersp |
61806b6c53f78f470bd63fcd | The Academic Freedom Podcast #7 with Hank Reichman | pa new episode of a hrefhttpsacademicfreedomorgpodcaststhe academic freedom podcasta from the a hrefhttpsacademicfreedomorgacademic freedom alliancea is now available subscribe through your favorite platform so you dont miss an episodep
pin this episode i talk with hank reichman about the state of academic freedom in america today reichman is professor emeritus of history at california state university east bay he is also the former chair of american association of university professors committee a on academic freedom and tenure his new book ema hrefhttpswwwamazoncomexecobidosasin1421442159reasonmagazinea20understanding academic freedomaem is now availablep
pa hrefhttpswwwpodbeancomewpbr4dte111d092listen to the whole thing hereap | pa new episode hrefhttpsacademicfreedomorgpodcaststhe academic freedom podcasta hrefhttpsacademicfreedomorgacademic freedom alliancea available subscribe favorite platform dont miss episodep pin episode talk hank reichman state academic freedom america today reichman professor emeritus history california state university east bay chair american association university professors committee academic freedom tenure new book ema hrefhttpswwwamazoncomexecobidosasin1421442159reasonmagazinea20understanding academic freedomaem availablep pa hrefhttpswwwpodbeancomewpbr4dte111d092listen thing hereap |
61806b7d53f78f470bd63fcf | America’s labor shortage and the ‘Great Resignation’: My long-read Q&A with Michael Strain | pstrongby james pethokoukis and michael strainstrongp
pas the covid19 pandemic drags on millions of americans are quitting their jobs in a labor market thats already short on workers on top of this great resignation the laborforce participation rate still hasnt rebounded to prepandemic levels all the while supply chain interruptions and trillions in government stimulus are pushing prices up to find out whats going on with the labor market and broader american economy ive brought on michael strain p
pmike is the arthur f burns scholar in political economy and the director of economic policy studies at aei p
diviframe srchttpsplayercaptivatefmepisodecc3ac7ffdba64ea193247094517e723fiframediv
pwhat follows is a lightly edited transcript of our conversation you can download the episode a hrefhttpswwwaeiorgpodcastmichaelstrainthestateofthelabormarketherea and dont forget to subscribe to my podcast on a hrefhttpspodcastsapplecomuspodcastpoliticaleconomypodcastid589914386mt2itunesa or a hrefhttpswwwstitchercompodcastricochetmoneypoliticswithjimpethokoukisstitchera tell your friends leave a reviewp
pstrongpethokoukisstrong strongthe unemployment rate is falling lots of jobs seem to be created every month but yet it seems people are concerned that americans somehow are not coming back to work ive heard the phrase the great resignation im not sure exactly what that means some people are resigning other people are just not going back to work what is the state of the labor market right nowstrongp
pstrain well i think the state of the labor market is confused if you look at some indicators you see a labor market thats really exceptionally strong and its in great shape we can tick through a few of those the number of unemployed workers for every job vacancy is well under one in other words there are more vacancies than there are unemployed workers a big problem that the us labor market has had in the past couple of decades has been the opposite there are too few jobs for available unemployed workersp
pwe have the opposite problem right now jobs are chasing workers workers are not chasing jobs we have record numbers of job openings in the economy we have a record number of workers who are quitting their jobs and the reason why quitting is considered a sign of a strong labor market is that people wouldnt voluntarily quit their job unless they were pretty confident they could get a better job or at least a job that was at least as goodp
pso the fact that workers are feeling like theyre able to quit in large numbers suggests that they have the upper hand in the labor market right now perhaps most compellingly the strength of the labor market can be seen in wage growth right now wages are growing at about a 5 percent annual rate if you look at wages in the leisure and hospitality sector they are growing at an 11 percent annual rate so really rapid wage growth it is common to hear businesses say theres a labor shortage we cant find good workers etc the right instinct is to be skeptical of those claims because those claims typically occur without wage increasesp
figure classwpblockimageimg alt srchttpswwwaeiorgwpcontentuploads202111strainlongreadhiringjpgx91208 classwpimage1008614053figcaptiona now hiring sign in montgomery alabama sept 1 2021 via reutersfigcaptionfigure
pand so when you typically hear businesses talk about labor shortages or not being able to find workers what they really mean is were unable to find workers at the wages that were currently able to offer and theyre not taking steps to be able to increase their wage offerings that isnt whats happening now you really are seeing businesses put their money where their mouths are and nominal wages are growing really rapidly so all of that really points to a very strong labor marketp
spanspan
pstrongso the confusion is that it also seems as if people are unhappy about their jobs theyre not returning to their jobs its almost been described as if the american labor force has had a great awakening strong strongthat theyve all discovered that those jobs that they had before were terrible and now they dont want to go back so what are those confusing factorsstrongp
pwell i think the most confusing factor is that workers arent coming back in any aggressive fashion if you look at workforce participation among prime age workers workers who are too old to be in school too young to be retired what you see is that there really has been no improvement in their workforce participation since the summerp
pif you look at how this has evolved over the course of the pandemic you see that workforce participation among this group of workers fell by around 4 percent during the lockdowns then in the spring of 2020 that recovered to a little over 98 percent of its prepandemic level so employment was down about 2 percent for this group and thats basically where it still is today one source of the labor shortage surely is early retirements but when youre looking at people who are in their 30s 40s and early 50s thats not going to be a big part of the story so there must be other reasons keeping these workers on the sidelines other than early retirementp
pstrongdoes the story that youre about to tell differ by skill level education level income level is it a different case for lowerwage workers than for upperwage workers or is it a similar storystrongp
pyou see this largely across the board i mean as it often happens the job losses when the recession began were concentrated among lowerwage workers and lowerincome households and so the gains are disproportionately among those workers that are higher income or theyre just less sensitive to the business cycle in general but fundamentally we still have this economy where workforce participation really isnt improving and where we are several million jobs in the hole six million seven million jobs below where we should be and below where we wouldve been if it werent for the pandemicp
pthis is a confusing situation on the one hand labor demand is white hot employers are rapidly raising wages they are creating job vacancies that theyre trying to fill at the same time were six or seven million jobs in the hole workforce participation isnt really improving and we have millions of people on the sidelines who shouldnt be there so this is why i characterize it as confusingp
pstrongwhy arent they coming back to workstrongp
pwell i think its a combination of factors some of these factors are related to the pandemic for sure i mean i think you do still see in surveys that some people are still worried about the pandemic and dont feel comfortable coming back to work as a consequence of that this has been a consistent story throughout the last year and a half pretty much since the lockdowns were lifted in the late spring of 2020 when you see the share of the population that is unable to work due to covid dropping but when theres a covid spike like weve had with the delta variant you see that decline suspended you see people saying oh well yeah i think covid is making it hard for me to workp
pthere are lingering childcare issues for sure schools are open for the most part daycare centers are open for the most part but theyre still really affected by the pandemic and this is something that i think parents of schoolaged kids all experience every day certainly i do with my kids school the likelihood that we might get an email or a phone call that says hey you have to come pick up your kids or hey your kids classroom is going to be shut down for a week or two is a daily reality for us and thats just not the kind of thing that people had to worry about before the pandemic and i think that is keeping some people from reentering the workforce i think some people are saying ill go back to work once i can be confident that im not going to be called home randomly or my kids classroom is going to be closed downp
panother big factor is the generosity of unemployment benefits president biden as part of the american rescue plan increased the generosity of unemployment benefits by 300 a week on average unemployment benefits are typically about 350 a week so going from 350 to 650 is a really large increase and that has kept people on the sidelines that program expired last month but it takes people a while to start their job search and to find a job and so i think thats another factor keeping people on the sidelinesp
pstrongit seems like every month numbers come out and people look at those numbers and say well see we dont detect any impact of these unemployment benefits so what is the case that you are wrong but why arent you wrongstrongp
plook this has certainly been a source of controversy let me present three different buckets of evidence and we can sort through them one bucket of evidence comes from the us labor market from the 1970s until the eve of the pandemic and if you look at studies of that period theres a strong consensus in the evidence that when unemployment benefits become more generous people stay unemployed for longer and theres debate about the magnitude of that effect the size of that effect but i think thats pretty close to a consensus viewp
pwhen the pandemic began the cares act signed by president trump in march of 2020 significantly expanded the generosity of unemployment benefits and studies of that unemployment benefit expansion do not find that it led people to be unemployed for longer so thats in conflict with the evidence that came before thatp
figure classwpblockimageimg alt srchttpswwwaeiorgwpcontentuploads202111strainlongreadcaresjpgx91208 classwpimage1008614068figcaptionus president donald trump signs the cares act in the oval office of the white house march 27 2020 reutersjonathan ernstfigcaptionfigure
pthe question i think about the effect of president bidens 300 expansion really kind of boils down to a question of whether the economy in the summer and fall of 2021 the economy of june july august september october where we are now was more like the prepandemic economy more like a normal economy or more like the economy that existed in the spring and summer of 2020 during the initial months of the pandemic and it has elements of both i dont think theres any question about that but in my view the economy was much much closer to normal in the summer and fall of 2021 than it was to a pandemic economyp
pso our expectation should be that the relationship between unemployment benefits and the duration of unemployment looks a lot more like the half century before the pandemic than it looked like in 2020 there is evidence accumulating about this about half the states i think 26 states turned off that 300 and reduced expanded eligibilityp
pstrongwhen did they do thatstrongp
pin june you could look to see whether or not we have data for july august and september and you can look to see okay in july what does it look like in august did those states that stopped participating did they see employment recover faster and theres some disagreement about this ive done some work on my own on this and it looks to me pretty clear that the states that stopped participating in this program in june really did see transitions from unemployment to employment accelerate that looks especially true if you focus on the leisure and hospitality and retail sectors that are really heavily affected by the pandemicp
pi think theres some mixed evidence on that but in my view the evidence points to unemployment benefits as a real factor in keeping people on the sidelines and i think its hard to make super strong conclusions with just two or three months of data so well have to let some time pass but i think in my view thats pretty clearly where the evidence is pointing right now another important factor is savings the government has given households a lot of moneyp
pstrongthose cash balances have just really exploded i mean theyre up what maybe 50 percentstrongp
pyeah excess savings are 2 trillion or 25 trillion right now throughout the economy and so that is i think making it easier financially for some people to take a little longer searching for a job and to take a little longer reentering the workforcep
pstrongbut those balances are going to be worked down so those people will be coming backstrongp
pfor sure those balances are going to be worked down and thats going to be another factor pushing the labor market toward normalization as we end 2021 and go through 2022p
pstrongso lets go back to the great awakening theory and that is something more systemic lets take the early retirements and set those aside but for the other kinds of workers the people behind the great awakening theory are saying that theyre not going to go back because theyve had this time away and they now realize they hated those jobs theyre wildly underpaid and unless the wage structure of the united states changes so people just pay a lot more for jobs particularly on the low end those people arent going to come back im not sure what theyre going to do but theyre not going to come back to get those labor force participation rates back somewhere close to normal the us has to stop being a lowwage country it has to start being something better than that do you see something like that happeningstrongp
pno i dont and i hope that i dont as well in other words i hope that im right that it isnt happening i think that people make decisions and they take into account all their options and at a time when you could earn more money not working than working which was true for a large share of the workforce over the course of the year going back to a job similar to the one that you used to have doesnt look all that appealing if after your unemployment benefits normalize and after you burn through some of your savings not working is a worse deal then going back to a job that was similar to the job that you used to have all of a sudden becomes more attractivep
pand i think that is going to be a lot of the dynamic that you see if you are a lowwage services worker and lets say youre a single mom going back to work at a time when your phone could ring at any minute and you have to go pick your kid up from school and your kids stuck at home for two weeks then youre worried youre just going to get fired at that point or something that kind of uncertainty in your job security is much more of a drawback at a time when your kids school situation is much more uncertain if we get to a point where parents can really count on school staying open and kids being able to stay in their classrooms then that affects the way that a job looks to you too the job starts to look better as wellp
figure classwpblockimageimg alt srchttpswwwaeiorgwpcontentuploads202111strainlongreadschooljpgx91208 classwpimage1008614065figcaptiona school crossing guard holds a bus as a woman and child cross the street photo by anthony beharsipa usafigcaptionfigure
pi think people over the past several months have been thinking about the jobs that they used to have and there are aspects to those jobs that are unpleasant and that arent attractive but theyre making those evaluations in a context and that context is a pandemic context its a context of schools being uncertain its a context of still being able to get a decent income from not working and i think when that context changes and the context is changing right now and the context will continue to evolve hopefully pretty rapidly over the next several months their assessment of their employment opportunities i suspect will also change and we should hope that it doesp
pone of the interesting economic realities right now is the ability of the economy to produce goods and services without all these workers the level of economic output gdp is back to where it wouldve been if there was never a pandemic and businesses are able to produce goods and services as if there never was a pandemic even though were six or seven million workers in the hole and my concern is that businesses will have figured out how to get by with fewer workersp
pand if there are workers who are lingering on the sidelines because their unemployment benefits were generous or because their kids school cant stay open or because they have so much money in the bank from all the stimulus checks those workers may be lingering and by the time theyre ready to come back labor demand might have cooled off and businesses might say hey we just need fewer workers than we used to need and the jobs that theyre counting on returning to may not be there for all of themp
pstrongand in that kind of situation either these people need to increase their skills so theyre more attractive i imagine that would take some time or what we start paying people a basic income not to work this is the great transition to a basic income because at the same time that youre expressing this concern that these people might not have jobs to go back to if companies figure out they dont need them there are also people pushing for even higher minimum wages they critique the united states economy for being a lowwage economy maybe we need a 20 minimum wage or a 25 minimum wage that would seem to exacerbate the very issue youre worried aboutstrongp
pyeah i think it would think about wages as coming from two places one place that wages come from is from the productivity of workers its kind of a market factor and then another determinative of wages are things like bargaining power the power balance between workers and firms and that sort of stuff if you want wages to go up then you either need to get people more skills so they can be more productive or you need to change the power balance between workers and firms and neither of those things are happening right now youre seeing wages go up because at the macroeconomic level demand is surging and supply cant keep up and that is not increasing worker skills it is tilting the balance of power away from businesses and towards workers but not in a permanent wayp
pthere are no institutional changes in the us economy that are permanently altering that balance its not as if unionization rates are wildly increasing its not as if there are all sorts of new laws being passed that restrict the freedom of businesses to design employment contracts for workers and things of this nature its temporary and as demand moderates which it will over the course of 2022 and as the supply side of the economy is able to expand as it will over the course of 2022 were going to start to look more and more like we used to prior to the pandemic and the power balance between workers and firms is going to normalize as well were going to be left with a workforce that isnt more skilled and dynamics between businesses and workers that look more like they always have nothing thats happening this summer or fall is permanentp
pstrongdo you have a different philosophy of the value of work than some other people as i hear about this great resignation and critiques of the us labor market theres a group out there that doesnt look at work the same way and maybe these are also the people pushing for a universal basic income but there seems to be an actual disagreement about the value of work and whether people should really be forced to work its almost like its a human rights issuestrongp
plook yes i think thats right i mean i think this is one of the big dividing lines in american public life right now the importance of work and the inherent value of work and that is a dividing line that i think has become sharper and more salient as a consequence of the pandemic there are unpleasant jobs in the united states certainly and there are jobs that are physically demanding and that are unpleasant for a myriad of circumstances for sure and there are people in public life who argue thats not a good thing and one of the goals of public policy should be to make it so that people dont have to hold those kinds of jobs if they dont want top
pand i think that view gets some things right we shouldnt want somebody to be in a minimum wage job for 20 years that shouldnt be the goal we shouldnt want people to be stuck in jobs that they dont want to hold another way to say that is that the labor market should be characterized by upward mobility that people can climb a ladder and not just get stuck on one of the rungs but i think that view misses a lot i think it misses a lot about the inherent dignity in all work and about the ability of people to make real contributions to society in all those jobsp
pi think youre right to characterize it as a philosophical disagreement a lot of it is an empirical disagreement as well about the level of upward mobility and about the ability of those sorts of jobs to serve as a conduit to other and better jobs but there is a real philosophical divide here too and in my view the goal of public policy should be participation that people participate in society and that a lot of that participation takes place through participating in market activities through participating in the economy and thats a normative view its a view about what is important to lead a flourishing life and to lead a good life a full life and i think a full life and a flourishing life involves contributionsp
figure classwpblockimageimg alt srchttpswwwaeiorgwpcontentuploads202111strainlongreadjanitorjpgx91208 classwpimage1008614057figcaptionvia twenty20figcaptionfigure
pand i think if youre working a minimum wage job at a grocery store or youre flipping burgers at a mcdonalds or youre a custodian in a hotel or whatever youre making a contribution youre contributing to society through those jobs and i think its unfortunate that there are prominent voices in public life who refer to those kinds of jobs as deadend jobs and who make arguments about how those jobs are beneath the dignity of americans or things of that nature i think thats not true and i think its a bad message to send telling millions of people that their jobs are dead endsp
ptheyre not dead ends theyre making valuable contributions and they can serve as stepping stones to even larger contributions and even better jobs so the goal of public policy shouldnt be to make it so that people dont have to work or to make it so that people dont have to work in lowerwage jobs the goal of public policy should be to get people involved in economic life to set people up so that they can make contributions to society through their employment and through market activities and to build skills and to create onramps of opportunities so that people can have a career and progress up the employment ladder and not get stuck on any one rungp
pstrongmy guest today is michael strain mike thanks for coming back on the podcaststrongp
pthank you its always a pleasurep
p divpstronglearn more stronga hrefhttpswwwaeiorgeconomicsdoesamericaneedmoreplanningmylongreadqawithneilchilsondoes america need more planning my longread qampa with neil chilsona a hrefhttpswwwaeiorgeconomicscangeothermalenergyreplaceoilandgasmylongreadqawithjamiebeardcan geothermal energy replace oil and gas my longread qampa with jamie bearda a hrefhttpswwwaeiorgeconomicsthecomingfusionrevolutionmylongreadqawitharthurturrellthe coming fusion revolution my longread qampa with arthur turrellapdiv br
pthe post a relnofollow hrefhttpswwwaeiorgeconomicsamericaslaborshortageandthegreatresignationmylongreadqawithmichaelstrainamericas labor shortage and the great resignation my longread qampa with michael straina appeared first on a relnofollow hrefhttpswwwaeiorgamerican enterprise institute aeiap | pstrongby james pethokoukis michael strainstrongp pas covid19pandemic drags millions americansare quitting jobs labor market thats short workers great resignation laborforce participation rate hasnt rebounded prepandemic levels supply chain interruptions trillions government stimulus pushing prices find whats going labor market broader american economy ive brought michael strainp pmike arthur f burns scholar political economy director economic policy studies aeip diviframe srchttpsplayercaptivatefmepisodecc3ac7ffdba64ea193247094517e723fiframediv pwhat follows lightly edited transcript conversation download episode hrefhttpswwwaeiorgpodcastmichaelstrainthestateofthelabormarketherea dont forget subscribe podcast hrefhttpspodcastsapplecomuspodcastpoliticaleconomypodcastid589914386mt2itunesa hrefhttpswwwstitchercompodcastricochetmoneypoliticswithjimpethokoukisstitchera tell friends leave reviewp pstrongpethokoukisstrong strongthe unemployment rate falling lots jobs created month people concerned americans coming work ive heard phrase great resignation im sure exactly means people resigning people going work state labor market right nowstrongp pstrain think state labor market confused look indicators labor market thats exceptionally strong great shape tick number unemployed workers job vacancy words vacancies unemployed workers big problem labor market past couple decades opposite jobs available unemployed workersp pwe opposite problem right jobs chasing workers workers chasing jobs record numbers job openings economy record number workers quitting jobs reason quitting considered sign strong labor market people wouldnt voluntarily quit job pretty confident better job job goodp pso fact workers feeling like theyre able quit large numbers suggests upper hand labor market right compellingly strength labor market seen wage growth right wages growing 5 percent annual rate look wages leisure hospitality sector growing 11 percent annual rate rapid wage growth common hear businesses theres labor shortage cant find good workers etc right instinct skeptical claims claims typically occur wage increasesp figure classwpblockimageimg alt srchttpswwwaeiorgwpcontentuploads202111strainlongreadhiringjpgx91208 classwpimage1008614053figcaptiona hiring sign montgomery alabama sept 1 2021 reutersfigcaptionfigure pand typically hear businesses talk labor shortages able find workers mean unable find workers wages currently able offer theyre taking steps able increase wage offerings isnt whats happening seeing businesses money mouths nominal wages growing rapidly points strong labor marketp spanspan pstrongso confusion people unhappy jobs theyre returning jobs described american labor force great awakening strong strongthat theyve discovered jobs terrible dont want confusing factorsstrongp pwell think confusing factor workers arent coming aggressive fashion look workforce participation prime age workers workers old school young retired improvement workforce participation summerp pif look evolved course pandemic workforce participation group workers fell 4 percent lockdowns spring 2020 recovered little 98 percent prepandemic level employment 2 percent group thats basically today source labor shortage surely early retirements youre looking people 30s 40s early 50s thats going big story reasons keeping workers sidelines early retirementp pstrongdoes story youre tell differ skill level education level income level different case lowerwage workers upperwage workers similar storystrongp pyou largely board mean happens job losses recession began concentrated lowerwage workers lowerincome households gains disproportionately workers higher income theyre sensitive business cycle general fundamentally economy workforce participation isnt improving million jobs hole million seven million jobs wouldve werent pandemicp pthis confusing situation hand labor demand white hot employers rapidly raising wages creating job vacancies theyre trying fill time seven million jobs hole workforce participation isnt improving millions people sidelines shouldnt characterize confusingp pstrongwhy arent coming workstrongp pwell think combination factors factors related pandemic sure mean think surveys people worried pandemic dont feel comfortable coming work consequence consistent story year half pretty lockdowns lifted late spring 2020 share population unable work covid dropping theres covid spike like weve delta variant decline suspended people saying oh yeah think covid making hard workp pthere lingering childcare issues sure schools open daycare centers open theyre affected pandemic think parents schoolaged kids experience day certainly kids school likelihood email phone says hey come pick kids hey kids classroom going shut week daily reality thats kind thing people worry pandemic think keeping people reentering workforce think people saying ill work confident im going called home randomly kids classroom going closed downp panother big factor generosity unemployment benefits president biden american rescue plan increased generosity unemployment benefits 300 week average unemployment benefits typically 350 week going 350 650 large increase kept people sidelines program expired month takes people start job search find job think thats factor keeping people sidelinesp pstrongit like month numbers come people look numbers dont detect impact unemployment benefits case wrong arent wrongstrongp plook certainly source controversy let present different buckets evidence sort bucket evidence comes labor market 1970s eve pandemic look studies period theres strong consensus evidence unemployment benefits generous people stay unemployed longer theres debate magnitude effect size effect think thats pretty close consensus viewp pwhen pandemic began cares act signed president trump march 2020 significantly expanded generosity unemployment benefits studies unemployment benefit expansion find led people unemployed longer thats conflict evidence came thatp figure classwpblockimageimg alt srchttpswwwaeiorgwpcontentuploads202111strainlongreadcaresjpgx91208 classwpimage1008614068figcaptionus president donald trump signs cares act oval office white house march 27 2020 reutersjonathan ernstfigcaptionfigure pthe question think effect president bidens 300 expansion kind boils question economy summer fall 2021 economy june july august september october like prepandemic economy like normal economy like economy existed spring summer 2020 initial months pandemic elements dont think theres question view economy closer normal summer fall 2021 pandemic economyp pso expectation relationship unemployment benefits duration unemployment looks lot like half century pandemic looked like 2020 evidence accumulating half states think 26 states turned 300 reduced expanded eligibilityp pstrongwhen thatstrongp pin june look data july august september look okay july look like august states stopped participating employment recover faster theres disagreement ive work looks pretty clear states stopped participating program june transitions unemployment employment accelerate looks especially true focus leisure hospitality retail sectors heavily affected pandemicp pi think theres mixed evidence view evidence points unemployment benefits real factor keeping people sidelines think hard super strong conclusions months data let time pass think view thats pretty clearly evidence pointing right important factor savings government given households lot moneyp pstrongthose cash balances exploded mean theyre maybe 50 percentstrongp pyeah excess savings 2 trillion 25 trillion right economy think making easier financially people little longer searching job little longer reentering workforcep pstrongbut balances going worked people coming backstrongp pfor sure balances going worked thats going factor pushing labor market normalization end 2021 2022p pstrongso lets great awakening theory systemic lets early retirements set aside kinds workers people great awakening theory saying theyre going theyve time away realize hated jobs theyre wildly underpaid wage structure united states changes people pay lot jobs particularly low end people arent going come im sure theyre going theyre going come labor force participation rates close normal stop lowwage country start better like happeningstrongp pno dont hope dont words hope im right isnt happening think people decisions account options time earn money working working true large share workforce course year going job similar doesnt look appealing unemployment benefits normalize burn savings working worse deal going job similar job sudden attractivep pand think going lot dynamic lowwage services worker lets youre single mom going work time phone ring minute pick kid school kids stuck home weeks youre worried youre going fired point kind uncertainty job security drawback time kids school situation uncertain point parents count school staying open kids able stay classrooms affects way job looks job starts look better wellp figure classwpblockimageimg alt srchttpswwwaeiorgwpcontentuploads202111strainlongreadschooljpgx91208 classwpimage1008614065figcaptiona school crossing guard holds bus woman child cross street photo anthony beharsipa usafigcaptionfigure pi think people past months thinking jobs aspects jobs unpleasant arent attractive theyre making evaluations context context pandemic context context schools uncertain context able decent income working think context changes context changing right context continue evolve hopefully pretty rapidly months assessment employment opportunities suspect change hope doesp pone interesting economic realities right ability economy produce goods services workers level economic output gdp wouldve pandemic businesses able produce goods services pandemic seven million workers hole concern businesses figured fewer workersp pand workers lingering sidelines unemployment benefits generous kids school cant stay open money bank stimulus checks workers lingering time theyre ready come labor demand cooled businesses hey need fewer workers need jobs theyre counting returning themp pstrongand kind situation people need increase skills theyre attractive imagine time start paying people basic income work great transition basic income time youre expressing concern people jobs companies figure dont need people pushing higher minimum wages critique united states economy lowwage economy maybe need 20 minimum wage 25 minimum wage exacerbate issue youre worried aboutstrongp pyeah think think wages coming places place wages come productivity workers kind market factor determinative wages things like bargaining power power balance workers firms sort stuff want wages need people skills productive need change power balance workers firms things happening right youre seeing wages macroeconomic level demand surging supply cant increasing worker skills tilting balance power away businesses workers permanent wayp pthere institutional changes economy permanently altering balance unionization rates wildly increasing sorts new laws passed restrict freedom businesses design employment contracts workers things nature temporary demand moderates course 2022 supply economy able expand course 2022 going start look like prior pandemic power balance workers firms going normalize going left workforce isnt skilled dynamics businesses workers look like thats happening summer fall permanentp pstrongdo different philosophy value work people hear great resignation critiques labor market theres group doesnt look work way maybe people pushing universal basic income actual disagreement value work people forced work like human rights issuestrongp plook yes think thats right mean think big dividing lines american public life right importance work inherent value work dividing line think sharper salient consequence pandemic unpleasant jobs united states certainly jobs physically demanding unpleasant myriad circumstances sure people public life argue thats good thing goals public policy people dont hold kinds jobs dont want pand think view gets things right shouldnt want somebody minimum wage job 20 years shouldnt goal shouldnt want people stuck jobs dont want hold way labor market characterized upward mobility people climb ladder stuck rungs think view misses lot think misses lot inherent dignity work ability people real contributions society jobsp pi think youre right characterize philosophical disagreement lot empirical disagreement level upward mobility ability sorts jobs serve conduit better jobs real philosophical divide view goal public policy participation people participate society lot participation takes place participating market activities participating economy thats normative view view important lead flourishing life lead good life life think life flourishing life involves contributionsp figure classwpblockimageimg alt srchttpswwwaeiorgwpcontentuploads202111strainlongreadjanitorjpgx91208 classwpimage1008614057figcaptionvia twenty20figcaptionfigure pand think youre working minimum wage job grocery store youre flipping burgers mcdonalds youre custodian hotel youre making contribution youre contributing society jobs think unfortunate prominent voices public life refer kinds jobs deadend jobs arguments jobs beneath dignity americans things nature think thats true think bad message send telling millions people jobs dead endsp ptheyre dead ends theyre making valuable contributions serve stepping stones larger contributions better jobs goal public policy shouldnt people dont work people dont work lowerwage jobs goal public policy people involved economic life set people contributions society employment market activities build skills create onramps opportunities people career progress employment ladder stuck rungp pstrongmy guest today michael strain mike thanks coming podcaststrongp pthank pleasurep p divpstronglearn stronga hrefhttpswwwaeiorgeconomicsdoesamericaneedmoreplanningmylongreadqawithneilchilsondoes america need planning longread qampa neil chilsona hrefhttpswwwaeiorgeconomicscangeothermalenergyreplaceoilandgasmylongreadqawithjamiebeardcan geothermal energy replace oil gas longread qampa jamie bearda hrefhttpswwwaeiorgeconomicsthecomingfusionrevolutionmylongreadqawitharthurturrellthe coming fusion revolution longread qampa arthur turrellapdiv br pthe post relnofollow hrefhttpswwwaeiorgeconomicsamericaslaborshortageandthegreatresignationmylongreadqawithmichaelstrainamericas labor shortage great resignation longread qampa michael straina appeared relnofollow hrefhttpswwwaeiorgamerican enterprise institute aeiap |
61806ba853f78f470bd63fd3 | *Apprentice to Genius* | pan excellent book the author is robert kanigel and the subtitle is a relnoopener hrefhttpswwwamazoncomapprenticegeniusmakingscientificdynastydp0801847575refsr_1_4dchild1keywordsrobertkanigelqid1635689918qsid14214283993463341sr84sres05255209452c08018475752c14767634962cb01mu69jxl2cb0050diwfw2c02626120622cb003wea3mg2c03458033372cb01k3rt34s2c08018733042c03168549562c03091023672cb0001pg48g2cb01focs9382cb005v3phww2c3322832074srptabis_book target_blankthe making of a scientific dynastya it is strongest on the role of mentors and lineages in scientific excellence the radically inegalitarian and unfair nature of scientific achievement and also credit and it offers an interesting look at the early days of the nih here is one excerptp
blockquotepbut brodie simply saw no reason to become an expert in an area to launch a study of it rather as sid udenfriend says he would just wander into a new field and make advances that people fifteen years in the field couldnt poring through scientific journals didnt appeal to him picking the brains of colleagues did hed go up to you jack orloff remembers and say tell me what you know about x and y sometimes hed already know a lot but he could come across as almost stupid indeed he could seem downright ignorant asking disarmingly simple even hopelessly naive questions like a child but as one admirer notes hed end up asking just the questions you should have asked ten years agopblockquote
pandp
blockquotepbeginning around 1955 the big stir at lcp was over serotonin when the experiments were good we called it seroemtoninem brodie would later recallwhen i heard it pronounced seemroemtonin i knew the experiments were bad and i stayed homepblockquote
pandp
blockquotepmartin zatz a veteran of julius axelrods lab and a scientist with an uncommonly broad cast of mind was talking about mentoring and its role in science are you going to talk about the emdisadvantageem of the mentor chain he asked me smiling broadlyp
pwhats that that you dont get anywhere he replied now quite serious unless youre in onepblockquote
precommended why are there not more excellent conceptual books on the history of sciencep
pthe post a relnofollow hrefhttpmarginalrevolutioncommarginalrevolution202111apprenticetogeniushtmlapprentice to geniusa appeared first on a relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap | pan excellent book author robert kanigel subtitle relnoopener hrefhttpswwwamazoncomapprenticegeniusmakingscientificdynastydp0801847575refsr_1_4dchild1keywordsrobertkanigelqid1635689918qsid14214283993463341sr84sres05255209452c08018475752c14767634962cb01mu69jxl2cb0050diwfw2c02626120622cb003wea3mg2c03458033372cb01k3rt34s2c08018733042c03168549562c03091023672cb0001pg48g2cb01focs9382cb005v3phww2c3322832074srptabis_book target_blankthe making scientific dynastya strongest role mentors lineages scientific excellence radically inegalitarian unfair nature scientific achievement credit offers interesting look early days nih excerptp blockquotepbut brodie simply saw reason expert area launch study sid udenfriend says wander new field advances people years field couldnt poring scientific journals didnt appeal picking brains colleagues hed jack orloff remembers tell know x y hed know lot come stupid downright ignorant asking disarmingly simple hopelessly naive questions like child admirer notes hed end asking questions asked years agopblockquote pandp blockquotepbeginning 1955 big stir lcp serotonin experiments good called seroemtoninem brodie later recallwhen heard pronounced seemroemtonin knew experiments bad stayed homepblockquote pandp blockquotepmartin zatz veteran julius axelrods lab scientist uncommonly broad cast mind talking mentoring role science going talk emdisadvantageem mentor chain asked smiling broadlyp pwhats dont replied youre onepblockquote precommended excellent conceptual books history sciencep pthe post relnofollow hrefhttpmarginalrevolutioncommarginalrevolution202111apprenticetogeniushtmlapprentice geniusa appeared relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap |
61806c7d53f78f470bd63ff7 | Academic Freedom Alliance Letter on the University of Florida Situation | pthe a hrefhttpsacademicfreedomorgacademic freedom alliancea has released its a hrefhttpsacademicfreedomorgafadenouncesuniversityoffloridaforblockingprofessorsfromservingaswitnessesincaseagainstthestatepublic lettera on the situation at the a hrefhttpswwwnytimescom20211029usfloridaprofessorsvotingrightslawsuithtmluniversity of floridaa the administration of the university of florida has attempted to block three political science professors from serving as expert witnesses in a lawsuit against the state over the recently enacted voting law as discussed by coblogger eugene volokh a hrefhttpsreasoncomvolokh20211031univoffloridablocksprofessorsexpertwitnessworkincaseagainstfloridagovernmentherea this is an egregious violation of academic freedom and the first amendment if accepted in this case it would have broad ramifications for how state universities operated across a host of other casesp
pfrom the letterp
blockquotepi write on behalf of the academic freedom alliance to express our firm view that this decision is a serious violation of the academic freedom principles to which the university of florida is committed the university is mistaken in thinking that this decision is consistent with the principles of free speech and academic freedom and has construed the potential conflicts of interest in this case in a manner that is incompatible with maintaining academic freedom in the future it has long been a central feature of academic freedom in the united states that when university professors quota hrefhttpswwwaauporgreport1940statementprinciplesacademicfreedomandtenurespeak or write as citizensa they should be free from institutional censorship or disciplinequot whatever interest a state university might have in preventing members of its faculty from acting as political partisans when operating within their duties as state employees that interest cannot be understood to extend to restricting the speech activities in which professors might engage when operating outside their university duties and acting as private citizenspblockquote
pa hrefhttpsacademicfreedomorgwpcontentuploads202111afalettertoufonexperttestimonyprohibitionpdfyou can read the full letter hereap | pthe hrefhttpsacademicfreedomorgacademic freedom alliancea released hrefhttpsacademicfreedomorgafadenouncesuniversityoffloridaforblockingprofessorsfromservingaswitnessesincaseagainstthestatepublic lettera situation hrefhttpswwwnytimescom20211029usfloridaprofessorsvotingrightslawsuithtmluniversity floridaa administration university florida attempted block political science professors serving expert witnesses lawsuit state recently enacted voting law discussed coblogger eugene volokh hrefhttpsreasoncomvolokh20211031univoffloridablocksprofessorsexpertwitnessworkincaseagainstfloridagovernmentherea egregious violation academic freedom amendment accepted case broad ramifications state universities operated host casesp pfrom letterp blockquotepi write behalf academic freedom alliance express firm view decision violation academic freedom principles university florida committed university mistaken thinking decision consistent principles free speech academic freedom construed potential conflicts interest case manner incompatible maintaining academic freedom future long central feature academic freedom united states university professors quota hrefhttpswwwaauporgreport1940statementprinciplesacademicfreedomandtenurespeak write citizensa free institutional censorship disciplinequot interest state university preventing members faculty acting political partisans operating duties state employees interest understood extend restricting speech activities professors engage operating outside university duties acting private citizenspblockquote pa hrefhttpsacademicfreedomorgwpcontentuploads202111afalettertoufonexperttestimonyprohibitionpdfyou read letter hereap |
6181bc8049dac1a54d9f54fa | There’s “Regulation” and Then There’s “Regulation” | pwriting on his substack noahpinion noah smith a hrefhttpsnoahpinionsubstackcompbewareshovelingmoneyatoverpricedoffers some opinionsa about the paper a hrefhttpswwwniskanencenterorgcostdiseasesocialismhowsubsidizingcostswhilerestrictingsupplydrivesamericasfiscalimbalancecost disease socialisma i coauthored with samuel hammond and steven teles hes got some nice things to say about the paper especially the general framing he makes some criticisms too arguing that we place too much emphasis on regulation as a driver of cost driver for key goods notably health carep
blockquote classwpblockquotepthere are some big problems with the niskanen thesis in particular its explanation for why costs are already too high in construction a hrefhttpswwwbrookingseduwpcontentuploads201908wp54_brooksliscow_updatedpdfthere is good evidencea that regulation especially rules allowing nimbys to block new projects is a major source of excess cost regulation especially rules mandating very low childtoworker ratios might be a hrefhttpswwwtheatlanticcomideasarchive201911whychildcaresoexpensive602599the issue in child carea as wellppin health care meanwhile strongits obvious that in countries where medical services are much cheaper ie every single other rich country health care is stronga hrefhttpswwwcommonwealthfundorginternationalhealthpolicycentersystemprofilesstrongemmoreem regulated than in the united statesstrongastrongstrong in fact price controls of one sort or another are a very common feature of other health systems and are a hrefhttpswwwinvestopediacomarticlespersonalfinance0806156reasonshealthcaresoexpensiveusaspcommonly citeda as a factor that holds down costs strongits easy to identify individual regulations that increase the cost of individual medical services but stronga hrefhttpswwwhsphharvardedunewshsphinthenewsunderstandingwhyhealthcarecostsintheusaresohighstrongeconomistsstrongastrong who stronga hrefhttpshealthcarepricingprojectorgstrongstudy the reasonsstrongastrong for excessive health costs rarely point the finger at regulation as a big overall driver [italics in original bold emphasis added]strongppso niskanens diagnosis for the existing cost problem is highly incomplete and needs a lot of work especially when it comes to health care and higher edpblockquote
psmiths point is valuable in the abstract certain interventions emcanem bring down prices but his critique is wrong not only because the notion that health care is emmoreem regulated in other developed countries is debatable at best but because his argument in the above quotation implicitly though probably not intentionally embraces a more versus less framing of the issue of regulation its far more productive to examine which regulations are better or worse though determining which rules are more or less restrictive is often a valuable exercise his framing of the issue ironically embraces the socalled market fundamentalist view in which all regulations are an intrusion on the liberty to truck and barter even if he comes out on the other side in the economic sectors our paper focuses on the most urgent need is to lift counterproductive regulations but this does not mean we embrace a slashandburn approach to deregulate across the board our interest is in whether a particular regulation is fixing or exacerbating inequality and lack of access not whether it would imply more or less regulation we dont discuss markets that are worse embecauseem theyre more regulated we discuss markets that are worse emand happen to beem more regulatedp
pone of my objections to market fundamentalism of the snakehandling variety is the tendency to shout regulation whenever the price of this or that good or service is too high or access is too low the dose makes the poison and how you determine if a given market is more or less regulated than another is subjective this more or less framing also makes it possible to skirt the issue of whether or not a given rule or regulatory regime is better or worse than the alternative in other words questions about over or underregulation tend to distract from the oftenmorerelevant discussion of emmisemregulation p
pon some issues a consensus can emerge on which rules are more burdensome than others and which sectors are more regulated for example a regime that requires a license to practice a particular trade is more regulated than one which doesnt p
pbut things get more complicated very quickly looking at the a hrefhttpscapturedeconomycomtheinvertedpyramid10lessrestrictivealternativestooccupationallicensinginstitute for justices inverted pyramida of labor market regulations we see that they rank private causes of action as an option less restrictive than inspections and both of those are less burdensome than mandatory bonding this ranking is generally fine as a rule of thumb but what if youre bob belcher and have to deal with a hrefhttpsbobsburgersfandomcomwikihugo_habercorea health inspectora with an axe to grind but your liability insurance provider charges low premiums because youre a reputable establishment what if your health inspections are infrequent and painless but a hrefhttpswwwyoutubecomwatchv1t0kietnbkqsaul goodman comes forward with a crop of customersa who mysteriously complain that their finger food actually contains fingersp
pall of this is to say that while there are some clearcut cases when calling this or that market more or less regulated its generally more useful to analyze whether a given regulatory regime is better or worse regulated not only in the outcomes it produces but in the degrees of freedom available to private parties smith partly saves himself by adding the qualifier that [i]ts easy to identify individual regulations take for example a hrefhttpswwwcbsnewscomnewsathomecovidtestsareafreeeasypartofeverydaylifeintheukandtheushastakennotethe us versus european policy related to athome covid testsa but its not at all clear to me that the dynamic he identifies is obvious and smith needs to do more work if he wants to italicize emmore emp
pbeginning with the only example cited we have what appears to be a clear instance where other developed nations more heavily regulate their health care markets than the united states drug price negotiation theres really no argument that this in isolation is a more heavyhanded approach than what happens in the us but we need to take a broader view there are many contributors to high drug prices and if we really want to look at all the ways the prescription drug market is regulated we cant avoid discussions of intellectual propertyp
pall developed nations have patent systems that are broadly similar to americas in providing regulatory subsidies to patent holders in the form of temporary exclusivity but patents are often overlooked as a type of regulation thanks to a a hrefhttpswwwniskanencenterorgnewpaperwhyintellectualpropertyisamisnomertexte2809cintellectual20propertye2809d20is20a20misleadingthat20simply20does20not20existamptextthe20mere20fact20that20thedoes20not20prove20that20caserobust and wellargued but ultimately unconvincing body of work which categorizes them as private propertya a cornerstone of the free market system rather than a hrefhttpswwwsupremecourtgovopinions17pdf16712_87adpdfas public franchisesa intellectual property is the employer exclusion of innovation policy a feature of the a hrefhttpspressuchicagoeduucpbooksbookchicagosbo12244559htmlsubmerged statea that veils itself by operating indirectly through an incentive[] subsid[y] or payment[] to private organizations or households to encourage or reimburse them for conducting activities deemed to serve a public purposep
pthe generic drug industry isnt perfect but a little entry a hrefhttpswwwfdagovaboutfdacenterdrugevaluationandresearchcdergenericcompetitionanddrugpricesgoes a long way to bring down drug pricesa in the absence of generic entry negotiation is one way to bring down prices however such prices are emthemselvesem the product of a regulatory subsidy given to private parties to generate new drugs there are plenty of critiques to be made of the current patent system a hrefhttpscapturedeconomycomlotstolovethebidencompetitionexecutiveorderonintellectualpropertyand no shortage of good ideas on how to fix ita and the us a hrefhttpsdigitalcommonslawyaleeduyjoltvol18iss17hasa a hrefhttpswwwwashingtonpostcompolitics20210908claimthatusgovernmentalreadyhaspowerlowerdrugpricestoolsa to soften patent laws sharp edges mainly in the form of compulsory licenses to limit the effects of regulatory exclusivity and enhance market competition but if we view it as more or fewer rules these are addons just like drug price negotiation isp
phow should we view a regime that checks the excesses of rules by stacking on more rules though a code of federal regulations with text to limit the effect of other regulations will be longer than one without it it doesnt make sense to call the former more regulated than the latter when the copyright office announces a hrefhttpswwwgovinfogovcontentpkgfr20181026pdf201823241pdfnew exemptions to the anticircumvention provisions of the dmcaa the law becomes more complicated but also more liberalp
pto use an even more relevant example from the world of occupational licensing look to a hrefhttpswwwsupremecourtgovopinions14pdf13534_19m2pdfemnorth carolina dental examiners v ftcemaem emwhere a 63 supreme court ruled that stateaction immunity from federal antitrust enforcement did not apply because a controlling number of the boards decision makers [were] active market participants in the occupation the board regulates the court explained the board can invoke stateaction antitrust immunity only if it was subject to active supervision by the state a hrefhttpscapturedeconwpenginecomoccupationallicensingreformacrosstheunitedstatesa number of states in recent yearsa have enacted laws requiring state supervision of licensing boardsp
pin this case we have state governments stepping in to check the excesses of quasiprivate boards that themselves control competition in the market by acting as gatekeepers to enforce regulations crafted by the state these reforms are praised by free marketeers as they should be even though they involve more government intervention and add complexity to labor market regulations if were willing to call a licensing board supervised by the state a lessregulated regime than a licensing board free of supervision its tough to see why we shouldnt call a regime of negotiated drug prices less regulated than one where pharma companies name their pricep
pthats all a very long way of saying that smith mischaracterizes our position when he casts us as hostile toward regulation of health care in general and oversimplifies the relationship between regulations and markets when he calls other systems more regulated than the us the other side of this coin is that in many ways the market for health care delivery is much more free in europe than in the united statesp
pthe ability to travel and receive medical treatments in another eu country is one area where our friends across the pond are able to cut costs by cutting regulations on human movement a hrefhttpseuropaeuyoureuropecitizenshealthplannedhealthcareindex_enhtmterms and conditions applya and a belgian traveling to get surgery in the czech republic jumps through more hoops than if he were going to be treated in thailand but it is absolutely an example of a laxer regulatory regime which the us would benefit fromp
pdean baker explored this issue sometimes called medical tourism in a hrefhttpscapturedeconomycomeightmarketorientedproposalsthatreduceincomeinequalitya 2017 paper for the american enterprise institutea using hip replacement knee replacement bypass surgery and angioplasty as examples and data on the number of procedures performed in 2010 he found that even modest uptake of medical travel with reimbursement would save consumers and taxpayers over 10 billion annually there are numerous details that would need to be worked out for a robust regime of medical travel to be established in the united states but considering the differential between the costs of treatment in countries like spain or argentina and the us there are significant savings to be foundp
pmobility and jurisdictional recognition of licensing is another case where europe has a leg up on the us while progress is being made in america the practice of medicine across jurisdictions is governed by a patchwork of inconsistent state regimes in the eu a hrefhttpswwwncbinlmnihgovpmcarticlespmc4952532full reciprocity has been policy for yearsap
pbeyond emwhereem health care practitioners can ply their trade the eus system is also far more rational when examining what they have to do to practice in addition to subjecting more professions within the health care system a hrefhttpswwwniskanencenterorgopedtoolittlefortoomuchin generala to licensing the united states throttled the number of residency slots for physicians decades ago and we have a hrefhttpswwwniskanencenterorgwpcontentuploads202109unmatchedrepairingtheusresidencypipelinepdfyet to recover from the effects of this policya it also takes about as much education to become a specialist in the eu as it does to become a physician of any kind in the usp
pthe costs of the regulations that the united states imposes but peer nations avoid or limit are major drivers of americas skyhigh health care prices this of course is not to dismiss the desperate need for a comprehensive universal coverage regime in the us the need for aggressive antitrust enforcement against hospital consolidation and other areas where state intervention could go a long way to bring down costs to taxpayers insurers and those paying outofpocket theres a reasonable debate to be had over whether or not an america with a health care system comparable to those in similar nations would be more or less regulated than the one we have now but it would be a debate not a blowout more importantly we should think about regulatory reform in health care like a good doctor the question is not whether your patient needs more treatment or less the question is how you diagnose the disease and what interventions are necessary to fix itp
pphoto a relnoreferrer noopener hrefhttpswwwistockphotocomphotomedicalcaduceussymbolasscaleswithbacklightoverwallgm640025558115701401 target_blankdoomu via istockap
pthe post a relnofollow hrefhttpswwwniskanencenterorgtheresregulationandthentheresregulationtheres regulation and then theres regulationa appeared first on a relnofollow hrefhttpswwwniskanencenterorgniskanen centerap | pwriting substack noahpinion noah smith hrefhttpsnoahpinionsubstackcompbewareshovelingmoneyatoverpricedoffers opinionsa paper hrefhttpswwwniskanencenterorgcostdiseasesocialismhowsubsidizingcostswhilerestrictingsupplydrivesamericasfiscalimbalancecost disease socialisma coauthored samuel hammond steven teles hes got nice things paper especially general framing makes criticisms arguing place emphasis regulation driver cost driver key goods notably health carep blockquote classwpblockquotepthere big problems niskanen thesis particular explanation costs high construction hrefhttpswwwbrookingseduwpcontentuploads201908wp54_brooksliscow_updatedpdfthere good evidencea regulation especially rules allowing nimbys block new projects major source excess cost regulation especially rules mandating low childtoworker ratios hrefhttpswwwtheatlanticcomideasarchive201911whychildcaresoexpensive602599the issue child carea wellppin health care strongits obvious countries medical services cheaper ie single rich country health care stronga hrefhttpswwwcommonwealthfundorginternationalhealthpolicycentersystemprofilesstrongemmoreem regulated united statesstrongastrongstrong fact price controls sort common feature health systems hrefhttpswwwinvestopediacomarticlespersonalfinance0806156reasonshealthcaresoexpensiveusaspcommonly citeda factor holds costs strongits easy identify individual regulations increase cost individual medical services stronga hrefhttpswwwhsphharvardedunewshsphinthenewsunderstandingwhyhealthcarecostsintheusaresohighstrongeconomistsstrongastrong stronga hrefhttpshealthcarepricingprojectorgstrongstudy reasonsstrongastrong excessive health costs rarely point finger regulation big overall driver [italics original bold emphasis added]strongppso niskanens diagnosis existing cost problem highly incomplete needs lot work especially comes health care higher edpblockquote psmiths point valuable abstract certain interventions emcanem bring prices critique wrong notion health care emmoreem regulated developed countries debatable best argument quotation implicitly probably intentionally embraces versus framing issue regulation far productive examine regulations better worse determining rules restrictive valuable exercise framing issue ironically embraces socalled market fundamentalist view regulations intrusion liberty truck barter comes economic sectors paper focuses urgent need lift counterproductive regulations mean embrace slashandburn approach deregulate board interest particular regulation fixing exacerbating inequality lack access imply regulation dont discuss markets worse embecauseem theyre regulated discuss markets worse emand happen beem regulatedp pone objections market fundamentalism snakehandling variety tendency shout regulation price good service high access low dose makes poison determine given market regulated subjective framing makes possible skirt issue given rule regulatory regime better worse alternative words questions underregulation tend distract oftenmorerelevant discussion emmisemregulationp pon issues consensus emerge rules burdensome sectors regulated example regime requires license practice particular trade regulated doesntp pbut things complicated quickly looking hrefhttpscapturedeconomycomtheinvertedpyramid10lessrestrictivealternativestooccupationallicensinginstitute justices inverted pyramida labor market regulations rank private causes action option restrictive inspections burdensome mandatory bonding ranking generally fine rule thumb youre bob belcher deal hrefhttpsbobsburgersfandomcomwikihugo_habercorea health inspectora axe grind liability insurance provider charges low premiums youre reputable establishment health inspections infrequent painless hrefhttpswwwyoutubecomwatchv1t0kietnbkqsaul goodman comes forward crop customersa mysteriously complain finger food actually contains fingersp pall clearcut cases calling market regulated generally useful analyze given regulatory regime better worse regulated outcomes produces degrees freedom available private parties smith partly saves adding qualifier [i]ts easy identify individual regulations example hrefhttpswwwcbsnewscomnewsathomecovidtestsareafreeeasypartofeverydaylifeintheukandtheushastakennotethe versus european policy related athome covid testsa clear dynamic identifies obvious smith needs work wants italicize emmoreemp pbeginning example cited appears clear instance developed nations heavily regulate health care markets united states drug price negotiation theres argument isolation heavyhanded approach happens need broader view contributors high drug prices want look ways prescription drug market regulated cant avoid discussions intellectual propertyp pall developed nations patent systems broadly similar americas providing regulatory subsidies patent holders form temporary exclusivity patents overlooked type regulation thanks hrefhttpswwwniskanencenterorgnewpaperwhyintellectualpropertyisamisnomertexte2809cintellectual20propertye2809d20is20a20misleadingthat20simply20does20not20existamptextthe20mere20fact20that20thedoes20not20prove20that20caserobust wellargued ultimately unconvincing body work categorizes private propertya cornerstone free market system hrefhttpswwwsupremecourtgovopinions17pdf16712_87adpdfas public franchisesa intellectual property employer exclusion innovation policy feature hrefhttpspressuchicagoeduucpbooksbookchicagosbo12244559htmlsubmerged statea veils operating indirectly incentive[] subsid[y] payment[] private organizations households encourage reimburse conducting activities deemed serve public purposep pthe generic drug industry isnt perfect little entry hrefhttpswwwfdagovaboutfdacenterdrugevaluationandresearchcdergenericcompetitionanddrugpricesgoes long way bring drug pricesa absence generic entry negotiation way bring prices prices emthemselvesem product regulatory subsidy given private parties generate new drugs plenty critiques current patent system hrefhttpscapturedeconomycomlotstolovethebidencompetitionexecutiveorderonintellectualpropertyand shortage good ideas fix ita hrefhttpsdigitalcommonslawyaleeduyjoltvol18iss17hasa hrefhttpswwwwashingtonpostcompolitics20210908claimthatusgovernmentalreadyhaspowerlowerdrugpricestoolsa soften patent laws sharp edges mainly form compulsory licenses limit effects regulatory exclusivity enhance market competition view fewer rules addons like drug price negotiation isp phow view regime checks excesses rules stacking rules code federal regulations text limit effect regulations longer doesnt sense regulated copyright office announces hrefhttpswwwgovinfogovcontentpkgfr20181026pdf201823241pdfnew exemptions anticircumvention provisions dmcaa law complicated liberalp pto use relevant example world occupational licensing look hrefhttpswwwsupremecourtgovopinions14pdf13534_19m2pdfemnorth carolina dental examiners v ftcemaem emwhere 63 supreme court ruled stateaction immunity federal antitrust enforcement apply controlling number boards decision makers [were] active market participants occupation board regulates court explained board invoke stateaction antitrust immunity subject active supervision state hrefhttpscapturedeconwpenginecomoccupationallicensingreformacrosstheunitedstatesa number states recent yearsa enacted laws requiring state supervision licensing boardsp pin case state governments stepping check excesses quasiprivate boards control competition market acting gatekeepers enforce regulations crafted state reforms praised free marketeers involve government intervention add complexity labor market regulations willing licensing board supervised state lessregulated regime licensing board free supervision tough shouldnt regime negotiated drug prices regulated pharma companies pricep pthats long way saying smith mischaracterizes position casts hostile regulation health care general oversimplifies relationship regulations markets calls systems regulated coin ways market health care delivery free europe united statesp pthe ability travel receive medical treatments eu country area friends pond able cut costs cutting regulations human movement hrefhttpseuropaeuyoureuropecitizenshealthplannedhealthcareindex_enhtmterms conditions applya belgian traveling surgery czech republic jumps hoops going treated thailand absolutely example laxer regulatory regime benefit fromp pdean baker explored issue called medical tourism hrefhttpscapturedeconomycomeightmarketorientedproposalsthatreduceincomeinequalitya 2017 paper american enterprise institutea hip replacement knee replacement bypass surgery angioplasty examples data number procedures performed 2010 found modest uptake medical travel reimbursement save consumers taxpayers 10 billion annually numerous details need worked robust regime medical travel established united states considering differential costs treatment countries like spain argentina significant savings foundp pmobility jurisdictional recognition licensing case europe leg progress america practice medicine jurisdictions governed patchwork inconsistent state regimes eu hrefhttpswwwncbinlmnihgovpmcarticlespmc4952532full reciprocity policy yearsap pbeyond emwhereem health care practitioners ply trade eus system far rational examining practice addition subjecting professions health care system hrefhttpswwwniskanencenterorgopedtoolittlefortoomuchin generala licensing united states throttled number residency slots physicians decades ago hrefhttpswwwniskanencenterorgwpcontentuploads202109unmatchedrepairingtheusresidencypipelinepdfyet recover effects policya takes education specialist eu physician kind usp pthe costs regulations united states imposes peer nations avoid limit major drivers americas skyhigh health care prices course dismiss desperate need comprehensive universal coverage regime need aggressive antitrust enforcement hospital consolidation areas state intervention long way bring costs taxpayers insurers paying outofpocket theres reasonable debate america health care system comparable similar nations regulated debate blowout importantly think regulatory reform health care like good doctor question patient needs treatment question diagnose disease interventions necessary fix itp pphoto relnoreferrer noopener hrefhttpswwwistockphotocomphotomedicalcaduceussymbolasscaleswithbacklightoverwallgm640025558115701401 target_blankdoomu istockap pthe post relnofollow hrefhttpswwwniskanencenterorgtheresregulationandthentheresregulationtheres regulation theres regulationa appeared relnofollow hrefhttpswwwniskanencenterorgniskanen centerap |
6181bcb049dac1a54d9f5508 | 5 questions for Michael Strain on the labor market | pstrongby james pethokoukis and michael strainstrongp
psince the economic downturn of the covid19 pandemic production has rebounded to prepandemic trends but the effects of the pandemic are ongoing in the us labor market with stagnant labor force participation rates and a shortage of workers to fill vacant positions michael strain joined a recent episode of political economy to explain whats going onp
pmike is the arthur f burns scholar in political economy and the director of economic policy studies at aeip
diviframe srchttpsplayercaptivatefmepisodecc3ac7ffdba64ea193247094517e723fiframediv
pbelow is an abbreviated transcript of our conversation you can read our full discussion a hrefhttpswwwaeiorgeconomicsamericaslaborshortageandthegreatresignationmylongreadqawithmichaelstrainherea you can also subscribe to my podcast on a hrefhttpspodcastsapplecomuspodcastpoliticaleconomywithjimpethokoukisid589914386apple podcastsa or a hrefhttpswwwstitchercompodcastricochetmoneypoliticswithjimpethokoukisstitchera or download the podcast on a hrefhttpsricochetcomseriespoliticaleconomyjamespethokoukisricochetap
pstrongpethokoukis what is the state of the labor market right nowstrongp
pstrain if you look at some indicators you see a labor market thats in great shape there are more vacancies than there are unemployed workers a big problem that the us labor market has had in the past couple of decades has been the opposite now jobs are chasing workers workers are not chasing jobs people wouldnt voluntarily quit their job unless they were pretty confident they could get a better job or at least the job that was at least as good nominal wages are growing really rapidly so all of that really points to a very strong labor marketp
plabor demand is white hot employers are rapidly raising wages and creating job vacancies that theyre trying to fill at the same time were six or seven million jobs in the hole workforce participation isnt really improving and we have millions of people on the sidelines who shouldnt be therep
figure classwpblockimageimg alt srchttpswwwaeiorgwpcontentuploads202111strain5qshiringjpgx91208 classwpimage1008614111figcaptiona sign in augusta maine advertises job openings amid the shortage in labor due to the covid19 pandemic photo by samuel rigelhaupt sipa usafigcaptionfigure
pstrongwhy arent they coming back to workstrongp
pwell i think its a combination of factors some people are still worried about the pandemic and dont feel comfortable coming back to work as a consequence of that schools are open for the most part daycare centers are open for the most part but theyre still really affected by the pandemic the likelihood that we might get an email or a phone call that says hey your kids classroom is going to be shut down for a week or two is a daily reality for us and thats just not the kind of thing that people had to worry about before the pandemic and i think that is keeping some people from reentering the workforcep
panother big factor is the generosity of unemployment benefits president biden as part of the american rescue plan increased the generosity of unemployment benefits by 300 a week on average unemployment benefits are typically about 350 a week so going from 350 to 650 is a really large increase and that has kept people on the sidelines that program expired last month but it takes people a while to start their job search and to find a job and so i think thats another factor keeping people on the sidelinesp
pstrongsome people are saying workers are not going to go back because theyve had this time away and they now realize they hated those jobs those people arent going to come back unless the wage structure of the united states changes do you see something like that happeningstrongp
pno i dont and i hope that isnt happening i think people have been thinking about the jobs that they used to have but theyre making those evaluations in a pandemic context its a context of schools being uncertain its a context of still being able to get a decent income from not working as that context changes their assessment of their employment opportunities i suspect will also change and we should hope that it doesp
pbusinesses are able to produce goods and services as if there never were a pandemic even though were six or 7 million workers in the hole and my concern is that businesses will have figured out how to get by with fewer workers by the time workers are ready to come back labor demand might have cooled off and businesses might say hey we just need fewer workers than we used to need and the jobs that theyre counting on returning to may not be there for all of themp
pstrongand in that kind of situation either these people need to increase their skills so theyre more attractive or what we start paying people a basic income not to workstrong strongis this a permanent shiftstrongp
pright now wages are growing at about a 5 percent annual rate one place that wages come from is from the productivity of workers and then another determinative of wages are things like bargaining power the power balance between workers and firms youre seeing wages go up because at the macroeconomic level demand is surging and supply cant keep up and that is not increasing worker skills it is tilting the balance of power away from businesses and towards workersp
pbut there are no institutional changes in the us economy that are permanently altering that balance its not as if unionization rates are wildly increasing or its not as if there are all sorts of new laws being passed as demand moderates and as the supply side of the economy is able to expand were going to start to look more and more like we used to prior to the pandemic and the power balance between workers and firms is going to normalize as well were going to be left with a workforce that isnt more skilled and dynamics between businesses and workers that look more like they always have nothing thats happening this summer or fall is permanentp
pstrongas i hear about this great resignation and critiques of the us labor market there seems to be an actual disagreement of the value of work do you have a different philosophy of the value of work than some other peoplestrongp
pthere are jobs that are physically demanding and that are unpleasant for a myriad of circumstances for sure and there are people in public life who argue that thats not a good thing and i think that their view gets some things right the labor market should be characterized by upward mobility that people can climb a ladder and not just get stuck on one of the rungs but i think that view misses a lot about the inherent dignity in all work and about the ability of people to make real contributions to society in all those jobsp
pi think its unfortunate that there are prominent voices in public life who refer to those kinds of jobs as deadend jobs i think its a bad message to send telling millions of people that their jobs are dead ends theyre making valuable contributions and they can serve as stepping stones to even larger contributions and even better jobsp
pdivpstronglearn more stronga hrefhttpswwwaeiorgeconomics5questionsfornicholasbloomoninnovationandworkfromhome5 questions for nicholas bloom on innovation and work from homea a hrefhttpswwwaeiorgeconomics5questionsforedglaeseronthesurvivalofcities5 questions for ed glaeser on the survival of citiesa a hrefhttpswwwaeiorgeconomics5questionsforjohnhaltiwangeronhowthepandemichaschangedusentrepreneurship5 questions for john haltiwanger on how the pandemic has changed us entrepreneurshipapdivbr
pthe post a relnofollow hrefhttpswwwaeiorgeconomics5questionsformichaelstrainonthelabormarket5 questions for michael strain on the labor marketa appeared first on a relnofollow hrefhttpswwwaeiorgamerican enterprise institute aeiap | pstrongby james pethokoukis michael strainstrongp psince economic downturn covid19 pandemic production rebounded prepandemic trends effects pandemic ongoing labor market stagnant labor force participation rates shortage workers fill vacant positions michael strain joined recent episode political economy explain whats going onp pmike arthur f burns scholar political economy director economic policy studies aeip diviframe srchttpsplayercaptivatefmepisodecc3ac7ffdba64ea193247094517e723fiframediv pbelow abbreviated transcript conversation read discussion hrefhttpswwwaeiorgeconomicsamericaslaborshortageandthegreatresignationmylongreadqawithmichaelstrainherea subscribe podcast hrefhttpspodcastsapplecomuspodcastpoliticaleconomywithjimpethokoukisid589914386apple podcastsa hrefhttpswwwstitchercompodcastricochetmoneypoliticswithjimpethokoukisstitchera download podcast hrefhttpsricochetcomseriespoliticaleconomyjamespethokoukisricochetap pstrongpethokoukis state labor market right nowstrongp pstrain look indicators labor market thats great shape vacancies unemployed workers big problem labor market past couple decades opposite jobs chasing workers workers chasing jobs people wouldnt voluntarily quit job pretty confident better job job good nominal wages growing rapidly points strong labor marketp plabor demand white hot employers rapidly raising wages creating job vacancies theyre trying fill time seven million jobs hole workforce participation isnt improving millions people sidelines shouldnt therep figure classwpblockimageimg alt srchttpswwwaeiorgwpcontentuploads202111strain5qshiringjpgx91208 classwpimage1008614111figcaptiona sign augusta maine advertises job openings amid shortage labor covid19 pandemic photo samuel rigelhaupt sipa usafigcaptionfigure pstrongwhy arent coming workstrongp pwell think combination factors people worried pandemic dont feel comfortable coming work consequence schools open daycare centers open theyre affected pandemic likelihood email phone says hey kids classroom going shut week daily reality thats kind thing people worry pandemic think keeping people reentering workforcep panother big factor generosity unemployment benefits president biden american rescue plan increased generosity unemployment benefits 300 week average unemployment benefits typically 350 week going 350 650 large increase kept people sidelines program expired month takes people start job search find job think thats factor keeping people sidelinesp pstrongsome people saying workers going theyve time away realize hated jobs people arent going come wage structure united states changes like happeningstrongp pno dont hope isnt happening think people thinking jobs theyre making evaluations pandemic context context schools uncertain context able decent income working context changes assessment employment opportunities suspect change hope doesp pbusinesses able produce goods services pandemic 7 million workers hole concern businesses figured fewer workers time workers ready come labor demand cooled businesses hey need fewer workers need jobs theyre counting returning themp pstrongand kind situation people need increase skills theyre attractive start paying people basic income workstrong strongis permanent shiftstrongp pright wages growing 5 percent annual rate place wages come productivity workers determinative wages things like bargaining power power balance workers firms youre seeing wages macroeconomic level demand surging supply cant increasing worker skills tilting balance power away businesses workersp pbutthere institutional changes economy permanently altering balance unionization rates wildly increasing sorts new laws passed demand moderates supply economy able expand going start look like prior pandemic power balance workers firms going normalize going left workforce isnt skilled dynamics businesses workers look like thats happening summer fall permanentp pstrongas hear great resignation critiques labor market actual disagreement value work different philosophy value work peoplestrongp pthere jobs physically demanding unpleasant myriad circumstances sure people public life argue thats good thing think view gets things right labor market characterized upward mobility people climb ladder stuck rungs think view misses lot inherent dignity work ability people real contributions society jobsp pi think unfortunate prominent voices public life refer kinds jobs deadend jobs think bad message send telling millions people jobs dead ends theyre making valuable contributions serve stepping stones larger contributions better jobsp pdivpstronglearn stronga hrefhttpswwwaeiorgeconomics5questionsfornicholasbloomoninnovationandworkfromhome5 questions nicholas bloom innovation work homea hrefhttpswwwaeiorgeconomics5questionsforedglaeseronthesurvivalofcities5 questions ed glaeser survival citiesa hrefhttpswwwaeiorgeconomics5questionsforjohnhaltiwangeronhowthepandemichaschangedusentrepreneurship5 questions john haltiwanger pandemic changed entrepreneurshipapdivbr pthe post relnofollow hrefhttpswwwaeiorgeconomics5questionsformichaelstrainonthelabormarket5 questions michael strain labor marketa appeared relnofollow hrefhttpswwwaeiorgamerican enterprise institute aeiap |
6181bcdc49dac1a54d9f550c | It’s the tech giants, not socialist politicians, who are coming for our liberty | pfor much of the 20th century the political right was preoccupied with the threat to free societies posed by the state in its scariest incarnation the big state was represented by totalitarian entities like the ussrp
pyet classical liberal thought which would come to dominate rightwing political parties in the west during 1980s saw a common thread running directly from social democratic welfarism to the gulag a road to serfdom as the title of friedrich hayeks famous defence of laissezfaire capitalism phrased itp
pthe austrianborn hayeks traumatic experience living on the periphery of a collapsing weimar germany fostered in him a belief that social democracy as opposed to a decrepit capitalism generated the rise of hitler and the nazis it laid the groundwork for fascism hayek argued by sapping peoples attachment to individual libertyp
pwhile hayeks view of social democracy was overblown postsecond world war europe enjoyed a period of remarkable freedom and prosperity under mixed economies with interventionist states he was surely right to argue that state collectivism at least contained the seeds of despotism as george orwell wrote in 1944 in his review of hayeks emthe road to serfdomem and as millions behind the iron curtain were discovering for themselves the technocratic state gives to a tyrannical minority such powers as the spanish inquisitors never dreamed ofp
pand yet an obsession with the overmighty state part of our 20thcentury hayekian inheritance can also blind us to the threats to freedom posed by private corporations indeed the gravest threat to liberty in the west for the time being at least arguably comes not from statebacked totalitarianism but from private big tech corporationsp
pthe revenues of the big six tech firms amazon apple facebook google microsoft and netflix individually outstrip those of many nation states in 2019 alphabet the holding company that owns google and its video platform youtube a relnoreferrer noopener hrefhttpswwwtheguardiancombusiness2021feb06isbigtechnowjusttoobigtostomach target_blankbrought ina 162bn in revenues more than hungarys entire economyp
pwe increasingly rely on big tech algorithms to facilitate everything from our connections to one another via social media to the people a relnoreferrer noopener hrefhttpswwwvoxcom20192718210998tinderalgorithmswipingtipsdatingappscience target_blankwe datea to the information we consume and platforms such as twitter facebook instagram also owned by facebook and youtube owned by google have the power to censor us should they wish to the fact they dont usually is surely beside the point the fact is most of us could probably do very little about it were we to be suddenly expelled from their platformsp
plast week we were given a useful reminder of just how powerless we are when novara media a leftwing broadcaster with 170000 subscribers had its youtube channel abruptly a relnoreferrer noopener hrefhttpswwwnewstatesmancomsciencetechbigtech202110whydidyoutubedeletenovaramediaschannel target_blanktaken offa the air in an email to novara youtube a relnoreferrer noopener hrefhttpswwwnytimescom20211029businessyoutubenovarahtml target_blankreportedlya said the broadcaster was guilty of repeated violations of youtubes community guidelines according to the company a youtube channel is terminated if it accrues three strikes by flouting the platforms community guidelinesp
psomething similar recently happened to a friend of mine the filmmaker and former bbc and channel 4 journalist david fuller a relnoreferrer noopener hrefhttpsscheerpostcom20210902meetthecensoredivermectincriticdavidfuller target_blankbrandeda youtube unfit for the purpose for hosting journalism after the platform arbitrarily took down two videos from his a relnoreferrer noopener hrefhttpswwwgooglecomurlsatrctjqesrcssourcewebcdcadrjauact8ved2ahukewjdtp32x_nzahxvh_0hhus1bsgqfnoecbmqaqurlhttps3a2f2fwwwyoutubecom2fc2frebelwisdomusgaovvaw0iivzdh0fmp4mr345i47i target_blankrebel wisdoma channel films that presented emcritiques ofem antivaccination arguments on the a relnoreferrer noopener hrefhttpstwittercomfullydavidstatus1432030126112493570 target_blankbasisa that they constituted medical misinformation fullers channel was also given a youtube strikep
pin both instances youtube later reversed its decisions and released statements saying the videos had been incorrectly removed it appeared that youtubes errorprone algorithm was to blame youtube the worlds largest video platform a relnoreferrer noopener hrefhttpstransparencyreportgooglecomyoutubepolicyremovalshlen_gb target_blankdeletesa around 2000 channels every hour so many in fact that human employees outsource at least some of the platforms moderation to algorithms yet many of the rules governing what gets taken down by youtube or demonetised a step sometimes taken to prevent content creators from generating ad revenue remain opaque to company outsidersp
prightwing content creators have a relnoreferrer noopener hrefhttpsorderordercom20210105youtubeterminatestalkradiochannelfollowinglockdowncriticism target_blankfrequentlya a hrefhttpsunherdcomthepostprofessorkarolsikorafearismoredangerousthanthevirusbeena on the a relnoreferrer noopener hrefhttpswwwtheguardiancomusnews2021feb10trumptwitterbanpermamentsocialmedia target_blankreceiving enda of big tech censorship and so until youtube came for novaras leftwing channel many progressives stayed conspicuously silent about big tech censorship or worse they unthinkingly cheered on the removal of content by the tech giants their reasoning for doing so often sounded more libertarian than leftist as novara medias very own video editor gary mcquiggin a relnoreferrer noopener hrefhttpstwittercomspaulo333status1453131240253579270 target_blankput ita back in 2020 when us president donald trump was banned from twitter its not censorship when a private company decides to remove you from its platformp
psome of this liberal complacency arguably stems from the assumption that modern corporations share their socially liberal attitudes indeed in recent times the rise of woke capitalism has seen corporations a hrefhttpswwwnewstatesmancomlongreads202110thegoodnessbusinesshowwokecapitalismturnedvirtueintoprofitturn virtue into profita big tech has grown adept at talking the language of equality and diversity while simultaneously pursuing its own profitdriven agenda amazon the largest multinational in the world where i a relnoreferrer noopener hrefhttpsatlanticbookscoukbookhired target_blankdiscovereda workers urinating into cocacola bottles when i went undercover at the company in 2016 even a relnoreferrer noopener hrefhttpswwwaboutamazoncomworkplacediversityinclusion target_blanklistsa equity as one of its guiding principlesp
pbigstate totalitarianism may have been the curse of the 20th century yet as the philosopher hannah arendt once wrote an obsession with totalitarianism can lead to us becoming blind to the numerous small and not so small evils with which the road to hell is pavedp
pour apparent willingness to let big tech dictate the information we consume is an apposite example of the blindness arendt was referring to when big tech corporations wield a greater degree of power than many modern nations the big state is probably not the only bogeyman we should be worried aboutp
pthis is what we believe margaret thatcher is a relnoreferrer noopener hrefhttpswwwpressreadercomukthesundaytelegraph20191103281827170568928 target_blankrumoureda to have told conservative party colleagues while brandishing a copy of hayeks emthe constitution of libertyem in our complacency about private corporations we still live in hayeks shadow but as orwell noted in his review of hayeks emthe road to serfdomem hayek was blind to the fact that free capitalism necessarily leads to monopolyp
pmonopoly is precisely what big tech has bestowed upon us when it comes to our online lives as such the issue of big tech censorship can no longer be waved away as a private corporation acting on its own private interests indeed its high time we sloughed off the outdated dogma that says that the state alone is capable of thwarting political libertyp
pstrongem[see also a hrefhttpswwwnewstatesmancomlongreads202110thegoodnessbusinesshowwokecapitalismturnedvirtueintoprofitthe goodness business how woke capitalism turned virtue into profita]emstrongp | pfor 20th century political right preoccupied threat free societies posed state scariest incarnation big state represented totalitarian entities like ussrp pyet classical liberal thought come dominate rightwing political parties west 1980s saw common thread running directly social democratic welfarism gulag road serfdom title friedrich hayeks famous defence laissezfaire capitalism phrased itp pthe austrianborn hayeks traumatic experience living periphery collapsing weimar germany fostered belief social democracy opposed decrepit capitalism generated rise hitler nazis laid groundwork fascism hayek argued sapping peoples attachment individual libertyp pwhile hayeks view social democracy overblown postsecond world war europe enjoyed period remarkable freedom prosperity mixed economies interventionist states surely right argue state collectivism contained seeds despotism george orwell wrote 1944 review hayeks emthe road serfdomem millions iron curtain discovering technocratic state gives tyrannical minority powers spanish inquisitors dreamed ofp pand obsession overmighty state 20thcentury hayekian inheritance blind threats freedom posed private corporations gravest threat liberty west time arguably comes statebacked totalitarianism private big tech corporationsp pthe revenues big tech firms amazon apple facebook google microsoft netflix individually outstrip nation states 2019 alphabet holding company owns google video platform youtube relnoreferrer noopener hrefhttpswwwtheguardiancombusiness2021feb06isbigtechnowjusttoobigtostomach target_blankbrought ina 162bn revenues hungarys entire economyp pwe increasingly rely big tech algorithms facilitate connections social media people relnoreferrer noopener hrefhttpswwwvoxcom20192718210998tinderalgorithmswipingtipsdatingappscience target_blankwe datea information consume platforms twitter facebook instagram owned facebook youtube owned google power censor wish fact dont usually surely point fact probably little suddenly expelled platformsp plast week given useful reminder powerless novara media leftwing broadcaster 170000 subscribers youtube channel abruptly relnoreferrer noopener hrefhttpswwwnewstatesmancomsciencetechbigtech202110whydidyoutubedeletenovaramediaschannel target_blanktaken offa air email novara youtube relnoreferrer noopener hrefhttpswwwnytimescom20211029businessyoutubenovarahtml target_blankreportedlya said broadcaster guilty repeated violations youtubes community guidelines according company youtube channel terminated accrues strikes flouting platforms community guidelinesp psomething similar recently happened friend filmmaker bbc channel 4 journalist david fuller relnoreferrer noopener hrefhttpsscheerpostcom20210902meetthecensoredivermectincriticdavidfuller target_blankbrandeda youtube unfit purpose hosting journalism platform arbitrarily took videos relnoreferrer noopener hrefhttpswwwgooglecomurlsatrctjqesrcssourcewebcdcadrjauact8ved2ahukewjdtp32x_nzahxvh_0hhus1bsgqfnoecbmqaqurlhttps3a2f2fwwwyoutubecom2fc2frebelwisdomusgaovvaw0iivzdh0fmp4mr345i47i target_blankrebel wisdoma channel films presented emcritiques ofem antivaccination arguments relnoreferrer noopener hrefhttpstwittercomfullydavidstatus1432030126112493570 target_blankbasisa constituted medical misinformation fullers channel given youtube strikep pin instances youtube later reversed decisions released statements saying videos incorrectly removed appeared youtubes errorprone algorithm blame youtube worlds largest video platform relnoreferrer noopener hrefhttpstransparencyreportgooglecomyoutubepolicyremovalshlen_gb target_blankdeletesa 2000 channels hour fact human employees outsource platforms moderation algorithms rules governing gets taken youtube demonetised step taken prevent content creators generating ad revenue remain opaque company outsidersp prightwing content creators relnoreferrer noopener hrefhttpsorderordercom20210105youtubeterminatestalkradiochannelfollowinglockdowncriticism target_blankfrequentlya hrefhttpsunherdcomthepostprofessorkarolsikorafearismoredangerousthanthevirusbeena relnoreferrer noopener hrefhttpswwwtheguardiancomusnews2021feb10trumptwitterbanpermamentsocialmedia target_blankreceiving enda big tech censorship youtube came novaras leftwing channel progressives stayed conspicuously silent big tech censorship worse unthinkingly cheered removal content tech giants reasoning sounded libertarian leftist novara medias video editor gary mcquiggin relnoreferrer noopener hrefhttpstwittercomspaulo333status1453131240253579270 target_blankput ita 2020 president donald trump banned twitter censorship private company decides remove platformp psome liberal complacency arguably stems assumption modern corporations share socially liberal attitudes recent times rise woke capitalism seen corporations hrefhttpswwwnewstatesmancomlongreads202110thegoodnessbusinesshowwokecapitalismturnedvirtueintoprofitturn virtue profita big tech grown adept talking language equality diversity simultaneously pursuing profitdriven agenda amazon largest multinational world relnoreferrer noopener hrefhttpsatlanticbookscoukbookhired target_blankdiscovereda workers urinating cocacola bottles went undercover company 2016 relnoreferrer noopener hrefhttpswwwaboutamazoncomworkplacediversityinclusion target_blanklistsa equity guiding principlesp pbigstate totalitarianism curse 20th century philosopher hannah arendt wrote obsession totalitarianism lead blind numerous small small evils road hell pavedp pour apparent willingness let big tech dictate information consume apposite example blindness arendt referring big tech corporations wield greater degree power modern nations big state probably bogeyman worried aboutp pthis believe margaret thatcher relnoreferrer noopener hrefhttpswwwpressreadercomukthesundaytelegraph20191103281827170568928 target_blankrumoureda told conservative party colleagues brandishing copy hayeks emthe constitution libertyem complacency private corporations live hayeks shadow orwell noted review hayeks emthe road serfdomem hayek blind fact free capitalism necessarily leads monopolyp pmonopoly precisely big tech bestowed comes online lives issue big tech censorship longer waved away private corporation acting private interests high time sloughed outdated dogma says state capable thwarting political libertyp pstrongem[see hrefhttpswwwnewstatesmancomlongreads202110thegoodnessbusinesshowwokecapitalismturnedvirtueintoprofitthe goodness business woke capitalism turned virtue profita]emstrongp |
6181bd0e49dac1a54d9f5516 | Jihadi Networks Are More Resilient Than We Think | the world may be distracted by other threats but jihadis arent going away anytime soon | world distracted threats jihadis arent going away anytime soon |
6181bd5e49dac1a54d9f5520 | 2021 Update: “For every 100 girls…..” Part III | div classwpblockimagefigurea hrefhttpswwwaeiorgwpcontentuploads202111forevery100girls20211pngx91208img alt width777 srchttpswwwaeiorgwpcontentuploads202111forevery100girls20211pngx91208 classwpimage1008614187 height1021afigurediv
pheres strongpart iiistrong of my 2021 update for every 100 girls seestrong part istrong a relnoreferrer noopener hrefhttpswwwaeiorgcarpediem2021updateforevery100girlsparti target_blankherea andstrong part iistronga relnoreferrer noopener hrefhttpswwwaeiorgcarpediem2020updateforevery100girlspartii target_blank aa relnoreferrer noopener hrefhttpswwwaeiorgcarpediem2021updateforevery100girlspartii target_blankherea the entire 70item list including parts i ii and iii is a relnoreferrer noopener hrefhttpswwwscribdcomdocument536709735forevery100girls2021update target_blankavailable herea p
pstrong5 higher education and labor market 9strongp
ullifor every strong100 womenstrong enrolled in us colleges degreegranting postsecondary institutions at all levels there are strong75 menstrong enrolled bremsourceem a relnoreferrer noopener hrefhttpsncesedgovprogramsdigestd20tablesdt20_30310aspcurrentyes target_blanknational center for education statisticsalilifor every strong100 womenstrong enrolled in us graduate schools there are strong68 menstrongbr emsourceem a relnoreferrer noopener hrefhttpscgsnetorgckfinderuserfilesfilescgs_ged20_report_final_v2pdf target_blankcouncil for graduate schoolsa 2020 lilifor every strong100 womenstrong who earn associates degrees from us colleges there are strong61 menstrong bremsourceem a relnoreferrer noopener hrefhttpsncesedgovprogramsdigestd20tablesdt20_31810aspcurrentyes target_blanknational center for education statisticsa 20212022lilifor every strong100 womenstrong who earn bachelors degrees from us colleges and universities there are strong73 menstrong bremsourceem a relnoreferrer noopener hrefhttpsncesedgovprogramsdigestd20tablesdt20_31810aspcurrentyes target_blanknational center for education statisticsa 20212022 lilifor every strong100 womenstrong who earn masters degrees from us colleges and universities there are strong65 menstrong br emsourceem a relnoreferrer noopener hrefhttpsncesedgovprogramsdigestd20tablesdt20_31810aspcurrentyes target_blanknational center for education statisticsa lilifor every strong100 womenstrong who earn doctors degrees from us universities there are strong85 menstrong bremsourceem a relnoreferrer noopener hrefhttpsncesedgovprogramsdigestd20tablesdt20_31810aspcurrentyes target_blanknational center for education statisticsa lilifor every strong100 womenstrong who are recent college graduates but not in the labor force there are strong108 menstrong br emsourceem a relnoreferrer noopener hrefhttpsncesedgovprogramsdigestd20tablesdt20_31810aspcurrentyes target_blankdepartment of labora lilifor every strong100 womenstrong with an advanced degree but not in the labor force there are strong114 men strongbremsourceem a relnoreferrer noopener hrefhttpswwwblsgovnewsreleasepdfhsgecpdf target_blankdepartment of labora lilifor every strong100 women ages 1624 strongin the civilian labor force who are enrolled in college there are strong68 menstrong brsource a relnoreferrer noopener hrefhttpswwwblsgovnewsreleasepdfhsgecpdf target_blankdepartment of laboraliul
pp
pstrong6 crime incarceration alcohol and drugs homelessness and wounded military 16strongp
ullifor every strong100 womenstrong who were victims of violent crimes in 2020 there were strong106 menstrongbr emsourceem a hrefhttpscrimedataexplorerappcloudgovpagesexplorercrimecrimetrendfederal bureau of investigationalilifor every strong100 women strongmurdered in 2020 there were strong344 menstrong br emsourceem a hrefhttpscrimedataexplorerappcloudgovpagesexplorercrimecrimetrendfederal bureau of investigationalilifor every strong100 women strongwho were victims of robbery in 2020 there were 187 men br emsourceem a hrefhttpscrimedataexplorerappcloudgovpagesexplorercrimecrimetrendfederal bureau of investigationalilifor every strong100 womenstrong who were victims of aggravated assault in 2020 there were strong115 menstrongbr emsourceem a hrefhttpscrimedataexplorerappcloudgovpagesexplorercrimecrimetrendfederal bureau of investigationalilifor every strong100 women strongwho were victims of property crimes in 2020 there were strong126 menstrong bremsourceem a hrefhttpscrimedataexplorerappcloudgovpagesexplorercrimecrimetrendfederal bureau of investigationalilifor every strong100 womenstrong who were victims of motor vehicle theft in 2020 there were strong167 menstrong bremsourceem a hrefhttpscrimedataexplorerappcloudgovpagesexplorercrimecrimetrendfederal bureau of investigationalilifor every strong100 womenstrong who are homeless there are strong158 menstrong br emsourceem a relnoreferrer noopener hrefhttpswwwhudusergovportalsitesdefaultfilespdf2020aharpart1pdf target_blankus department of housing and urban developmenta 2020 lilifor every strong100 womenstrong who are homeless and unsheltered there are strong234 menstrong bremsourceem a relnoreferrer noopener hrefhttpswwwhudusergovportalsitesdefaultfilespdf2020aharpart1pdf target_blankus department of housing and urban developmenta 2020 lilifor every strong100 womenstrong who abuse illicit drugs and alcohol strong180 menstrong do so bremsourceem a relnoreferrer noopener hrefhttpswwwaddictioncentercomaddictiondifferencesmenwomen target_blankaddiction centeralilifor every strong100 womenstrong who had an alcohol use disorder in 2019 there were strong175 menstrong bremsourceem a relnoreferrer noopener hrefhttpswwwcdcgovalcoholfactsheetsmenshealthhtm target_blankcenters for disease control a lilifor every strong100 womenstrong who have an alcoholrelated hospitalization there are 232 men emsourceem a hrefhttpspubsniaaanihgovpublicationssurveillance106hds14pdfnational institute on alcohol abuse and alcoholisma lilifor every strong100 femalesstrong in local jails in the us there are strong614strong males bremsourceem department of justice via a relnoreferrer noopener hrefhttpsenwikipediaorgwikiincarceration_in_the_united_states target_blankwikipediaa lilifor every strong100 femalesstrong in state and federal prisons there are strong1225 malesstrong br emsourceem a relnoreferrer noopener hrefhttpsbjsojpgovcontentpubpdfp19pdf target_blankdepartment of justicea lilifor every strong100 femalesstrong in federal prison there are strong1331 male prisonersstrong br emsourceem a relnoreferrer noopener hrefhttpswwwbopgovaboutstatisticsstatistics_inmate_genderjsp target_blankfederal bureau of prisonsa lilifor every strong100 female military personnelstrong who have been wounded in action during emoperation enduring freedomem strong5098 menstrong have bremsourceem a hrefhttpsfasorgsgpcrsnatsecrl32492pdfcongressional research servicealilifor every strong100 female military personnelstrong who have been wounded in action during emoperation iraqi freedomem strong4982 menstrong have bremsourceem a hrefhttpsfasorgsgpcrsnatsecrl32492pdfcongressional research servicealiul
psee the chart above that includes some of the items above and items that appear in part i and part ii p
pthe post a relnofollow hrefhttpswwwaeiorgcarpediem2021updateforevery100girlspartiii2021 update for every 100 girls part iiia appeared first on a relnofollow hrefhttpswwwaeiorgamerican enterprise institute aeiap | div classwpblockimagefigurea hrefhttpswwwaeiorgwpcontentuploads202111forevery100girls20211pngx91208img alt width777 srchttpswwwaeiorgwpcontentuploads202111forevery100girls20211pngx91208 classwpimage1008614187 height1021afigurediv pheresstrongpart iiistrongof 2021 update 100 girls seestrongpart istrong relnoreferrer noopener hrefhttpswwwaeiorgcarpediem2021updateforevery100girlsparti target_blankherea andstrong iistronga relnoreferrer noopener hrefhttpswwwaeiorgcarpediem2020updateforevery100girlspartii target_blank aa relnoreferrer noopener hrefhttpswwwaeiorgcarpediem2021updateforevery100girlspartii target_blankherea entire 70item list including parts ii iii relnoreferrer noopener hrefhttpswwwscribdcomdocument536709735forevery100girls2021update target_blankavailable herea p pstrong5 higher education labor market 9strongp ullifor strong100 womenstrong enrolled colleges degreegranting postsecondary institutions levels strong75 menstrong enrolled bremsourceem relnoreferrer noopener hrefhttpsncesedgovprogramsdigestd20tablesdt20_30310aspcurrentyes target_blanknational center education statisticsalilifor strong100 womenstrong enrolled graduate schools strong68 menstrongbr emsourceem relnoreferrer noopener hrefhttpscgsnetorgckfinderuserfilesfilescgs_ged20_report_final_v2pdf target_blankcouncil graduate schoolsa2020 lilifor strong100 womenstrong earn associates degrees colleges strong61 menstrong bremsourceem relnoreferrer noopener hrefhttpsncesedgovprogramsdigestd20tablesdt20_31810aspcurrentyes target_blanknational center education statisticsa20212022lilifor strong100 womenstrong earn bachelors degrees colleges universities strong73 menstrong bremsourceem relnoreferrer noopener hrefhttpsncesedgovprogramsdigestd20tablesdt20_31810aspcurrentyes target_blanknational center education statisticsa20212022 lilifor strong100 womenstrong earn masters degrees colleges universities strong65 menstrong br emsourceem relnoreferrer noopener hrefhttpsncesedgovprogramsdigestd20tablesdt20_31810aspcurrentyes target_blanknational center education statisticsa lilifor strong100 womenstrong earn doctors degrees universities strong85 menstrong bremsourceem relnoreferrer noopener hrefhttpsncesedgovprogramsdigestd20tablesdt20_31810aspcurrentyes target_blanknational center education statisticsa lilifor strong100 womenstrong recent college graduates labor force strong108 menstrong br emsourceem relnoreferrer noopener hrefhttpsncesedgovprogramsdigestd20tablesdt20_31810aspcurrentyes target_blankdepartment labora lilifor strong100 womenstrong advanced degree labor force strong114 men strongbremsourceem relnoreferrer noopener hrefhttpswwwblsgovnewsreleasepdfhsgecpdf target_blankdepartment labora lilifor strong100 women ages 1624 strongin civilian labor force enrolled college strong68 menstrong brsource relnoreferrer noopener hrefhttpswwwblsgovnewsreleasepdfhsgecpdf target_blankdepartment laboraliul pp pstrong6 crime incarceration alcohol drugs homelessness wounded military 16strongp ullifor strong100 womenstrong victims violent crimes 2020 strong106 menstrongbr emsourceem hrefhttpscrimedataexplorerappcloudgovpagesexplorercrimecrimetrendfederal bureau investigationalilifor strong100 women strongmurdered 2020 strong344 menstrong br emsourceem hrefhttpscrimedataexplorerappcloudgovpagesexplorercrimecrimetrendfederal bureau investigationalilifor strong100 women strongwho victims robbery 2020 187 men br emsourceem hrefhttpscrimedataexplorerappcloudgovpagesexplorercrimecrimetrendfederal bureau investigationalilifor strong100 womenstrong victims aggravated assault 2020 strong115 menstrongbr emsourceem hrefhttpscrimedataexplorerappcloudgovpagesexplorercrimecrimetrendfederal bureau investigationalilifor strong100 women strongwho victims property crimes 2020 strong126 menstrong bremsourceem hrefhttpscrimedataexplorerappcloudgovpagesexplorercrimecrimetrendfederal bureau investigationalilifor strong100 womenstrong victims motor vehicle theft 2020 strong167 menstrong bremsourceem hrefhttpscrimedataexplorerappcloudgovpagesexplorercrimecrimetrendfederal bureau investigationalilifor strong100 womenstrong homeless strong158 menstrong br emsourceem relnoreferrer noopener hrefhttpswwwhudusergovportalsitesdefaultfilespdf2020aharpart1pdf target_blankus department housing urban developmenta 2020lilifor strong100 womenstrong homeless unsheltered strong234 menstrong bremsourceem relnoreferrer noopener hrefhttpswwwhudusergovportalsitesdefaultfilespdf2020aharpart1pdf target_blankus department housing urban developmenta2020 lilifor strong100 womenstrong abuse illicit drugs alcohol strong180 menstrong sobremsourceem relnoreferrer noopener hrefhttpswwwaddictioncentercomaddictiondifferencesmenwomen target_blankaddiction centeralilifor strong100 womenstrong alcohol use disorder 2019 strong175 menstrong bremsourceem relnoreferrer noopener hrefhttpswwwcdcgovalcoholfactsheetsmenshealthhtm target_blankcenters disease control alilifor strong100 womenstrong alcoholrelated hospitalization 232 men emsourceem hrefhttpspubsniaaanihgovpublicationssurveillance106hds14pdfnational institute alcohol abuse alcoholisma lilifor strong100 femalesstrong local jails strong614strong males bremsourceem department justice relnoreferrer noopener hrefhttpsenwikipediaorgwikiincarceration_in_the_united_states target_blankwikipediaa lilifor strong100 femalesstrong state federal prisons strong1225 malesstrong br emsourceem relnoreferrer noopener hrefhttpsbjsojpgovcontentpubpdfp19pdf target_blankdepartment justicea lilifor strong100 femalesstrong federal prison strong1331 male prisonersstrong br emsourceem relnoreferrer noopener hrefhttpswwwbopgovaboutstatisticsstatistics_inmate_genderjsp target_blankfederal bureau prisonsa lilifor strong100 female military personnelstrong wounded action emoperation enduring freedomem strong5098 menstrong bremsourceem hrefhttpsfasorgsgpcrsnatsecrl32492pdfcongressional research servicealilifor strong100 female military personnelstrong wounded action emoperation iraqi freedomem strong4982 menstrong bremsourceem hrefhttpsfasorgsgpcrsnatsecrl32492pdfcongressional research servicealiul psee chart includes items items appear ii p pthe post relnofollow hrefhttpswwwaeiorgcarpediem2021updateforevery100girlspartiii2021 update 100 girls iiia appeared relnofollow hrefhttpswwwaeiorgamerican enterprise institute aeiap |
6181be1949dac1a54d9f5548 | The welfare effects of eviction policies | blockquotepthis paper studies the implications of rental market policies that address evictions and homelessness policies that make it harder to evict delinquent tenants for example by providing taxfunded legal counsel in eviction cases righttocounsel or by instating eviction moratoria imply eviction and homelessness are less likely given default but higher default costs to landlords lead to higher equilibrium rents and lower housing supply i quantify these tradeoffs in a model of rental markets in a city matched to micro data on rents and evictions as well as shocks to income and family structure i find that righttocounsel drives up rents so much that homelessness increases by 15 and welfare is dampened since defaults on rent are driven by persistent income shocks stronger protections are ineffective in preventing evictions of delinquent tenants and lead to a large increase in default premia in contrast rental assistance lowers renters default risk and as a result reduces homelessness by 45 and evictions by 75 and increases welfare eviction moratoria can prevent a spike in evictions following a rare economic downturn as long as they are used as a temporary measurepblockquote
phere is a relnoopener hrefhttpsstanfordeduboaza target_blankthe papera that is by boaz abramson who is currently on the job market from stanfordp
pthe post a relnofollow hrefhttpmarginalrevolutioncommarginalrevolution202111thewelfareeffectsofevictionpolicieshtmlthe welfare effects of eviction policiesa appeared first on a relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap | blockquotepthis paper studies implications rental market policies address evictions homelessness policies harder evict delinquent tenants example providing taxfunded legal counsel eviction cases righttocounsel instating eviction moratoria imply eviction homelessness likely given default higher default costs landlords lead higher equilibrium rents lower housing supply quantify tradeoffs model rental markets city matched micro data rents evictions shocks income family structure find righttocounsel drives rents homelessness increases 15 welfare dampened defaults rent driven persistent income shocks stronger protections ineffective preventing evictions delinquent tenants lead large increase default premia contrast rental assistance lowers renters default risk result reduces homelessness 45 evictions 75 increases welfare eviction moratoria prevent spike evictions following rare economic downturn long temporary measurepblockquote phere relnoopener hrefhttpsstanfordeduboaza target_blankthe papera boaz abramson currently job market stanfordp pthe post relnofollow hrefhttpmarginalrevolutioncommarginalrevolution202111thewelfareeffectsofevictionpolicieshtmlthe welfare effects eviction policiesa appeared relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap |
6181be5849dac1a54d9f554e | What I’ve been reading | p1 stephen crane a relnoopener hrefhttpswwwamazoncomcouragestoriesoxfordworldsclassicsdp0199552541refsr_1_10dchild1keywordsredbadgeofcourageqid1635637042qsid14214283993463341sr810sres04862646532cb096ttdlnn2c15084827642c16459401362c19548391542cb09c4lmpw52c15354405622c01995525412c15985306152c03939307502c19496111082cb000nculp42cb002dymbnu2c07645857972cb000fc1cdc2c1562549324srptabis_book target_blankthe red badge of couragea i read this as a kid and was surprised how well my reread held up to the point subtle and with an economy of means i hope the new paul auster biography of crane which i will read soon will revive interest in this classicp
p2 frank herbert a relnoopener hrefhttpswwwamazoncomdunemessiahfrankherbertebookdpb0011ugndgrefsr_1_1dchild1keywordsdunemessiahqid1635636968qsid14214283993463341sr81sres05930982342c05932018842cb001at61pi2c07394239912cb00384x4ai2c04500326632cb00qpjs9gm2cb00798n1ny2c03991259302c14732244622c05932018922c91241429722c13386879642cb000fa5tpg2c03991289802cb003j5uikasrptabis_book target_blankdune messiaha 2 in the dune series i disliked this one as a tot but currently am marveling at its political sophistication somewhat uneven but better than its reputation a relnoopener hrefhttpsenwikipediaorgwikidune_messiah target_blankthe wikipedia page for the booka also indicates that villeneuve is likely to do a dune 3 based on this storyp
p3 elisabeth anderson not the philosopher a relnoopener hrefhttpswwwamazoncomagentsreformprincetoncomparativesociologydp0691220891refsr_1_1dchild1keywordselisabethandersonagentsofreformqid1635637112qsid14214283993463341sr81sres0691220891srptabis_book target_blankagents of reform child labor and the origins of the welfare statea considers the political economy of child labor reform germany france the united states and the failed case of belgium pathbreaking a major advance on the extant literature the explanations are messy rather than monocausal but often focus on the success or failure of individual policy entrepreneursp
p4 gordon teskey a relnoopener hrefhttpswwwamazoncomspenserianmomentsgordonteskeydp0674988442refsr_1_1dchild1keywordsspenserianmomentsqid1635637143qsid14214283993463341sr81sres06749884422cb078rdnfsc2c19516513592cb07mqxssh82cb078m3b7sr2cb07xkq2m6r2cb084ptvqlz2cb088d5k76l2cb07ctgq9g92cb07tn17d3f2cb07zphnrtr2cb08l6wd8k62cb07j18ljhj2cb076prwvfg2cb01ki2on8e2cb012bgenoe target_blankspenserian momentsa no one seems to care about poor old edmund spenser yet there seem to be quite a few good books about himp
p5 patrick mcgilligan a relnoopener hrefhttpswwwamazoncomalfredhitchcocklifedarknesslightebookdpb003shdp3grefsr_1_4cridnmafss35e7y7dchild1keywordsalfredhitchcockbookqid1635637668sprefixalfredhitchcock2caps2c205sr84 target_blankalfred hitchcock a life in darkness and lighta the best book on hitchcock john nye recommended it to me eight years agop
pthere is howard husock a relnoopener hrefhttpswwwamazoncompoorsidetownwhyneeddp1641772026refsr_1_1dchild1keywordshowardhusockqid1635637176qsid14214283993463341sr81sres16417720262c15666353142c16417705892c15940373882cb004bcueko2cb0006rzb7o2cb0006qvkru2cb0006qid9i2cb00072ga8c2c19515701892cb001bkqygw2cb08kmzt1br2cb07vdg7tnd2cb0833q33js2cb07rfntr6t2cb07yl8stdd target_blankthe poor side of town and why we need itap
pand mary roach a relnoopener hrefhttpswwwamazoncomfuzzwhennaturebreakslawebookdpb08xp24kr8refsr_1_2dchild1keywordsmaryroachfuzzqid1635637208qsid14214283993463341sr82sres13240019332c16214507162cb09k256jy32c14262209792cb003m5ige22c052551032x2cb003yjexum2c16318384822c03164965022c17807498992c00628539102c15247469082c13356900502c03933543772cb00196of822c0393881725 target_blankfuzz when nature breaks the lawap
prichard a williams a relnoopener hrefhttpswwwamazoncomfixingfoodinsiderunravelssolutionsebookdpb09fcqtctprefsr_1_3dchild1keywordsrichardwilliamsfixingfoodqid1635637244qsid14214283993463341sr83sres16375801262c17357285002c1401948324srptabis_book target_blankfixing food an fda insider unravels the myths and their solutionsa covers the food regulatory side of the fda andp
pmarkus k brunnermeier a relnoopener hrefhttpswwwamazoncomresilientsocietymarkusbrunnermeierdp1737403609refsr_1_1dchild1keywordsmarkusbrunnermeierqid1635637286qsid14214283993463341sr81sres17374036092c06911784102c01982969832c34067123392c09557009732cb07612lkry2cb071p4br2j2cb01gmi3iny2c09557009812cb07n85w6mf2cb09cywkjfx2c306008811x2cb00iial24w2cb086dxb67m2cb07p7mq9d52cb00eil07qosrptabis_book target_blankthe resilient societyap
pthe post a relnofollow hrefhttpmarginalrevolutioncommarginalrevolution202111whativebeenreading207htmlwhat ive been readinga appeared first on a relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap | p1 stephen crane relnoopener hrefhttpswwwamazoncomcouragestoriesoxfordworldsclassicsdp0199552541refsr_1_10dchild1keywordsredbadgeofcourageqid1635637042qsid14214283993463341sr810sres04862646532cb096ttdlnn2c15084827642c16459401362c19548391542cb09c4lmpw52c15354405622c01995525412c15985306152c03939307502c19496111082cb000nculp42cb002dymbnu2c07645857972cb000fc1cdc2c1562549324srptabis_book target_blankthe red badge couragea read kid surprised reread held point subtle economy means hope new paul auster biography crane read soon revive interest classicp p2 frank herbert relnoopener hrefhttpswwwamazoncomdunemessiahfrankherbertebookdpb0011ugndgrefsr_1_1dchild1keywordsdunemessiahqid1635636968qsid14214283993463341sr81sres05930982342c05932018842cb001at61pi2c07394239912cb00384x4ai2c04500326632cb00qpjs9gm2cb00798n1ny2c03991259302c14732244622c05932018922c91241429722c13386879642cb000fa5tpg2c03991289802cb003j5uikasrptabis_book target_blankdune messiaha 2 dune series disliked tot currently marveling political sophistication somewhat uneven better reputation relnoopener hrefhttpsenwikipediaorgwikidune_messiah target_blankthe wikipedia page booka indicates villeneuve likely dune 3 based storyp p3 elisabeth anderson philosopher relnoopener hrefhttpswwwamazoncomagentsreformprincetoncomparativesociologydp0691220891refsr_1_1dchild1keywordselisabethandersonagentsofreformqid1635637112qsid14214283993463341sr81sres0691220891srptabis_book target_blankagents reform child labor origins welfare statea considers political economy child labor reform germany france united states failed case belgium pathbreaking major advance extant literature explanations messy monocausal focus success failure individual policy entrepreneursp p4 gordon teskey relnoopener hrefhttpswwwamazoncomspenserianmomentsgordonteskeydp0674988442refsr_1_1dchild1keywordsspenserianmomentsqid1635637143qsid14214283993463341sr81sres06749884422cb078rdnfsc2c19516513592cb07mqxssh82cb078m3b7sr2cb07xkq2m6r2cb084ptvqlz2cb088d5k76l2cb07ctgq9g92cb07tn17d3f2cb07zphnrtr2cb08l6wd8k62cb07j18ljhj2cb076prwvfg2cb01ki2on8e2cb012bgenoe target_blankspenserian momentsa care poor old edmund spenser good books himp p5 patrick mcgilligan relnoopener hrefhttpswwwamazoncomalfredhitchcocklifedarknesslightebookdpb003shdp3grefsr_1_4cridnmafss35e7y7dchild1keywordsalfredhitchcockbookqid1635637668sprefixalfredhitchcock2caps2c205sr84 target_blankalfred hitchcock life darkness lighta best book hitchcock john nye recommended years agop pthere howard husock relnoopener hrefhttpswwwamazoncompoorsidetownwhyneeddp1641772026refsr_1_1dchild1keywordshowardhusockqid1635637176qsid14214283993463341sr81sres16417720262c15666353142c16417705892c15940373882cb004bcueko2cb0006rzb7o2cb0006qvkru2cb0006qid9i2cb00072ga8c2c19515701892cb001bkqygw2cb08kmzt1br2cb07vdg7tnd2cb0833q33js2cb07rfntr6t2cb07yl8stdd target_blankthe poor town need itap pand mary roach relnoopener hrefhttpswwwamazoncomfuzzwhennaturebreakslawebookdpb08xp24kr8refsr_1_2dchild1keywordsmaryroachfuzzqid1635637208qsid14214283993463341sr82sres13240019332c16214507162cb09k256jy32c14262209792cb003m5ige22c052551032x2cb003yjexum2c16318384822c03164965022c17807498992c00628539102c15247469082c13356900502c03933543772cb00196of822c0393881725 target_blankfuzz nature breaks lawap prichard williams relnoopener hrefhttpswwwamazoncomfixingfoodinsiderunravelssolutionsebookdpb09fcqtctprefsr_1_3dchild1keywordsrichardwilliamsfixingfoodqid1635637244qsid14214283993463341sr83sres16375801262c17357285002c1401948324srptabis_book target_blankfixing food fda insider unravels myths solutionsa covers food regulatory fda andp pmarkus k brunnermeier relnoopener hrefhttpswwwamazoncomresilientsocietymarkusbrunnermeierdp1737403609refsr_1_1dchild1keywordsmarkusbrunnermeierqid1635637286qsid14214283993463341sr81sres17374036092c06911784102c01982969832c34067123392c09557009732cb07612lkry2cb071p4br2j2cb01gmi3iny2c09557009812cb07n85w6mf2cb09cywkjfx2c306008811x2cb00iial24w2cb086dxb67m2cb07p7mq9d52cb00eil07qosrptabis_book target_blankthe resilient societyap pthe post relnofollow hrefhttpmarginalrevolutioncommarginalrevolution202111whativebeenreading207htmlwhat ive readinga appeared relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap |
6181be5c49dac1a54d9f5550 | 2021 Update: “For every 100 girls…..” Part II | pheres strongpart iistrong of my 2021 update for every 100 girls see strongpart istrong a relnoreferrer noopener hrefhttpswwwaeiorgcarpediem2021updateforevery100girlsparti target_blankherea and strongpart iiistrong a relnoreferrer noopener hrefhttpswwwaeiorgcarpediem2021updateforevery100girlspartiii target_blankherea the full 70item list with all three parts is available a relnoreferrer noopener hrefhttpswwwscribdcomdocument536709735forevery100girls2021update target_blankherea p
div classwpblockimagefigurea hrefhttpswwwaeiorgwpcontentuploads202111forevery100girls20211pngx91208img alt width777 srchttpswwwaeiorgwpcontentuploads202111forevery100girls20211pngx91208 classwpimage1008614187 height1021afigurediv
pstrong3 k12 education 13strongp
ullifor every strong100 girlsstrong who repeat kindergarten strong145 boysstrong repeat kindergartenbr emsourceem a relnoreferrer noopener hrefhttpsncesedgovprogramsdigestd13tablesdt13_22050asp target_blanknational center for education statisticsa lilifor every strong100 girlsstrong whose entry into kindergarten is delayed strong139 boysstrong are delayedbrem sourceem a relnoreferrer noopener hrefhttpsncesedgovprogramsdigestd13tablesdt13_22050asp target_blanknational center for education statisticsalilifor every strong100 girlsstrong suspended from public schools in grades 612 strong195 boysstrong are suspended bremsourceem a relnoreferrer noopener hrefhttpsncesedgovprogramsdigestd17tablesdt17_23330asp target_blanknational center for education statisticsalilifor every strong100 girlsstrong expelled from public schools in grades 612 strong223 boysstrong are expelled br emsourceem a relnoreferrer noopener hrefhttpsncesedgovprogramsdigestd17tablesdt17_23330asp target_blanknational center for education statistics alilifor every strong100 high school girlsstrong who took the sat test in 2021 strong94 boysstrong took the testbr emsourceem a hrefhttpsreportscollegeboardorgpdf2020totalgroupsatsuiteassessmentsannualreportpdfcollege boarda 2021lilifor every strong100 collegebound high school senior girlsstrong in the top 10 of their class there are strong79 boysstrong strong strongbremsourceem a relnoreferrer noopener hrefhttpsreportscollegeboardorgpdftotalgroup2016pdf target_blankcollege boarda 2016lilifor every strong100 collegebound high school senior girlsstrong with an a or a grade point average there are strong65 boysstrong bremsourceem a hrefhttpsreportscollegeboardorgpdftotalgroup2016pdfcollege boarda 2016 lilifor every strong100 collegebound high school senior girlsstrong who take aphonors courses in math there are strong82 boys strongbremsourceem a relnoreferrer noopener hrefhttpsreportscollegeboardorgpdftotalgroup2016pdf target_blankcollege boarda 2016lilifor every strong100 collegebound high school senior girlsstrong who take aphonors courses in natural sciences there are strong79 boysstrongbremsourceem a relnoreferrer noopener hrefhttpsreportscollegeboardorgpdftotalgroup2016pdf target_blankcollege boarda 2016lilifor every strong100 collegebound high school senior girlsstrong who take aphonors courses in foreignclassical languages there are strong64 boysstrong bremsourceem a relnoreferrer noopener hrefhttpsreportscollegeboardorgpdftotalgroup2016pdf target_blankcollege boarda 2016lilifor every strong100 collegebound high school senior girlsstrong who take aphonors courses in artmusic there are strong54 boysstrongbremsourceem a relnoreferrer noopener hrefhttpsreportscollegeboardorgpdftotalgroup2016pdf target_blankcollege boarda 2016lilifor every strong100 collegebound high school senior girlsstrong who take aphonors courses in englishlanguage arts there are strong64 boysstrong bremsourceem a relnoreferrer noopener hrefhttpsreportscollegeboardorgpdftotalgroup2016pdf target_blankcollege boarda 2016lilifor every 100 high school girls who took an ap course in 2020 there were 76 boysbremsourceem a hrefhttpssecuremediacollegeboardorgdigitalservicespdfresearch2020programsummaryreport2020pdfcollege boarda 2020liul
pstrong4 special education 8strongp
ullifor every strong100 girls ages 317 yearsstrong diagnosed with communication disorders there are strong168 boysstrong bremsourceem a relnoreferrer noopener hrefhttpswwwcdcgovnchsdatadatabriefsdb205pdf target_blankcenters for disease control and preventionalilifor every strong100 girls 4 to 17 years oldstrong diagnosed with attentiondeficithyperactivity disorder adhd there are strong238 boysstrong bremsourceem a relnoreferrer noopener hrefhttpswwwncldorgidentifyingstrugglingstudents target_blanknational center for education statisticsalilifor every strong100 girls ages 3 to 5 yearsstrong old served by public schools under the individuals with disabilities education act idea there are strong227 boysstrong bremsourceem a relnoreferrer noopener hrefhttpsncesedgovprogramsdigestd19tablesdt19_20450aspcurrentyes target_blanknational center for education statisticsa 20192020lilifor every strong100 girls ages 6 to 21 yearsstrong served by public schools under the individuals with disabilities education act idea there are strong193 boysstrong bremsourceem a relnoreferrer noopener hrefhttpsncesedgovprogramsdigestd19tablesdt19_20450aspcurrentyes target_blanknational center for education statisticsa 20192020lilifor every strong100 girlsstrong ages 621 who receive services in public schools for autism there are strong492 boysstrong bremsourceem a relnoreferrer noopener hrefhttpsncesedgovprogramsdigestd20tablesdt20_20450aspcurrentyes target_blanknational center for education statisticsa 20192020 lilifor every strong100 girlsstrong ages 621 who receive services in public schools for developmental delay there are strong235 boysstrongbr emsourceem a relnoreferrer noopener hrefhttpsncesedgovprogramsdigestd20tablesdt20_20450aspcurrentyes target_blanknational center for education statisticsa 20192020lilifor every strong100 girlsstrong ages 621 in public schools classified as having an emotional disturbance there are strong255 boys strongbremsourceem a relnoreferrer noopener hrefhttpsncesedgovprogramsdigestd20tablesdt20_20450aspcurrentyes target_blanknational center for education statisticsa 20192020lilifor every strong100 girlsstrong ages 621 in public schools who are classified as having a specific learning disability there are strong144 boysstrong bremsourceem a relnoreferrer noopener hrefhttpsncesedgovprogramsdigestd20tablesdt20_20450aspcurrentyes target_blanknational center for education statisticsa 20192020liul
p see the chart above that includes some of the items above and also items that appear in part i and part iii p
pthe post a relnofollow hrefhttpswwwaeiorgcarpediem2021updateforevery100girlspartii2021 update for every 100 girls part iia appeared first on a relnofollow hrefhttpswwwaeiorgamerican enterprise institute aeiap | pheres strongpart iistrong 2021 update 100 girls strongpart istrong relnoreferrer noopener hrefhttpswwwaeiorgcarpediem2021updateforevery100girlsparti target_blankherea strongpart iiistrong relnoreferrer noopener hrefhttpswwwaeiorgcarpediem2021updateforevery100girlspartiii target_blankherea 70item list parts available relnoreferrer noopener hrefhttpswwwscribdcomdocument536709735forevery100girls2021update target_blankherea p div classwpblockimagefigurea hrefhttpswwwaeiorgwpcontentuploads202111forevery100girls20211pngx91208img alt width777 srchttpswwwaeiorgwpcontentuploads202111forevery100girls20211pngx91208 classwpimage1008614187 height1021afigurediv pstrong3 k12 education 13strongp ullifor strong100 girlsstrong repeat kindergarten strong145 boysstrong repeat kindergartenbr emsourceem relnoreferrer noopener hrefhttpsncesedgovprogramsdigestd13tablesdt13_22050asp target_blanknational center education statisticsa lilifor strong100 girlsstrong entry kindergarten delayed strong139 boysstrong delayedbrem sourceem relnoreferrer noopener hrefhttpsncesedgovprogramsdigestd13tablesdt13_22050asp target_blanknational center education statisticsalilifor strong100 girlsstrong suspended public schools grades 612 strong195 boysstrong suspended bremsourceem relnoreferrer noopener hrefhttpsncesedgovprogramsdigestd17tablesdt17_23330asp target_blanknational center education statisticsalilifor strong100 girlsstrong expelled public schools grades 612 strong223 boysstrong expelled br emsourceem relnoreferrer noopener hrefhttpsncesedgovprogramsdigestd17tablesdt17_23330asp target_blanknational center education statisticsalilifor strong100 high school girlsstrong took sat test 2021 strong94 boysstrong took testbr emsourceem hrefhttpsreportscollegeboardorgpdf2020totalgroupsatsuiteassessmentsannualreportpdfcollege boarda 2021lilifor strong100 collegebound high school senior girlsstrong 10 class strong79 boysstrong strong strongbremsourceem relnoreferrer noopener hrefhttpsreportscollegeboardorgpdftotalgroup2016pdf target_blankcollege boarda 2016lilifor strong100 collegebound high school senior girlsstrong grade point average strong65 boysstrong bremsourceem hrefhttpsreportscollegeboardorgpdftotalgroup2016pdfcollege boarda 2016 lilifor strong100 collegebound high school senior girlsstrong aphonors courses math strong82 boys strongbremsourceem relnoreferrer noopener hrefhttpsreportscollegeboardorgpdftotalgroup2016pdf target_blankcollege boarda 2016lilifor strong100 collegebound high school senior girlsstrong aphonors courses natural sciences strong79 boysstrongbremsourceem relnoreferrer noopener hrefhttpsreportscollegeboardorgpdftotalgroup2016pdf target_blankcollege boarda 2016lilifor strong100 collegebound high school senior girlsstrong aphonors courses foreignclassical languages strong64 boysstrong bremsourceem relnoreferrer noopener hrefhttpsreportscollegeboardorgpdftotalgroup2016pdf target_blankcollege boarda 2016lilifor strong100 collegebound high school senior girlsstrong aphonors courses artmusic strong54 boysstrongbremsourceem relnoreferrer noopener hrefhttpsreportscollegeboardorgpdftotalgroup2016pdf target_blankcollege boarda 2016lilifor strong100 collegebound high school senior girlsstrong aphonors courses englishlanguage arts strong64 boysstrong bremsourceem relnoreferrer noopener hrefhttpsreportscollegeboardorgpdftotalgroup2016pdf target_blankcollege boarda 2016lilifor 100 high school girls took ap course 2020 76 boysbremsourceem hrefhttpssecuremediacollegeboardorgdigitalservicespdfresearch2020programsummaryreport2020pdfcollege boarda 2020liul pstrong4 special education 8strongp ullifor strong100 girls ages 317 yearsstrong diagnosed communication disorders strong168 boysstrong bremsourceem relnoreferrer noopener hrefhttpswwwcdcgovnchsdatadatabriefsdb205pdf target_blankcenters disease control preventionalilifor strong100 girls 4 17 years oldstrong diagnosed attentiondeficithyperactivity disorder adhd strong238 boysstrong bremsourceem relnoreferrer noopener hrefhttpswwwncldorgidentifyingstrugglingstudents target_blanknational center education statisticsalilifor strong100 girls ages 3 5 yearsstrong old served public schools individuals disabilities education act idea strong227 boysstrong bremsourceem relnoreferrer noopener hrefhttpsncesedgovprogramsdigestd19tablesdt19_20450aspcurrentyes target_blanknational center education statisticsa 20192020lilifor strong100 girls ages 6 21 yearsstrong served public schools individuals disabilities education act idea strong193 boysstrong bremsourceem relnoreferrer noopener hrefhttpsncesedgovprogramsdigestd19tablesdt19_20450aspcurrentyes target_blanknational center education statisticsa 20192020lilifor strong100 girlsstrong ages 621 receive services public schools autism strong492 boysstrong bremsourceem relnoreferrer noopener hrefhttpsncesedgovprogramsdigestd20tablesdt20_20450aspcurrentyes target_blanknational center education statisticsa 20192020lilifor strong100 girlsstrong ages 621 receive services public schools developmental delay strong235 boysstrongbr emsourceem relnoreferrer noopener hrefhttpsncesedgovprogramsdigestd20tablesdt20_20450aspcurrentyes target_blanknational center education statisticsa 20192020lilifor strong100 girlsstrong ages 621 public schools classified having emotional disturbance strong255 boys strongbremsourceem relnoreferrer noopener hrefhttpsncesedgovprogramsdigestd20tablesdt20_20450aspcurrentyes target_blanknational center education statisticsa 20192020lilifor strong100 girlsstrong ages 621 public schools classified having specific learning disability strong144 boysstrong bremsourceem relnoreferrer noopener hrefhttpsncesedgovprogramsdigestd20tablesdt20_20450aspcurrentyes target_blanknational center education statisticsa 20192020liul p chart includes items items appear iii p pthe post relnofollow hrefhttpswwwaeiorgcarpediem2021updateforevery100girlspartii2021 update 100 girls iia appeared relnofollow hrefhttpswwwaeiorgamerican enterprise institute aeiap |
6181be8949dac1a54d9f5554 | 2021 Update: “For every 100 girls…..” Part I | div classwpblockimagefigurea hrefhttpswwwaeiorgwpcontentuploads202111forevery100girls2021pngx91208img alt width777 srchttpswwwaeiorgwpcontentuploads202111forevery100girls2021pngx91208 classwpimage1008614175 height1021afigurediv
pin 2011 a relnoreferrer noopener hrefhttpwwwpellinstituteorgsenior_scholarsshtml target_blankthomas g mortensona senior scholar at the a relnoreferrer noopener hrefhttpwwwpellinstituteorgindexshtml target_blankpell institute for the study of opportunity in higher educationa in washington dc and independent higher education policy analyst put together and published the 100 item list a relnoreferrer noopener hrefhttpwebarchiveorgweb20201111205407httpswwwedweekorgmediaevery100girls32boyspdf target_blankfor every 100 girlsa on a relnoreferrer noopener hrefhttpswwwedweekorgewindexhtml target_blankemeducation weekema in an email tom explained to me that at the time i initially wrote it i was hearing and reading that boys were no different than girls and the data i was looking at said something very different our differences are important to both genders and should be respected education has a long way to go to recognize appreciate and address these differences through educational opportunities tailored to these differencesp
pwith toms permission ive updated about half of the items on the original list with the most recent data available and added some new items that demonstrate empirically the many significant differences between boys men and girls women on many measures of health outcomes educational outcomes educational and learning disabilities suicide and homicide rates incarceration rates alcohol and drug abuse behavior problems leading to suspension or expulsion in school homelessness job deaths military deaths crime victimhood etc part i appears below and part ii appears a relnoreferrer noopener hrefhttpswwwaeiorgcarpediem2021updateforevery100girlspartii target_blankherea and part iii a relnoreferrer noopener hrefhttpswwwaeiorgcarpediem2021updateforevery100girlspartiii target_blankherea the full 70item list with all three parts is available a relnoreferrer noopener hrefhttpswwwscribdcomdocument536709735forevery100girls2021update target_blankherea p
pstrong1 birth and death 20 strongp
ul
lifor every strong100 girl babiesstrong who die in the first 27 days of life strong1275 boy babies diestrongli
lifor every strong100 girl babiesstrong who die after the first 27 days but in the first year of life strong130 boy babies diestrongli
lifor every strong100 infant girlsstrong who die under one year old strong128 infant boys diestrongli
lifor every strong100 girlsstrong ages 1 to 4 years who die strong141 boys diestrongli
lifor every strong100 girlsstrong ages 5 to 14 years who die strong130 boys diestrongli
lifor every strong100 girls and womenstrong ages 15 to 24 years who die strong270 boys and men diestrongli
lifor every strong100 womenstrong ages 25 to 34 who die strong227 men diestrongli
lifor every strong100 womenstrong ages 35 to 44 who die strong177 men diestrong li
ul
pemsourceem a relnoopener noreferrer hrefhttpswwwcdcgovnchsdatanvsrnvsr68nvsr68_09508pdf target_blankcenters for disease control and prevention national center for health statisticsap
ul
lifor every strong100 womenstrong who die by opioid overdose 227strong menstrong die bremsourceem a relnoreferrer noopener hrefhttpswwwkfforgotherstateindicatoropioidoverdosedeathsbygendercurrenttimeframe0sortmodel7b22colid2222location2222sort2222asc227d target_blankkaiser family foundationali
lifor every strong100 female deathsstrong attributable to alcohol worldwide there are strong329 malestrong deaths bremsourceem a relnoopener noreferrer hrefhttpsarcrniaaanihgovwomenandalcoholgenderdifferencesepidemiologyalcoholuseandrelatedharmsunitedstatesarticletoc0 target_blanknational institute on alcohol abuse and alcoholism national institutes of healthali
lifor every strong100 womenstrong who die on the job strong1118 menstrong die working bremsourceem a relnoreferrer noopener hrefhttpsarcrniaaanihgovwomenandalcoholgenderdifferencesepidemiologyalcoholuseandrelatedharmsunitedstatesarticletoc0 target_blankbureau of labor statisticsali
li
pfor every strong100 femalesstrong ages 15 to 19 who commit suicide there are strong293 malesstrong bremsourceem a relnoreferrer noopener hrefhttpswwwcdcgovnchsdatadvslcwk1_2015pdf target_blankcenters for disease controlap
li
li
pfor every strong100 femalesstrong ages 20 to 24 who commit suicide there are strong464 malesstrong brem sourceem a relnoreferrer noopener hrefhttpswwwcdcgovnchsdatadvslcwk1_2015pdf target_blankcenters for disease controlap
li
li
pfor every strong100 femalesstrong ages 2529 who commit suicide there are strong418 malesstrong brem sourceem a relnoreferrer noopener hrefhttpswwwcdcgovnchsdatadvslcwk1_2015pdf target_blankcenters for disease controlap
li
li
pfor every strong100 femalesstrong ages 1519 who die of homicide there are strong642 malesstrong bremsourceem a relnoreferrer noopener hrefhttpswwwcdcgovnchsdatadvslcwk1_2015pdf target_blankcenters for disease controlap
li
li
pfor every strong100 femalesstrong ages 2024 who die of homicide there are strong717 malesstrong bremsourceem a relnoreferrer noopener hrefhttpswwwcdcgovnchsdatadvslcwk1_2015pdf target_blankcenters for disease controlap
li
li
pfor every strong100 femalesstrong ages 2529 who die of homicide there are strong579 malesstrong bremsourceem a relnoreferrer noopener hrefhttpswwwcdcgovnchsdatadvslcwk1_2015pdf target_blankcenters for disease controlap
li
li
pfor every strong100 femalesstrong ages 3034 who die of homicide there are strong488 malesstrong bremsourceem a relnoreferrer noopener hrefhttpswwwcdcgovnchsdatadvslcwk1_2015pdf target_blankcenters for disease controlap
li
li
pfor every strong100 female military personnelstrong who have died during operation enduring freedom strong4506 menstrong have died bremsourceem a hrefhttpsfasorgsgpcrsnatsecrl32492pdfcongressional research serviceap
li
li
pfor every strong100 female military personnelstrong who have died during operation iraqi freedom strong3915 menstrong have died bremsourceem a hrefhttpsfasorgsgpcrsnatsecrl32492pdfcongressional research serviceap
li
ul
pstrong2 educational attainment of young adults 4 strongp
ullifor every strong100 womenstrong ages 25 to 29 years who have an associates degree there are strong89 menstronglilifor every strong100 womenstrong ages 25 to 29 years who have a bachelors degree there are strong88 menstronglilifor every strong100 womenstrong ages 25 to 29 years who have a masters degree there are strong61 menstronglilifor every strong100 womenstrong ages 25 to 29 years who have a first professional or doctors degree there are strong80 menstrongliul
pemsource
ema relnoreferrer noopener hrefhttpsncesedgovprogramsdigestd17tablesdt17_10430asp target_blanknational
center for education statisticsa p
pstrongmpstrong for those in the social constructionist movement who argue that the differences between men and women are entirely social conventions how can these significant differences in gender be explainedp
p see chart above that includes some of the items above and items that will appear in part ii and part iii p
pthe post a relnofollow hrefhttpswwwaeiorgcarpediem2021updateforevery100girlsparti2021 update for every 100 girls part ia appeared first on a relnofollow hrefhttpswwwaeiorgamerican enterprise institute aeiap | div classwpblockimagefigurea hrefhttpswwwaeiorgwpcontentuploads202111forevery100girls2021pngx91208img alt width777 srchttpswwwaeiorgwpcontentuploads202111forevery100girls2021pngx91208 classwpimage1008614175 height1021afigurediv pin 2011 relnoreferrer noopener hrefhttpwwwpellinstituteorgsenior_scholarsshtml target_blankthomas g mortensona senior scholar relnoreferrer noopener hrefhttpwwwpellinstituteorgindexshtml target_blankpell institute study opportunity higher educationa washington dc independent higher education policy analyst published 100 item list relnoreferrer noopener hrefhttpwebarchiveorgweb20201111205407httpswwwedweekorgmediaevery100girls32boyspdf target_blankfor 100 girlsa relnoreferrer noopener hrefhttpswwwedweekorgewindexhtml target_blankemeducation weekema email tomexplained time initially wrote hearing reading boys different girls data looking said different differences important genders respected education long way recognize appreciate address differences educational opportunities tailored differencesp pwith toms permission ive updated half items original list recent data available added new items demonstrate empirically significant differences boys men girls women measures health outcomes educational outcomes educational learning disabilities suicide homicide rates incarceration rates alcohol drug abuse behavior problems leading suspension expulsion school homelessness job deaths military deaths crime victimhood etc appears ii appears relnoreferrer noopener hrefhttpswwwaeiorgcarpediem2021updateforevery100girlspartii target_blankherea iii relnoreferrer noopener hrefhttpswwwaeiorgcarpediem2021updateforevery100girlspartiii target_blankherea 70item list parts available relnoreferrer noopener hrefhttpswwwscribdcomdocument536709735forevery100girls2021update target_blankherea p pstrong1 birth death 20 strongp ul lifor strong100 girl babiesstrong die 27 days life strong1275 boy babies diestrongli lifor strong100 girl babiesstrong die 27 days year life strong130 boy babies diestrongli lifor strong100 infant girlsstrong die year old strong128 infant boys diestrongli lifor strong100 girlsstrong ages 1 4 years die strong141 boys diestrongli lifor strong100 girlsstrong ages 5 14 years die strong130 boys diestrongli lifor strong100 girls womenstrong ages 15 24 years die strong270 boys men diestrongli lifor strong100 womenstrong ages 25 34 die strong227 men diestrongli lifor strong100 womenstrong ages 35 44 die strong177 men diestrongli ul pemsourceem relnoopener noreferrer hrefhttpswwwcdcgovnchsdatanvsrnvsr68nvsr68_09508pdf target_blankcenters disease control prevention national center health statisticsap ul lifor strong100 womenstrong die opioid overdose 227strong menstrong die bremsourceem relnoreferrer noopener hrefhttpswwwkfforgotherstateindicatoropioidoverdosedeathsbygendercurrenttimeframe0sortmodel7b22colid2222location2222sort2222asc227d target_blankkaiser family foundationali lifor strong100 female deathsstrong attributable alcohol worldwide strong329 malestrong deathsbremsourceem relnoopener noreferrer hrefhttpsarcrniaaanihgovwomenandalcoholgenderdifferencesepidemiologyalcoholuseandrelatedharmsunitedstatesarticletoc0 target_blanknational institute alcohol abuse alcoholism national institutes healthali lifor strong100 womenstrong die job strong1118 menstrong die working bremsourceem relnoreferrer noopener hrefhttpsarcrniaaanihgovwomenandalcoholgenderdifferencesepidemiologyalcoholuseandrelatedharmsunitedstatesarticletoc0 target_blankbureau labor statisticsali li pfor strong100 femalesstrong ages 15 19 commit suicide strong293 malesstrong bremsourceem relnoreferrer noopener hrefhttpswwwcdcgovnchsdatadvslcwk1_2015pdf target_blankcenters disease controlap li li pfor strong100 femalesstrong ages 20 24 commit suicide strong464 malesstrong brem sourceem relnoreferrer noopener hrefhttpswwwcdcgovnchsdatadvslcwk1_2015pdf target_blankcenters disease controlap li li pfor strong100 femalesstrong ages 2529 commit suicide strong418 malesstrong brem sourceem relnoreferrer noopener hrefhttpswwwcdcgovnchsdatadvslcwk1_2015pdf target_blankcenters disease controlap li li pfor strong100 femalesstrong ages 1519 die homicide strong642 malesstrong bremsourceem relnoreferrer noopener hrefhttpswwwcdcgovnchsdatadvslcwk1_2015pdf target_blankcenters disease controlap li li pfor strong100 femalesstrong ages 2024 die homicide strong717 malesstrong bremsourceem relnoreferrer noopener hrefhttpswwwcdcgovnchsdatadvslcwk1_2015pdf target_blankcenters disease controlap li li pfor strong100 femalesstrong ages 2529 die homicide strong579 malesstrong bremsourceem relnoreferrer noopener hrefhttpswwwcdcgovnchsdatadvslcwk1_2015pdf target_blankcenters disease controlap li li pfor strong100 femalesstrong ages 3034 die homicide strong488 malesstrong bremsourceem relnoreferrer noopener hrefhttpswwwcdcgovnchsdatadvslcwk1_2015pdf target_blankcenters disease controlap li li pfor strong100 female military personnelstrong died operation enduring freedom strong4506 menstrong died bremsourceem hrefhttpsfasorgsgpcrsnatsecrl32492pdfcongressional research serviceap li li pfor strong100 female military personnelstrong died operation iraqi freedom strong3915 menstrong died bremsourceem hrefhttpsfasorgsgpcrsnatsecrl32492pdfcongressional research serviceap li ul pstrong2 educational attainment young adults 4 strongp ullifor strong100 womenstrong ages 25 29 years associates degree strong89 menstronglilifor strong100 womenstrong ages 25 29 years bachelors degree strong88 menstronglilifor strong100 womenstrong ages 25 29 years masters degree strong61 menstronglilifor strong100 womenstrong ages 25 29 years professional doctors degree strong80 menstrongliul pemsource ema relnoreferrer noopener hrefhttpsncesedgovprogramsdigestd17tablesdt17_10430asp target_blanknational center education statisticsa p pstrongmpstrong social constructionist movement argue differences men women entirely social conventions significant differences gender explainedp p chart includes items items appear ii iii p pthe post relnofollow hrefhttpswwwaeiorgcarpediem2021updateforevery100girlsparti2021 update 100 girls ia appeared relnofollow hrefhttpswwwaeiorgamerican enterprise institute aeiap |
6181be9149dac1a54d9f5556 | The great climate change fallacy | pwe are quite literally in the last chance saloon a relnoopener hrefhttpswwwtheguardiancomenvironment2021oct31cop26literallythelastchancesaloontosaveplanetprincecharles target_blanksays prince charlesa humanity is about 51 down at halftime a relnoopener hrefhttpswwwtheguardiancomenvironment2021oct29cop26humanity51halftimeclimatecrisisborisjohnson target_blanksays boris johnsona people will curse this generation of politicians worse than they did that which appeased hitler a relnoopener hrefhttpstwittercombbclaurakstatus1455208478994206720 target_blanksays justin welbya the archbishop of canterbury because they are allowing a genocide on an infinitely greater scalep
pare things quite that bad well if you read the headlines yes were on course for disaster and we dont seem to be turning business as usual will lead to a relnoopener hrefhttpswwwnytimescom20210211opinionclimatechangehimalayashtml target_blanka catastrophic collapse of himalayan glaciersa and a relnoopener hrefhttpswwwnytimescom20210721opinionclimatechangeheatwaveshtml target_blankdevastating heatwavesa in the southern united states according to the emnew york timesem whats more the same newspaper a relnoopener hrefhttpswwwnytimescomarticleclimatechangeglobalwarmingfaqhtml target_blanksaid last weeka ahead of cop26 if we continue with business as usual by the end of the century it will be too hot to go outside during heat waves in the middle east and south asiap
pbut all these stories share one thing they are based on the ipccs rcp 85 scenario its not an exciting name but 85 is often described as business as usual hence the headlinesp
prcp 85 is not business as usual though its an unlikely worst case this means a large fraction of the public debate on climate change mitigation is driven by an increasingly implausible scenario which was unlikely when it was proposed and is even less so now the more we focus on this scenario though the more pessimistic and the more hopeless the situation will seemp
divdiv
pback in 2007 after a relnoopener hrefhttpswwwipccchassessmentreportar4 target_blankthe fourth ipcc reporta was published climate scientists wanted to create new emissions scenarios imagining how they might change in the coming decades and what impact they would have on the climate but while there was a relnoopener hrefhttpswwwnaturecomarticlesnature08823 target_blanka plana to make indepth scenarios ahead of the fifth report in 2013 scientists would need to start running models for that report as soon as 2010 they needed something that could be used in the meantimep
pso four representative concentration pathways rcps were developed rcp 26 45 60 and 85supa hrefhttpsunherdcom202111thegreatclimatechangefallacyen25474911asup they were roughly speaking a highly optimistic scenario regarding emissions two middling scenarios and a highly pessimistic one rcp 85 was there as a realistic worst case even at the time it was viewed as unlikely but two unfortunate things confused that picturep
pfirst of the four rcps only 85 imagined a world with no climate policy and second its authors a relnoopener hrefhttpslinkspringercomarticle101007s105840110149y target_blankdescribed ita as a highemission business as usual scenario meaning that it was at the high end of emissions for business as usual but which was taken to mean in some quarters that high emissions were business as usualp
pso rcp 85 became synonymous with business as usual there are dozens of studies published every year a relnoopener hrefhttpsscholargooglecomscholarhlenas_sdt06qrcp8522businessasusual22scisbd1 target_blankdescribing it as sucha this one a relnoopener hrefhttpswwwnaturecomarticless41612021001787 target_blanksaysa that businessasusual will lead to super and ultraextreme heatwaves in the middle east and north africa it is a mainstream part of climate sciencep
pthe problem isnt that people study these scenarios says a relnoopener hrefhttpsthebreakthroughorgpeoplezekehausfather target_blankzeke hausfathera a climate scientist at the breakthrough institute its that they frame them as the most likely outcome in the absence of policy that was probably never true but im sure its not true nowp
pmost obviously we dont live in a world without climate policies the a relnoopener hrefhttpswwweeaeuropaeuthemesclimatechangeadaptationglobalclimatechangepolicies target_blankparis protocolsa commit signatories to goals of keeping warming below 2c and aiming for below 15c so business as usual is a global effort to reduce emissionsp
diva hrefhttpsunherdcom201909whyclimatechangeisnttheendoftheworldrefinnara hrefhttpsunherdcom201909whyclimatechangeisnttheendoftheworldrefinnarimg srchttpsunherdcomwpcontentuploads201909gettyimages1163398643300x200jpgadiva hrefhttpsunherdcom201909whyclimatechangeisnttheendoftheworldrefinnarspansuggested readingspanaa hrefhttpsunherdcom201909whyclimatechangeisnttheendoftheworldrefinnarh5why climate change isnt the end of the worldh5apa hrefhttpsunherdcom201909whyclimatechangeisnttheendoftheworldrefinnarspanbyspan tom chiversapdivadiv
psecond and most important the world has changed its energy mix far faster than rcp 85 expected hausfather points out that current solar prices are below what the models think theyll be in 2050 and coal use has dropped a relnoopener hrefhttpsourworldindataorggraphercoalconsumptionpercapitatabchartcountryowid_wrl target_blankin recent yearsa in order for emissions to reach what rcp 85 imagined wed need to increase coal use per capita a relnoopener hrefhttpswwwsciencedirectcomsciencearticleabspiis0360544217314597page15 target_blankby about 700a from todays levels spectacularly reversing the recent declinep
pand this means that the really devastating levels of warming envisioned by rcp 85 are even less likely were probably looking at a situation of a relnoopener hrefhttpsthebreakthroughorgissuesenergy3cworld target_blank3c warminga above preindustrial levels compared with the 4c 5c or a relnoopener hrefhttpswwwtcdieeconomicsassetspdfseminars20152016gernot20wagnerampweitzmanpdf target_blankeven 6ca that a relnoopener hrefhttpsthebreakthroughorgissuesenergy3cworld target_blankrcp 85 predictsa as hausfather said in a relnoopener hrefhttpswwwnaturecomarticlesd41586020001773 target_blanka emnatureem piece last yeara 3c is still a catastrophic outcome but its a heck of a lot better than it used to bep
pits worth noting that while the emissions that get the world to rcp 85 are highly unlikely the outcomes that 85 predicts are still plausible one of the uncertainties in the climate is the feedbacks for instance as the world gets hotter ice melts ice reflects sunshine while dark earth absorbs it so the less ice there is the faster the world warms reducing ice thats a positive feedback system it tends to accelerate changesp
pon the flip side the more cosub2sub there is in the atmosphere the faster plants grow and the more they suck from the atmosphere thats a negative feedback system and it tends to moderate changesp
diva hrefhttpsunherdcom202107thecorrosivetribalismofclimatesciencerefinnara hrefhttpsunherdcom202107thecorrosivetribalismofclimatesciencerefinnarimg srchttpsunherdcomwpcontentuploads202107gettyimages12341859831300x200jpgadiva hrefhttpsunherdcom202107thecorrosivetribalismofclimatesciencerefinnarspansuggested readingspanaa hrefhttpsunherdcom202107thecorrosivetribalismofclimatesciencerefinnarh5can we trust the climate scientistsh5apa hrefhttpsunherdcom202107thecorrosivetribalismofclimatesciencerefinnarspanbyspan tom chiversapdivadiv
pthe exact magnitude of the many possible feedback systems in the atmosphere is uncertain as the siberian permafrost melts will it release gigatonnes of cosub2sub it is possible that even under more optimistic emissions scenarios the feedback systems will push more carbon into the atmosphere so we end up with the same cosub2sub concentrations as we would have done under rcp 85 and theres another layer of uncertainty which is climate sensitivity its not precisely known how much warming a given increase in cosub2sub concentrations will cause perhaps even if the amount of carbon in the atmosphere is relatively low the warming will be greater although that a relnoopener hrefhttpswwwcarbonbrieforgipcchowthear6wg1summaryforpolicymakerscomparestoitspredecessor target_blanknow looks less likelyap
pso really bad outcomes are possible even without rcp 85level emissions wed have to get incredibly unlucky with feedbacks for the world to end up warming that much says hausfather but we cant eliminate the possibilityp
pas a result theres an ongoing row among academics about whether rcp 85 and its equally pessimistic successorsupa hrefhttpsunherdcom202111thegreatclimatechangefallacyen25474922asup should be used at all a relnoopener hrefhttpswwwcoloradoeduenvsrogerpielkejr target_blankroger pielke jra a professor of public policy and environmental studies at the university of colorado boulder argues that it essentially has no place that its based on an implausible scenario even if you could end up somewhere similar because of uncertainties elsewhere two wrongs dont make a right he saysp
pbut a relnoopener hrefhttpsgeographyexeteracukstaffweb_idrichard_betts target_blankrichard bettsa a climate scientist at exeter university and the met office and one of the authors of the uk governmentsa relnoopener hrefhttpswwwukclimateriskorg target_blank climate change risk assessmenta argues differently we need to be aware of the risks of these 4c worlds that we could plausibly still find ourselves in he says and theres been lots of research done on worlds like that mostly using rcp 85p
pa relnoopener hrefhttpswwwgissnasagovstaffgschmidt target_blankgavin schmidta the director of nasas goddard institute adds that using extreme scenarios allows modellers to tease out causality in a way that more narrow ones dont it allows you to see nonlinearity allows you to look for thresholds he says you get a stronger signal to noise ratio the actual emission scenarios are less likely he agrees but studying them helps us understand the climate system betterp
diva hrefhttpsunherdcom202105howsciencehasbeencorruptedrefinnara hrefhttpsunherdcom202105howsciencehasbeencorruptedrefinnarimg srchttpsunherdcomwpcontentuploads202105gettyimages1211656392594x5941300x194jpgadiva hrefhttpsunherdcom202105howsciencehasbeencorruptedrefinnarspansuggested readingspanaa hrefhttpsunherdcom202105howsciencehasbeencorruptedrefinnarh5how science has been corruptedh5apa hrefhttpsunherdcom202105howsciencehasbeencorruptedrefinnarspanbyspan matthew crawfordapdivadiv
pthe trouble is that if a journalist sees two graphs in a study one of a plausible rcp 45 world and one of a much more dramatic rcp 85 world theyll probably want to run the rcp 85 graph because its more impressive says hausfather and theyll say scientists predict this much sea level rise or this many heat deaths and its not accurate because youd need to add but only if we burn all our coal or get very unluckyp
ptheres also a risk that rcp 85 will crowd out research into other areas for instance our world in datas a relnoopener hrefhttpsourworldindataorgcoralreefstounderstandtheimpactofclimatechangeandoceanacidificationoncoralreefsweneedmoreexperimentsatlowerlevelsofwarmingandco3csub3e23csub3econcentrations20target_blank20relnoopener3erecent20efforts20to20understand20human20impacts20on20biodiversity3ca3e20have20been20hampered20because203ca20href target_blankalmost all the researcha into coral reef collapse has been carried out using rcp 85 predictably enough a relnoopener hrefhttpsourworldindataorgcoralreefstounderstandtheimpactofclimatechangeandoceanacidificationoncoralreefsweneedmoreexperimentsatlowerlevelsofwarmingandco3csub3e23csub3econcentrations20target_blank20relnoopener3eall20the20coral20dies20in20that20scenario3ca3e20but20what20would20coral20reefs20look20like20under202c20of20warming20or203c20we20dont20really20know3cp3e target_blanklongstanding mutual animositya and schmidt feels pielke jr has spent 20 years trying to elbow out scientists from the centre ground on climate change so its hard for a journalist to get involved without taking sidesp
pbut its important because the more we associate the worstcase scenario with business as usual the more pessimistic the public debate will be it might demotivate people says hausfather its much easier to see the paris goals [of no more than 15c warming] as achievable if you know were on course for a 3c world rather than a 5c onep
diva hrefhttpsunherdcom202007whywestoppedtrustingexpertsrefinnara hrefhttpsunherdcom202007whywestoppedtrustingexpertsrefinnarimg srchttpsunherdcomwpcontentuploads202007gettyimages671580868e1594809567505300x183jpgadiva hrefhttpsunherdcom202007whywestoppedtrustingexpertsrefinnarspansuggested readingspanaa hrefhttpsunherdcom202007whywestoppedtrustingexpertsrefinnarh5why we stopped trusting expertsh5apa hrefhttpsunherdcom202007whywestoppedtrustingexpertsrefinnarspanbyspan oliver traldiapdivadiv
pi disagree with pielke jr rcp 85 has its place because as betts says theres a whole range of research into unlikely but plausible scenarios using it and if youre doing risk assessments you need to look at outcomes that a relnoopener hrefhttpsunherdcom202004couldanyonehavepredictedcovid19 target_blankprobably wont happen but which would be disastrous if they dida so you can try to avoid them at the moment the papers looking at those scenarios all use 85p
pbut on the other hand if the ipcc puts out rcps without explicitly saying which are the most likely then policymakers and journalists will take whichever scenario most suits their needs whether thats pretending theres no problem or magnifying the problem for the sake of a headline this isnt the fault of climate modellers but no one involved in the ipcc is explicitly saying rcp 85 is pretty unlikely and that fateful phrase business as usual is still attached to itp
phausfather has a solution for this attach explicit percentage likelihoods to the different scenarios say that rcp 45 is 45 probable or rcp 85 is 5 probable theyd be necessarily subjective but at least it would show that no one thinks theyre all equally likely or that rcp 85 is the course were already on betts agreesp
ptheres a risk that climate sceptics will leap on ideas like this and say that climate scientists have systematically overstated the risk of climate change betts says that this already happens but climate change is a relnoopener hrefhttpswwwcislcamacukresourcessustainablefinancepublicationsunhedgeablerisk target_blankan unhedgeable riska and we need to pay attention to even unlikely outcomes if theyre very bad in the same way that you wouldnt play russian roulette even if its only a 17 chance of death besides even the less dramatic 3c worlds involve dangerous levels of sea level rise heat waves and millions of unnecessary deaths a year youd think thatd be worrying enoughp
pevery week people see headlines based on a relnoopener hrefhttpswwwpnasorgcontent1172111350 target_blankrcp 85 scenariosa that say things like a relnoopener hrefhttpswwwftcomcontent072b5c877330459ba947be6767a1099d target_blankthree billion people could face nearunliveable conditions aby 2070 understandably people are rattled and some are even saying theyre a relnoopener hrefhttpsastralcodextensubstackcomppleasedontgiveuponhavingkids target_blanknot having childrena people are more scared than they need to bep
pclimate change is extremely bad but were not in the last chance saloon if that means that we face some inevitable catastrophe or 51 down and facing ruinous defeat and the politicians at cop26 are not guilty of facilitating a worse genocide than hitlers archbishop welby a relnoopener hrefhttpstwittercomjustinwelbystatus1455207850213617665 target_blankapologised afor that but its an understandable mistake if hes always being told that business as usual means a march to doomp
div
h6footnotes
ol
li spanthe numbers refer to the amount of spana relnoopener hrefhttpsenwikipediaorgwikiradiative_forcingipcc_usage target_blankspanradiative forcingspanaspan that is the change to the earths energy balance in watts per metre squared so under rcp 60 each square metre of the earths surface would absorb six more watts of energy than it would lose to space relative to preindustrial times
li spanin the latest ipcc report the rcps have been replaced with something else called ssps only one of the new ssps ssp5 is compatible with rcp 85 research using both is combined into a scenario called ssp585 im going to refer to rcps throughout for simplicity
a hrefhttpsunherdcom202111thegreatclimatechangefallacyappcommentsview 6 commentsaspanspanolh6div | pwe literally chance saloon relnoopener hrefhttpswwwtheguardiancomenvironment2021oct31cop26literallythelastchancesaloontosaveplanetprincecharles target_blanksays prince charlesa humanity 51 halftime relnoopener hrefhttpswwwtheguardiancomenvironment2021oct29cop26humanity51halftimeclimatecrisisborisjohnson target_blanksays boris johnsona people curse generation politicians worse appeased hitler relnoopener hrefhttpstwittercombbclaurakstatus1455208478994206720 target_blanksays justin welbya archbishop canterbury allowing genocide infinitely greater scalep pare things bad read headlines yes course disaster dont turning business usual lead relnoopener hrefhttpswwwnytimescom20210211opinionclimatechangehimalayashtml target_blanka catastrophic collapse himalayan glaciersa relnoopener hrefhttpswwwnytimescom20210721opinionclimatechangeheatwaveshtml target_blankdevastating heatwavesa southern united states according emnew york timesem whats newspaper relnoopener hrefhttpswwwnytimescomarticleclimatechangeglobalwarmingfaqhtml target_blanksaid weeka ahead cop26 continue business usual end century hot outside heat waves middle east south asiap pbut stories share thing based ipccs rcp 85 scenario exciting 85 described business usual headlinesp prcp 85 business usual unlikely worst case means large fraction public debate climate change mitigation driven increasingly implausible scenario unlikely proposed focus scenario pessimistic hopeless situation seemp divdiv pback 2007 relnoopener hrefhttpswwwipccchassessmentreportar4 target_blankthe fourth ipcc reporta published climate scientists wanted create new emissions scenarios imagining change coming decades impact climate relnoopener hrefhttpswwwnaturecomarticlesnature08823 target_blanka plana indepth scenarios ahead fifth report 2013 scientists need start running models report soon 2010 needed meantimep pso representative concentration pathways rcps developed rcp 26 45 60 85supa hrefhttpsunherdcom202111thegreatclimatechangefallacyen25474911asup roughly speaking highly optimistic scenario emissions middling scenarios highly pessimistic rcp 85 realistic worst case time viewed unlikely unfortunate things confused picturep pfirst rcps 85 imagined world climate policy second authors relnoopener hrefhttpslinkspringercomarticle101007s105840110149y target_blankdescribed ita highemission business usual scenario meaning high end emissions business usual taken mean quarters high emissions business usualp pso rcp 85 synonymous business usual dozens studies published year relnoopener hrefhttpsscholargooglecomscholarhlenas_sdt06qrcp8522businessasusual22scisbd1 target_blankdescribing sucha relnoopener hrefhttpswwwnaturecomarticless41612021001787 target_blanksaysa businessasusual lead super ultraextreme heatwaves middle east north africa mainstream climate sciencep pthe problem isnt people study scenarios says relnoopener hrefhttpsthebreakthroughorgpeoplezekehausfather target_blankzeke hausfathera climate scientist breakthrough institute frame likely outcome absence policy probably true im sure true nowp pmost obviously dont live world climate policies relnoopener hrefhttpswwweeaeuropaeuthemesclimatechangeadaptationglobalclimatechangepolicies target_blankparis protocolsa commit signatories goals keeping warming 2c aiming 15c business usual global effort reduce emissionsp diva hrefhttpsunherdcom201909whyclimatechangeisnttheendoftheworldrefinnara hrefhttpsunherdcom201909whyclimatechangeisnttheendoftheworldrefinnarimg srchttpsunherdcomwpcontentuploads201909gettyimages1163398643300x200jpgadiva hrefhttpsunherdcom201909whyclimatechangeisnttheendoftheworldrefinnarspansuggested readingspanaa hrefhttpsunherdcom201909whyclimatechangeisnttheendoftheworldrefinnarh5why climate change isnt end worldh5apa hrefhttpsunherdcom201909whyclimatechangeisnttheendoftheworldrefinnarspanbyspan tom chiversapdivadiv psecond important world changed energy mix far faster rcp 85 expected hausfather points current solar prices models think theyll 2050 coal use dropped relnoopener hrefhttpsourworldindataorggraphercoalconsumptionpercapitatabchartcountryowid_wrl target_blankin recent yearsa order emissions reach rcp 85 imagined wed need increase coal use capita relnoopener hrefhttpswwwsciencedirectcomsciencearticleabspiis0360544217314597page15 target_blankby 700a todays levels spectacularly reversing recent declinep pand means devastating levels warming envisioned rcp 85 likely probably looking situation relnoopener hrefhttpsthebreakthroughorgissuesenergy3cworld target_blank3c warminga preindustrial levels compared 4c 5c relnoopener hrefhttpswwwtcdieeconomicsassetspdfseminars20152016gernot20wagnerampweitzmanpdf target_blankeven 6ca relnoopener hrefhttpsthebreakthroughorgissuesenergy3cworld target_blankrcp 85 predictsa hausfather said relnoopener hrefhttpswwwnaturecomarticlesd41586020001773 target_blanka emnatureem piece yeara 3c catastrophic outcome heck lot better bep pits worth noting emissions world rcp 85 highly unlikely outcomes 85 predicts plausible uncertainties climate feedbacks instance world gets hotter ice melts ice reflects sunshine dark earth absorbs ice faster world warms reducing ice thats positive feedback system tends accelerate changesp pon flip cosub2sub atmosphere faster plants grow morethey suck atmosphere thats negative feedback system tends moderate changesp diva hrefhttpsunherdcom202107thecorrosivetribalismofclimatesciencerefinnara hrefhttpsunherdcom202107thecorrosivetribalismofclimatesciencerefinnarimg srchttpsunherdcomwpcontentuploads202107gettyimages12341859831300x200jpgadiva hrefhttpsunherdcom202107thecorrosivetribalismofclimatesciencerefinnarspansuggested readingspanaa hrefhttpsunherdcom202107thecorrosivetribalismofclimatesciencerefinnarh5can trust climate scientistsh5apa hrefhttpsunherdcom202107thecorrosivetribalismofclimatesciencerefinnarspanbyspan tom chiversapdivadiv pthe exact magnitude possible feedback systems atmosphere uncertain siberian permafrost melts release gigatonnes cosub2sub possible optimistic emissions scenarios feedback systems push carbon atmosphere end cosub2subconcentrations rcp 85 theres layer uncertainty climate sensitivity precisely known warming given increase cosub2subconcentrations cause carbon atmosphere relatively low warming greater relnoopener hrefhttpswwwcarbonbrieforgipcchowthear6wg1summaryforpolicymakerscomparestoitspredecessor target_blanknow looks likelyap pso bad outcomes possible rcp 85level emissions wed incredibly unlucky feedbacks world end warming says hausfather cant eliminate possibilityp pas result theres ongoing row academics rcp 85 equally pessimistic successorsupa hrefhttpsunherdcom202111thegreatclimatechangefallacyen25474922asup relnoopener hrefhttpswwwcoloradoeduenvsrogerpielkejr target_blankroger pielke jra professor public policy environmental studies university colorado boulder argues essentially place based implausible scenario end similar uncertainties wrongs dont right saysp pbut relnoopener hrefhttpsgeographyexeteracukstaffweb_idrichard_betts target_blankrichard bettsa climate scientist exeter university met office authors uk governmentsa relnoopener hrefhttpswwwukclimateriskorg target_blank climate change risk assessmenta argues differently need aware risks 4c worlds plausibly find says theres lots research worlds like rcp 85p pa relnoopener hrefhttpswwwgissnasagovstaffgschmidt target_blankgavin schmidta director nasas goddard institute adds extreme scenarios allows modellers tease causality way narrow ones dont allows nonlinearity allows look thresholds says stronger signal noise ratio actual emission scenarios likely agrees studying helps understand climate system betterp diva hrefhttpsunherdcom202105howsciencehasbeencorruptedrefinnara hrefhttpsunherdcom202105howsciencehasbeencorruptedrefinnarimg srchttpsunherdcomwpcontentuploads202105gettyimages1211656392594x5941300x194jpgadiva hrefhttpsunherdcom202105howsciencehasbeencorruptedrefinnarspansuggested readingspanaa hrefhttpsunherdcom202105howsciencehasbeencorruptedrefinnarh5how science corruptedh5apa hrefhttpsunherdcom202105howsciencehasbeencorruptedrefinnarspanbyspan matthew crawfordapdivadiv pthe trouble journalist sees graphs study plausible rcp 45 world dramatic rcp 85 world theyll probably want run rcp 85 graph impressive says hausfather theyll scientists predict sea level rise heat deaths accurate youd need add burn coal unluckyp ptheres risk rcp 85 crowd research areas instance world datas relnoopener hrefhttpsourworldindataorgcoralreefstounderstandtheimpactofclimatechangeandoceanacidificationoncoralreefsweneedmoreexperimentsatlowerlevelsofwarmingandco3csub3e23csub3econcentrations20target_blank20relnoopener3erecent20efforts20to20understand20human20impacts20on20biodiversity3ca3e20have20been20hampered20because203ca20href target_blankalmost researcha coral reef collapse carried rcp 85 predictably relnoopener hrefhttpsourworldindataorgcoralreefstounderstandtheimpactofclimatechangeandoceanacidificationoncoralreefsweneedmoreexperimentsatlowerlevelsofwarmingandco3csub3e23csub3econcentrations20target_blank20relnoopener3eall20the20coral20dies20in20that20scenario3ca3e20but20what20would20coral20reefs20look20like20under202c20of20warming20or203c20we20dont20really20know3cp3e target_blanklongstanding mutual animositya schmidt feels pielke jr spent 20 years trying elbow scientists centre ground climate change hard journalist involved taking sidesp pbut important associate worstcase scenario business usual pessimistic public debate demotivate people says hausfather easier paris goals [of 15c warming] achievable know course 3c world 5c onep diva hrefhttpsunherdcom202007whywestoppedtrustingexpertsrefinnara hrefhttpsunherdcom202007whywestoppedtrustingexpertsrefinnarimg srchttpsunherdcomwpcontentuploads202007gettyimages671580868e1594809567505300x183jpgadiva hrefhttpsunherdcom202007whywestoppedtrustingexpertsrefinnarspansuggested readingspanaa hrefhttpsunherdcom202007whywestoppedtrustingexpertsrefinnarh5why stopped trusting expertsh5apa hrefhttpsunherdcom202007whywestoppedtrustingexpertsrefinnarspanbyspan oliver traldiapdivadiv pi disagree pielke jr rcp 85 place betts says theres range research unlikely plausible scenarios youre risk assessments need look outcomes relnoopener hrefhttpsunherdcom202004couldanyonehavepredictedcovid19 target_blankprobably wont happen disastrous dida try avoid moment papers looking scenarios use 85p pbut hand ipcc puts rcps explicitly saying likely policymakers journalists whichever scenario suits needs thats pretending theres problem magnifying problem sake headline isnt fault climate modellers involved ipcc explicitly saying rcp 85 pretty unlikely fateful phrase business usual attached itp phausfather solution attach explicit percentage likelihoods different scenarios rcp 45 45 probable rcp 85 5 probable theyd necessarily subjective thinks theyre equally likely rcp 85 course betts agreesp ptheres risk climate sceptics leap ideas like climate scientists systematically overstated risk climate change betts says happens climate change relnoopener hrefhttpswwwcislcamacukresourcessustainablefinancepublicationsunhedgeablerisk target_blankan unhedgeable riska need pay attention unlikely outcomes theyre bad way wouldnt play russian roulette 17 chance death dramatic 3c worlds involve dangerous levels sea level rise heat waves millions unnecessary deaths year youd think thatd worrying enoughp pevery week people headlines based relnoopener hrefhttpswwwpnasorgcontent1172111350 target_blankrcp 85 scenariosa things like relnoopener hrefhttpswwwftcomcontent072b5c877330459ba947be6767a1099d target_blankthree billion people face nearunliveable conditions aby 2070 understandably people rattled saying theyre relnoopener hrefhttpsastralcodextensubstackcomppleasedontgiveuponhavingkids target_blanknot having childrena people scared need bep pclimate change extremely bad chance saloon means face inevitable catastrophe 51 facing ruinous defeat politicians cop26 guilty facilitating worse genocide hitlers archbishop welby relnoopener hrefhttpstwittercomjustinwelbystatus1455207850213617665 target_blankapologised afor understandable mistake hes told business usual means march doomp div h6footnotes ol lispanthe numbers refer spana relnoopener hrefhttpsenwikipediaorgwikiradiative_forcingipcc_usage target_blankspanradiative forcingspanaspan change earths energy balance watts metre squared rcp 60 square metre earths surface absorb watts energy lose space relative preindustrial times lispanin latest ipcc report rcps replaced called ssps new ssps ssp5 compatible rcp 85 research combined scenario called ssp585 im going refer rcps simplicity hrefhttpsunherdcom202111thegreatclimatechangefallacyappcommentsview 6 commentsaspanspanolh6div |
6181be9349dac1a54d9f5558 | The humiliation of the British Army | pspanthe armed forces and the army in particular are surely the only arms of the british state that still retain a popular reputation for institutional competence consider the recent bookspana relnoopener hrefhttpswwwamazoncoukhabitexcellencebritishleadershipworksdp0241507502 target_blank ispanthe habit of excellencespaniaspan a sort of retread for civilian ceos of the motivational anthologies handed out at sandhurst or the governmentsspana relnoopener hrefhttpsnewsskycomstorytopmilitarychiefappointedbygovernmenttoleadfarreachingreviewofnhsleadership12423548 target_blank spandrafting inspanaspan of the former vicechief of defence staff though a royal marine rather than a soldier to institute wideranging reforms to the nhs a clear nod to the militarys residual reputation for nononsense hardnosed efficiencyspanp
pit is difficult to square this perception with the armys shambolic and wasteful recent record in procurement and yet a sense lingers whether true or not that the armed forces remain a refuge area for a type of stoic effectiveness lost to the rest of the country an ability to get the job done without complaint against intimidating oddsp
divdiv
pspanthis may say as much about britain as a whole as it does of the armed forces itself consider the wave of affectionate sentimentality about the army perhaps a workingclass analogue of middleclass sentimentality about the nhs which swept the country in the late 2000s the popular mood at the time manifest in the help for heroes campaign est 2007 and the spanispansunspanispans military awardsspan spanest 2008 was immediately inflamed by the sense that troops in the field were being put in harms way by the governments budget cuts and by dissatisfaction with heckling and burning of poppies by jihadist sympathisers as troops paraded home from afghanistan then the army was a potent symbol of a pure betrayed institution around which the british people could explore its wider anxieties a metaphor for growing unease with the direction of the british state itselfspanp
pspanyet even the armys most devoted supporter would be forced to admit that the past two decades have not enhanced its reputation both the labour governments two wars of choice were painful strategic and tactical failures entered into with little popular enthusiasm and abandoned with little fanfare in both wars units and individual soldiers fought bravely on a tactical level in pursuit of misguided and ultimately fruitless strategic aims spanp
diva hrefhttpsunherdcom202110crisisisthenewnormalrefinnara hrefhttpsunherdcom202110crisisisthenewnormalrefinnarimg srchttpsunherdcomwpcontentuploads2021102gettyimages870601034scalede16344915347321024x6141300x180jpgadiva hrefhttpsunherdcom202110crisisisthenewnormalrefinnarspanmore from this authorspanaa hrefhttpsunherdcom202110crisisisthenewnormalrefinnarh5crisis is the new normalh5apa hrefhttpsunherdcom202110crisisisthenewnormalrefinnarspanbyspan aris roussinosapdivadiv
pspanit is within this context that two recent books aim to dissect the armys failings in iraq and afghanistan to make sense of this lacklustre performance in spana relnoopener hrefhttpswwwamazoncoukchangingguardbritisharmysincedp1913348482 target_blankispanthe changing of the guardspaniaspan simon akam a former gapyear officer chronicles the army like a disappointed lover twisting the knife into the institutions sorest wounds in spana relnoopener hrefhttpswwwamazoncoukbloodmetaldustafghanistan200114dp1472831012 target_blankispanblood metal and dustspaniaispanspanispan brigadier ben barry a former director of the british army staff chooses a higher target yes the successes of the small interventions of the nineties had led military chiefs to rest on their laurels so that operational success had become the mother of complacency but for barry whose book draws from his stillclassified official postmortem of the post911 wars the ultimate cause of failure can be placed at the hands of the labour politicians managing the war spanp
pspanboth retell the bare painful facts of the armys two most recent defeats in iraq the initial capture and occupation of basra entered into with soft hats and the selfcongratulatory confidence of an army that believed it led the world in peacekeeping and counterinsurgency ended in a humiliating negotiated withdrawal of british forces to the edge of the city where pinned down by constant bombardment by the shia militias who now ran the city they lost all capacity to exert their influence spanp
pspanthe americans distinctly unimpressed at the failure of the british officers were forced to help iraqi forces retake the city in 2008s spana relnoopener hrefhttpswwwunderstandingwarorgoperationoperationknightschargesaulatalfursan target_blankspancharge of the knights operationspanaspan a humiliation for britain this damaged the reputation of british forces with the us and the iraqis and inflicted major dents in british military selfconfidence barry notes akam is less stoic describing it as an acute and lasting humiliation to the british army which will linger and follow the troops halfway around the world to afghanistanspanp
pspanindeed to exercise this ghost britains political and military leaders recklessly volunteered for a campaign in a helmand landscape of walled farms and thick vegetation which the soviets had struggled to pacify even while the army struggled with iraq in afghanistan they believed the army would regain its reputation leaving the difficulties of iraq behindspanp
pspanthey were wrong thinly spread out in isolated rural compounds or platoon houses british troops were besieged by waves of taliban fighters and only avoided being overrun through devastating use of air power which in turn alienated the civilians whose homes it destroyed along with a desperate need to avoid casualties the reliance on shortranged patrols magnets for taliban ambushes and bogged down by ieds meant that the army could never retain tactical dominance in the countryside let alone gain the strategic initiative spanp
pspanas in basra force protection became the dominant goal and so initiative passed to the local enemy attempts to upend the balance of power through bold but misconceived operations like operation panthers claw or through grandiose heartsandminds schemes like the transporting of a gigantic turbine through taliban territory to the dam where it would remain unused for years all failed spanspanin afghanistan as in iraq the rich tribute of blood and treasure britain poured into the dust was entirely in vainspanp
diva hrefhttpsunherdcom202110thetoriescansavebluelabourrefinnara hrefhttpsunherdcom202110thetoriescansavebluelabourrefinnarimg srchttpsunherdcomwpcontentuploads2021102gettyimages1233914758scalede1633965805482copy300x158jpgadiva hrefhttpsunherdcom202110thetoriescansavebluelabourrefinnarspanmore from this authorspanaa hrefhttpsunherdcom202110thetoriescansavebluelabourrefinnarh5the tories can save blue labourh5apa hrefhttpsunherdcom202110thetoriescansavebluelabourrefinnarspanbyspan aris roussinosapdivadiv
pspanwhere does the blame lie barry lambasts labour politicians such as clare short whose intransigent refusal to provide the british troops who found themselves suddenly governing basra a city of 15 million people with even basic dfid support due to her opposition to the war did much to incite local anger in the first vital weeks and months of occupation he takes aim at gordon brown who as chancellor forced through defence cuts that reduced the armys helicopter fleet and then lied about it as prime minister when soldiers died in helmand as a direct result spanp
pspanbut he reserves his greatest ire for the architect of britains entry into these needless wars tony blair yet as barry makes clear military chiefs also failed to impress upon politicians the need to reassess their strategy in light of their failing mission the plainspeaking and sober appreciation of hard facts for which the army is renowned were here tragically absentspanp
pspanfor akam much of the blame can be laid at the army itself he draws an ethnographic portrait of an institution struggling to make sense of a changing world whose cherished regimental ethos the wellspring of individual pride and striving for excellence also reduces it to an awkwardly organised collection of warring tribes inadequately coordinated and often fighting each other fearful of future cuts generals volunteer the army for the underestimated helmand mission even as iraq is failing its use them or lose them akam quotes general sir richard dannett on the illfated decision generals tell politicians what they want to hear instead of the difficult truths that would blight promotion the british armys determination to crack on got the army into a terrible mess spanp
pspanfor akam the absence of accountability for such failure is corrosive to the armys capability junior ranks are hauled before the courts for individual war crimes rightly he feels while generals are rewarded for strategic failure with titles and sinecures unlike in israel where the failure of the 2006 lebanon war led to a purge of failed senior officers no british general was fired or resigned over iraq and afghanistan the result for akam is institutional rot that hypocrisy had trickled down into the institution below them and was souring it spanp
pspanmoreover akam asserts defence think tanks such as spana relnoopener hrefhttpsrusiorg target_blankspanrusispanaspan can seem more like comfy clubs funded partly by arms manufacturers friendly forces in the forces jargon than rigorous external overseers inhibiting them from guiding the army through painful reform spanp
diva hrefhttpsunherdcom202109howbinladensprophesiescametruerefinnara hrefhttpsunherdcom202109howbinladensprophesiescametruerefinnarimg srchttpsunherdcomwpcontentuploads202104gettyimages113634012e1619795169874300x151jpgadiva hrefhttpsunherdcom202109howbinladensprophesiescametruerefinnarspanmore from this authorspanaa hrefhttpsunherdcom202109howbinladensprophesiescametruerefinnarh5how bin laden wonh5apa hrefhttpsunherdcom202109howbinladensprophesiescametruerefinnarspanbyspan aris roussinosapdivadiv
pspanthe american presence looms large over both books like a victorian father whose approval is yearned for yet who emanates instead only cold disappointment the tragic irony as both akam and barry note was that both the basra and helmand campaigns were entered into entirely to win blair cachet in american eyes yet the result of the armys disappointing performance was only american disdain as akam notes of his soldier informants on the eve of the iraq invasion many appreciate that the real reason they are here is to maintain british military standing in american eyes spanp
pspanyet even during the invasion itself before the humiliating retreat the winnowing capacity of the british state had already lowered the armys reputation in american eyes basra just over the border from kuwait was chosen as britains target in akams telling because the armys recent adoption of justintime logistics had left it with insufficient spare parts to travel any further lack of armoured vehicles of body armour helicopters even ammunition left the army scrounging what it could from unimpressed americans and almost entirely equipping itself through emergency treasury funds spanp
pspanciting longago malaya and morerecent northern ireland as if that were an unqualified military success in its favour the army deflected its sense of insecurity at its vastly reduced capacity compared to the us with an arrogant and ultimately mistaken belief that populationcentric counterinsurgency was its unequalled spanispanmtierspanispan american officers quoted by barry rolled their eyes at more british tripe as events proved otherwise spanp
pspanbut even the americans whose resources were limitless in comparison ultimately lost both wars as barry observes the us governments decision to invade iraq must stand as the worst military decision of the 21st century it was a military strategic folly on a level equal to that of napoleons 1812 attack on russia and hitlers 1941 attack on the soviet union the failure then was ultimately a political one of british politicians blindly following their american patrons into unwinnable wars the armys essential sin was only one of trying to do the best of a bad job a not ignoble character flaw spanp
pspanit is difficult to avoid the painful conclusion that the british army functions for the americans as the gurkhas do for the british army a highly motivated loyal auxiliary force incapable of prosecuting a campaign on its own whose colourful traditions still carry the romance of an earlier more glorious era spanp
pspantoday however even this limited role is now in doubt with the governments new focus on naval capacity and the muchvaunted pacific tilt forming the basis of britains defence vision the incoming chief of general staff admiral sir tony radikin is spana relnoopener hrefhttpswwwdailymailcouknewsarticle10074159amparmyplanshugecutsinfantrytroopsaxedhtml target_blankspanallegedly poisedspanaspan to oversee a dramatic cut in the armys alreadydangerously pareddown numbers cutting infantry ranks by more than one third of its current numbers spanp
diva hrefhttpsunherdcom202110americasforgottenpowelldoctrinerefinnara hrefhttpsunherdcom202110americasforgottenpowelldoctrinerefinnarimg srchttpsunherdcomwpcontentuploads2021102gettyimages1251381800scalede1634820922156300x168jpgadiva hrefhttpsunherdcom202110americasforgottenpowelldoctrinerefinnarspansuggested readingspanaa hrefhttpsunherdcom202110americasforgottenpowelldoctrinerefinnarh5americas forgotten powell doctrineh5apa hrefhttpsunherdcom202110americasforgottenpowelldoctrinerefinnarspanbyspan edward luttwakapdivadiv
pspanthe best little army in the world may be getting littler but it is not for the better as the defence analyst spana relnoopener hrefhttpswwwforcesnetnewsbritisharmyclosebeingcombatincapableagainsthighendthreats target_blankspanfrancis tusa warnsspanaspan the result of its decadeslong and selfinflicted procurement woes is that it is now more or less combat incapable against highend threats two decades of fighting poorlyequipped insurgents has distracted the army from its primary mission of defending the country against a competent and wellequipped adversary like russia or chinaspanp
pspanperhaps this is less a disaster than it may at first seem the danger is not so much the armys incapacity as our politicians inability to match their ambitions to its resources or the moral courage of its generals to gently dissuade them for all that we mock germany its military weakness it is not abundantly clear that britain has gained much for the decade or so of warfare that the germans managed to avoid after blairs promiscuous use of the army to assuage his lust for glory perhaps a period of enforced abstinence might do the institution some good if it is to reequip itself for the graver and unchosen challenges of the coming century spanp
pspanthe armys focus on the new ranger battalions tasked with training and directing local partner forces in place of line infantry hints at a world of conflict where the business of fighting is increasingly left to expendable proxies yet a shrunken more tightlyfocussed army also presents a challenge for a denuded british state which has increasingly come to rely on soldiers to make up for its own lost capacityspanp
pspanits willingness to take on tasks outside its core role may fend off cutbacks for a time but is not necessarily in its own or the states best interests it distracts from its urgent task of modernisation and reorganisation and gives british governments cover to further winnow away state capacity confident that soldiers will always be there spana hrefhttpswwwindependentcouksportolympics13500militarypersonneldraftedlondon2012olympics6277442htmlspanto pick up the slackspanaspan spanp
pspanas the chilcot report on iraq observed a can do attitude is laudably ingrained in the uk armed forces a determination to get on with the job however difficult the circumstances but this can prevent ground truth from reaching senior ears perhaps the armys capacity to win the next war like the british states to weather the next crisis would be better served by generals finding the courage when necessary to tell politicians that some things simply cant or shouldnt be donespanp
a hrefhttpsunherdcom202111thehumiliationofthebritisharmyappcommentsview 8 commentsa | pspanthe armed forces army particular surely arms british state retain popular reputation institutional competence consider recent bookspana relnoopener hrefhttpswwwamazoncoukhabitexcellencebritishleadershipworksdp0241507502 target_blank ispanthe habit excellencespaniaspan sort retread civilian ceos motivational anthologies handed sandhurst governmentsspana relnoopener hrefhttpsnewsskycomstorytopmilitarychiefappointedbygovernmenttoleadfarreachingreviewofnhsleadership12423548 target_blank spandrafting inspanaspan vicechief defence staff royal marine soldier institute wideranging reforms nhs clear nod militarys residual reputation nononsense hardnosed efficiencyspanp pit difficult square perception armys shambolic wasteful recent record procurement sense lingers true armed forces remain refuge area type stoic effectiveness lost rest country ability job complaint intimidating oddsp divdiv pspanthis britain armed forces consider wave affectionate sentimentality army workingclass analogue middleclass sentimentality nhs swept country late 2000s popular mood time manifest help heroes campaign est 2007 spanispansunspanispans military awardsspan spanest 2008 immediately inflamed sense troops field harms way governments budget cuts dissatisfaction heckling burning poppies jihadist sympathisers troops paraded home afghanistan army potent symbol pure betrayed institution british people explore wider anxieties metaphor growing unease direction british state itselfspanp pspanyet armys devoted supporter forced admit past decades enhanced reputation labour governments wars choice painful strategic tactical failures entered little popular enthusiasm abandoned little fanfare wars units individual soldiers fought bravely tactical level pursuit misguided ultimately fruitless strategic aimsspanp diva hrefhttpsunherdcom202110crisisisthenewnormalrefinnara hrefhttpsunherdcom202110crisisisthenewnormalrefinnarimg srchttpsunherdcomwpcontentuploads2021102gettyimages870601034scalede16344915347321024x6141300x180jpgadiva hrefhttpsunherdcom202110crisisisthenewnormalrefinnarspanmore authorspanaa hrefhttpsunherdcom202110crisisisthenewnormalrefinnarh5crisis new normalh5apa hrefhttpsunherdcom202110crisisisthenewnormalrefinnarspanbyspan aris roussinosapdivadiv pspanit context recent books aim dissect armys failings iraq afghanistan sense lacklustre performance spana relnoopener hrefhttpswwwamazoncoukchangingguardbritisharmysincedp1913348482 target_blankispanthe changing guardspaniaspan simon akam gapyear officer chronicles army like disappointed lover twisting knife institutions sorest wounds spana relnoopener hrefhttpswwwamazoncoukbloodmetaldustafghanistan200114dp1472831012 target_blankispanblood metal dustspaniaispanspanispan brigadier ben barry director british army staff chooses higher target yes successes small interventions nineties led military chiefs rest laurels operational success mother complacency barry book draws stillclassified official postmortem post911 wars ultimate cause failure placed hands labour politicians managing warspanp pspanboth retell bare painful facts armys recent defeats iraq initial capture occupation basra entered soft hats selfcongratulatory confidence army believed led world peacekeeping counterinsurgency ended humiliating negotiated withdrawal british forces edge city pinned constant bombardment shia militias ran city lost capacity exert influencespanp pspanthe americans distinctly unimpressed failure british officers forced help iraqi forces retake city 2008s spana relnoopener hrefhttpswwwunderstandingwarorgoperationoperationknightschargesaulatalfursan target_blankspancharge knights operationspanaspan humiliation britain damaged reputation british forces iraqis inflicted major dents british military selfconfidence barry notes akam stoic describing acute lasting humiliation british army linger follow troops halfway world afghanistanspanp pspanindeed exercise ghost britains political military leaders recklessly volunteered campaign helmand landscape walled farms thick vegetation soviets struggled pacify army struggled iraq afghanistan believed army regain reputation leaving difficulties iraq behindspanp pspanthey wrong thinly spread isolated rural compounds platoon houses british troops besieged waves taliban fighters avoided overrun devastating use air power turn alienated civilians homes destroyed desperate need avoid casualties reliance shortranged patrols magnets taliban ambushes bogged ieds meant army retain tactical dominance countryside let gain strategic initiative spanp pspanas basra force protection dominant goal initiative passed local enemy attempts upend balance power bold misconceived operations like operation panthers claw grandiose heartsandminds schemes like transporting gigantic turbine taliban territory dam remain unused years failedspanspanin afghanistan iraq rich tribute blood treasure britain poured dust entirely vainspanp diva hrefhttpsunherdcom202110thetoriescansavebluelabourrefinnara hrefhttpsunherdcom202110thetoriescansavebluelabourrefinnarimg srchttpsunherdcomwpcontentuploads2021102gettyimages1233914758scalede1633965805482copy300x158jpgadiva hrefhttpsunherdcom202110thetoriescansavebluelabourrefinnarspanmore authorspanaa hrefhttpsunherdcom202110thetoriescansavebluelabourrefinnarh5the tories save blue labourh5apa hrefhttpsunherdcom202110thetoriescansavebluelabourrefinnarspanbyspan aris roussinosapdivadiv pspanwhere blame lie barry lambasts labour politicians clare short intransigent refusal provide british troops found suddenly governing basra city 15 million people basic dfid support opposition war incite local anger vital weeks months occupation takes aim gordon brown chancellor forced defence cuts reduced armys helicopter fleet lied prime minister soldiers died helmand direct resultspanp pspanbut reserves greatest ire architect britains entry needless wars tony blair barry makes clear military chiefs failed impress politicians need reassess strategy light failing mission plainspeaking sober appreciation hard facts army renowned tragically absentspanp pspanfor akam blame laid army draws ethnographic portrait institution struggling sense changing world cherished regimental ethos wellspring individual pride striving excellence reduces awkwardly organised collection warring tribes inadequately coordinated fighting fearful future cuts generals volunteer army underestimated helmand mission iraq failing use lose akam quotes general sir richard dannett illfated decision generals tell politicians want hear instead difficult truths blight promotion british armys determination crack got army terrible messspanp pspanfor akam absence accountability failure corrosive armys capability junior ranks hauled courts individual war crimes rightly feels generals rewarded strategic failure titles sinecures unlike israel failure 2006 lebanon war led purge failed senior officers british general fired resigned iraq afghanistan result akam institutional rot hypocrisy trickled institution souring itspanp pspanmoreover akam asserts defence think tanks spana relnoopener hrefhttpsrusiorg target_blankspanrusispanaspan like comfy clubs funded partly arms manufacturers friendly forces forces jargon rigorous external overseers inhibiting guiding army painful reformspanp diva hrefhttpsunherdcom202109howbinladensprophesiescametruerefinnara hrefhttpsunherdcom202109howbinladensprophesiescametruerefinnarimg srchttpsunherdcomwpcontentuploads202104gettyimages113634012e1619795169874300x151jpgadiva hrefhttpsunherdcom202109howbinladensprophesiescametruerefinnarspanmore authorspanaa hrefhttpsunherdcom202109howbinladensprophesiescametruerefinnarh5how bin laden wonh5apa hrefhttpsunherdcom202109howbinladensprophesiescametruerefinnarspanbyspan aris roussinosapdivadiv pspanthe american presence looms large books like victorian father approval yearned emanates instead cold disappointment tragic irony akam barry note basra helmand campaigns entered entirely win blair cachet american eyes result armys disappointing performance american disdain akam notes soldier informants eve iraq invasion appreciate real reason maintain british military standing american eyesspanp pspanyet invasion humiliating retreat winnowing capacity british state lowered armys reputation american eyes basra border kuwait chosen britains target akams telling armys recent adoption justintime logistics left insufficient spare parts travel lack armoured vehicles body armour helicopters ammunition left army scrounging unimpressed americans entirely equipping emergency treasury fundsspanp pspanciting longago malaya morerecent northern ireland unqualified military success favour army deflected sense insecurity vastly reduced capacity compared arrogant ultimately mistaken belief populationcentric counterinsurgency unequalled spanispanmtierspanispan american officers quoted barry rolled eyes british tripe events proved spanp pspanbut americans resources limitless comparison ultimately lost wars barry observes governments decision invade iraq stand worst military decision 21st century military strategic folly level equal napoleons 1812 attack russia hitlers 1941 attack soviet union failure ultimately political british politicians blindly following american patrons unwinnable wars armys essential sin trying best bad job ignoble character flawspanp pspanit difficult avoid painful conclusion british army functions americans gurkhas british army highly motivated loyal auxiliary force incapable prosecuting campaign colourful traditions carry romance earlier glorious eraspanp pspantoday limited role doubt governments new focus naval capacity muchvaunted pacific tilt forming basis britains defence vision incoming chief general staff admiral sir tony radikin spana relnoopener hrefhttpswwwdailymailcouknewsarticle10074159amparmyplanshugecutsinfantrytroopsaxedhtml target_blankspanallegedly poisedspanaspan oversee dramatic cut armys alreadydangerously pareddown numbers cutting infantry ranks current numbersspanp diva hrefhttpsunherdcom202110americasforgottenpowelldoctrinerefinnara hrefhttpsunherdcom202110americasforgottenpowelldoctrinerefinnarimg srchttpsunherdcomwpcontentuploads2021102gettyimages1251381800scalede1634820922156300x168jpgadiva hrefhttpsunherdcom202110americasforgottenpowelldoctrinerefinnarspansuggested readingspanaa hrefhttpsunherdcom202110americasforgottenpowelldoctrinerefinnarh5americas forgotten powell doctrineh5apa hrefhttpsunherdcom202110americasforgottenpowelldoctrinerefinnarspanbyspan edward luttwakapdivadiv pspanthe best little army world getting littler better defence analyst spana relnoopener hrefhttpswwwforcesnetnewsbritisharmyclosebeingcombatincapableagainsthighendthreats target_blankspanfrancis tusa warnsspanaspan result decadeslong selfinflicted procurement woes combat incapable highend threats decades fighting poorlyequipped insurgents distracted army primary mission defending country competent wellequipped adversary like russia chinaspanp pspanperhaps disaster danger armys incapacity politicians inability match ambitions resources moral courage generals gently dissuade mock germany military weakness abundantly clear britain gained decade warfare germans managed avoid blairs promiscuous use army assuage lust glory period enforced abstinence institution good reequip graver unchosen challenges coming centuryspanp pspanthe armys focus new ranger battalions tasked training directing local partner forces place line infantry hints world conflict business fighting increasingly left expendable proxies shrunken tightlyfocussed army presents challenge denuded british state increasingly come rely soldiers lost capacityspanp pspanits willingness tasks outside core role fend cutbacks time necessarily states best interests distracts urgent task modernisation reorganisation gives british governments cover winnow away state capacity confident soldiers spana hrefhttpswwwindependentcouksportolympics13500militarypersonneldraftedlondon2012olympics6277442htmlspanto pick slackspanaspanspanp pspanas chilcot report iraq observed attitude laudably ingrained uk armed forces determination job difficult circumstances prevent ground truth reaching senior ears armys capacity win war like british states weather crisis better served generals finding courage necessary tell politicians things simply cant shouldnt donespanp hrefhttpsunherdcom202111thehumiliationofthebritisharmyappcommentsview 8 commentsa |
61830e8d47681a29a44b21a1 | My Conversation with David Salle | pi was honored to visit his home and painting studio here is a relnoopener hrefhttpsconversationswithtylercomepisodesdavidsalle target_blankthe audio video and transcripta here is part of the cwt summaryp
blockquotepdavid joined tyler to discuss the fifteen or so functions of good art why its easier to write about money than art whats gone wrong with art criticism today how to cultivate good taste the reasons museum curators tend to be riskaverse the effect of modern artistic training on contemporary art the evolution of czanne how the centrality of photography is changing fine art what makes some artists retrospectives more compelling than others the physical challenges of painting on a large scale how artists view museums differently how a painting goes wrong where his paintings end up what great collectors have in common how artists collect art differently why frank ohara was so important to alex katz and himself what he loves about the films of preston sturges why emthe sopranos emis a model of artistic expression how we should change intellectual property law for artists the disappointing puritanism of the avantgarde and morepblockquote
pand excerptp
blockquote
pstrongcowen strongyes but just to be very concrete lets say someone asks you i want to take one actionable step tomorrow to learn more about art and they are a smart highly educated person but have not spent much time in the art world what should they actually emdoem other than look at art on the reading levelp
pstrongsalle strongon the reading level oh god tyler thats hard ill have to think about it ill have to come back with an answer in a few minutes im not sure theres anything concretely to do on the reading level there probably is just not coming to mindp
ptheres a relnoopener hrefhttpswwwwidewallschmagazinehenrygeldzahlercurator target_blank datahrefhttpswwwwidewallschmagazinehenrygeldzahlercuratorhenry geldzahlera who wrote a book very late in his life at the end of his life i cant remember the title but he addresses the problem of something which is almost a taboo how do you acquire taste which is in a sense what were talking about its something one cant even speak about in polite society among art historians or art criticsp
ptaste is considered to be something not worth discussing its simply were all above that taste is in a sense something that has to do with hallmark greeting cards but its not true taste is what we have to work with its a way of describing human experiencep
phenry who was the first curator of modern and contemporary art at the metropolitan museum in new york was a wonderful guy and a wonderful raconteur henry basically answers your question find ways start collecting okay but i dont have any money how can i collect art you dont have to collect great paintings just go to the flea market and buy a vase for 5 bucks bring it back to your room live with it and look at itp
ppretty soon youll start to make distinctions about it eventually if youre really paying attention to your own reactions youll use it up youll give that to somebody else and youll go back to the flea market and you buy another slightly better vase and you bring that home and live with that and so the process goes thats very real its very concretep
blockquote
pandp
blockquote
pstrongcowen strongas you know the 17th century in european painting is a quite special time you have velsquez you have rubens you have bruegel much much more and there are emsoem many talented painters today why can they not paint in that style anymore or can they what stops themp
pstrongsalle strongartists are trained in such a emvastlyem different way than in the 17th 18th or even the 19th century we didnt have the training were not trained in an apprentice guild situation where the apprenticeship starts very early in life and people who exhibit talent in drawing or painting are moved on to the next levelp
ptoday painters are trained in professional art schools people reach school at the normal age 18 20 22 something in grad school and then theyre in a big hurry if its something you cant master or show proficiency in quickly lets just drop it and move onp
pthere are other reasons as well cultural reasons for many years or decades painting in lets say the style of velsquez or even the style of manet what would have been the reason for it what would have been the motivation for it even assuming that one could do it modernism from whenever we date it from 1900 to 1990 was emsuchem a persuasive argument it was such an inclusive and exciting and dynamic argument that what possibly could have been the reason to want to take a step back 200 years in history and paint like an earlier painterp
blockquote
pit is a bit slow at the very beginning otherwise excellent throughoutp
pthe post a relnofollow hrefhttpmarginalrevolutioncommarginalrevolution202111myconversationwithdavidsallehtmlmy conversation with david sallea appeared first on a relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap | pi honored visit home painting studio relnoopener hrefhttpsconversationswithtylercomepisodesdavidsalle target_blankthe audio video transcripta cwt summaryp blockquotepdavid joined tyler discuss functions good art easier write money art whats gone wrong art criticism today cultivate good taste reasons museum curators tend riskaverse effect modern artistic training contemporary art evolution czanne centrality photography changing fine art makes artists retrospectives compelling physical challenges painting large scale artists view museums differently painting goes wrong paintings end great collectors common artists collect art differently frank ohara important alex katz loves films preston sturges emthe sopranos emis model artistic expression change intellectual property law artists disappointing puritanism avantgarde morepblockquote pand excerptp blockquote pstrongcowen strongyes concrete lets asks want actionable step tomorrow learn art smart highly educated person spent time art world actually emdoem look art reading levelp pstrongsalle strongon reading level oh god tyler thats hard ill think ill come answer minutes im sure theres concretely reading level probably isjust coming mindp ptheres relnoopener hrefhttpswwwwidewallschmagazinehenrygeldzahlercurator target_blank datahrefhttpswwwwidewallschmagazinehenrygeldzahlercuratorhenry geldzahlera wrote book late life end life cant remember title addresses problem taboohow acquire tastewhich sense talking cant speak polite society art historians art criticsp ptaste considered worth discussing simply taste sense hallmark greeting cardsbut true taste work way describing human experiencep phenry curator modern contemporary art metropolitan museum new york wonderful guy wonderful raconteur henry basically answers question find ways start collecting okay dont money collect art dont collect great paintings flea market buy vase 5 bucks bring room live look itp ppretty soon youll start distinctions eventually youre paying attention reactions youll use youll somebody youll flea market buy slightly better vase bring home live process goes thats real concretep blockquote pandp blockquote pstrongcowen strongas know 17th century european painting special time velsquez rubens bruegel emsoem talented painters today paint style anymore stops themp pstrongsalle strongartists trained emvastlyem different way 17th 18th 19th century didnt training trained apprentice guild situation apprenticeship starts early life people exhibit talent drawing painting moved levelp ptoday painters trained professional art schools people reach school normal age18 20 22 grad school theyre big hurry cant master proficiency quickly lets drop onp pthere reasons cultural reasons years decades painting lets style velsquez style manetwhat reason motivation assuming modernism date 1900 1990 emsuchem persuasive argument inclusive exciting dynamic argument possibly reason want step 200 years history paint like earlier painterp blockquote pit bit slow beginning excellent throughoutp pthe post relnofollow hrefhttpmarginalrevolutioncommarginalrevolution202111myconversationwithdavidsallehtmlmy conversation david sallea appeared relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap |
6185b1075f45d6f1d4f83fe7 | Why I Am Not a Fan of the Term “Anti-White.” | pa hrefhttpsi2wpcomcounterweightsupportcomwpcontentuploads202111biasjpgssl1img dataorigfilehttpsi2wpcomcounterweightsupportcomwpcontentuploads202111biasjpgfit12002c800ampssl1 dataorigsize1200800 datamediumfilehttpsi2wpcomcounterweightsupportcomwpcontentuploads202111biasjpgfit3002c200ampssl1 dataattachmentid1451 dataimagemetaquotaperturequotquot0quotquotcreditquotquotquotquotcameraquotquotquotquotcaptionquotquotquotquotcreated_timestampquotquot1599652092quotquotcopyrightquotquotquotquotfocal_lengthquotquot0quotquotisoquotquot0quotquotshutter_speedquotquot0quotquottitlequotquotquotquotorientationquotquot0quot dataimagedescription srchttpsi2wpcomcounterweightsupportcomwpcontentuploads202111biasjpgresize7202c480ssl1 datapermalinkhttpscounterweightsupportcom20211105whyiamnotafanofthetermantiwhitebias datalargefilehttpsi2wpcomcounterweightsupportcomwpcontentuploads202111biasjpgfit7202c480ampssl1 alt dataimagetitlebias srcsethttpsi2wpcomcounterweightsupportcomwpcontentuploads202111biasjpgw1200ampssl1 1200w httpsi2wpcomcounterweightsupportcomwpcontentuploads202111biasjpgresize3002c200ampssl1 300w httpsi2wpcomcounterweightsupportcomwpcontentuploads202111biasjpgresize10242c683ampssl1 1024w httpsi2wpcomcounterweightsupportcomwpcontentuploads202111biasjpgresize7682c512ampssl1 768w httpsi2wpcomcounterweightsupportcomwpcontentuploads202111biasjpgresize6002c400ampssl1 600w sizesmaxwidth 720px 100vw 720px width720 dataimagecaption datacommentsopened1 classwpimage1451 datarecalcdims1 height480abr
some people have questioned why i do not use the term antiwhite to describe aspects of critical social justice theory and activism that explicitly generalise negatively about white people instead when someone points out that a statement is racist about white people rather than focusing on the fact that the denigrated group is white i am likely to address it as a failure to consistently oppose racial essentialism and the evaluation of the worth of any individual by their racep
pthe main reason i do this is because i think it is important to focus primarily on first principles rather than identity the first principle of liberal opposition to racism is that it is stupid and unethical to evaluate peoples worth by their race or attribute any characteristics traits values or behaviours to them because of the colour of their skin that is the first principle of liberal approaches to racial equality is an individual and universal one that racist generalisations are always factually and ethically wrong there is enormous value in foregrounding this universal principle because liberally minded people of all races can get behind it it is this consistency of opposition to racism that will bring us together to oppose both the ideological loons whose negative racial generalisations are about black andor brown people emand emthe ideological loons whose negative racial generalisations are about white peoplep
pnegative generalisation about individuals on the grounds of their race is a concern shared by all people who oppose racism in genuinely liberal ways even though the people who denigrate black and brown people and the people who denigrate white people are different people who are motivated by different ideologies there is value in pointing out that they are manifesting the same factual and moral failures despite the fact that negative assumptions made about black and brown people by white identitarians are different to the negative assumptions made about white people by critical social justice antiracists and impact people differently there is still value in calling upon the first principle of liberal opposition to racism in order to oppose bothp
pthis does not mean that we should not address the differences above if we want to oppose white supremacist ideas we will need to focus on their ideological framework it is necessary to look at how they are specifically antiblack and how they make specific false claims about the unintelligence and criminality of black people it is important to look at how this specifically affects black people if we want to oppose csj approaches to antiracism we will also need to focus on their ideological framework to do this we need to look at how they are specifically antiwhite and make specific false claims about white people being racist arrogant ignorant and entitled and how this affects white people we dont need to make any false equivalencies when addressing both of these forms of racial stereotypes we can openly acknowledge the mountains of historical evidence that the people most grievously impacted by racist views have been black we can and should also acknowledge that the legacy of this can be measured today in the comparative prosperity of white and black peoplep
phowever we need to look at what will best address and remedy both the legacy of historical racism and the racial polarisation we are facing today the universal liberalism of the civil rights movement is best equipped to do this and there is much evidence to support this view society makes most progress when it appeals to our shared humanity when martin luther king said he dreamt of a day his children would be judged by the content of their character not the colour of their skin he was appealing to white americans hopes for their own children and their claimed liberal values he was saying we are human just like you we have needs and personalities and abilities and feelings just like you yet we are treated as inferior and denied full access to society this appeal to empathy and common humanity was something that white people could relate to and get on board with with liberal feminism and gay pride working in much the same way we saw much legal progress between 1960 and 1980 and have seen much social progress since this works with our best impulses of fairness empathy and reciprocityp
pidentity politics on the other hand works against those best impulses and brings out the worst in human nature our ingroup bias tribalism and tendency to callously disregard the wellbeing of the outgroup when robin diangelo calls upon white people to be less white by which she means less arrogant ignorant and oppressive this does not appeal to their empathy and create a sense of shared humanity in fact she rejects universalism explicitly this causes mostly resentment from white people who are none of the above and resulted in diangelo writing a whole book about how fragile white people are as the only possible explanation for them being unreceptive to her approach other appeals to identity which categorise certain groups as oppressors and others as oppressed have caused the same closing in and shutting down reaction diangelo can call it fragility but i would call it completely unnecessary alienation of whole sections of society from what should be a shared endeavour that is in the best interests of all of us a society free of racism sexism homophobia and all other bigotriesp
pthis is why i think the term antiwhite is seldom useful it may certainly sometimes be valid to use the term to point out that the race being denigrated in this case is white in order to address the problem specifically however as a general rule it is better to refer to principles rather than identity because shared principles are something that bring us together while shared identities can too often drive us apartp
pa black person being abused because of her race can say this is antiblack and that is wrong a white person being abused because of her race can say this is antiwhite and that is wrong they can both say this is prejudice against an individual because of her skin colour and this is wrong in this last case there is no element of identity politics just consistently liberal principlesp
pwe are seeing the rise of a new and largely reactive white identity politics and a new white victimhood narrative at the moment white identity politics have always existed of course thats what underlies the historical racism that has caused so much harm to nonwhite people but we have made remarkable progress toward overcoming that old racism which just ignorantly assumed the superiority of white people what we are seeing now is something new which is appearing in response to the identity politics and victim narratives of the critical social justice movement it is a defensive response to theories which make negative claims about white people such as that they are all racist oppressive arrogant entitled selfish ignorant and more this occurs alongside the development of concepts like whiteness which is nebulous and indefinable is explained in the theory as a kind of ideology held by white people that upholds white supremacy but is often used in practice to mean existing while white which is inherently badp
pthere are good grounds for seeing these ideas as racist and antiwhite and you are not fragile if you are a white person who feels wronged by being presented in this way when you are actually none of those things you are feeling the sting of injustice and it is natural to feel defensive however it is essential that what you defend is consistent principles of opposing racial essentialism in all its forms and not evaluating people by their race do not defend being white thisis an accident of birth and not something you should feel either proud or ashamed of be credited for or blamed for if you find yourself defending your white identity you could be slipping into white identity politics which could separate you from everybody else who consistently opposes evaluating people by their race this is a fatal error as a postracial future is a vitally important goal that requires the combined efforts of all of us such a future is the only truly liberal outcome and it is impeded by anybody who behaves in ways that add salience to race itself rather than consistently opposing racemismem i do not claim that people who use the term antiwhite are embracing white identity politics or asserting a white victimhood narrative most of them do not and are not they are simply describing an incident specifically however i would advise strategically to avoid doing thisp
pinstead rise above any efforts to demean you as a person whose skin happens to be white by consistently objecting to anybody being demeaned because of the colour of their skin this keeps you in sync with liberal opponents of racism of all races and they do come in all races three people who have come to counterweight for help in defending white colleagues against language that is demeaning to white people have been black two of them said they did so because they have experienced racism and they know what it feels like and they cannot stand by and allow people to be denigrated solely on the basis of their skin colour these are genuine liberals whose opposition to racist generalisations is absolutely consistent i have the greatest respect for them and so should you join them and all the other liberals of all races in working towards the postracial future that will benefit us allp
p p
pthe post a relnofollow hrefhttpscounterweightsupportcom20211105whyiamnotafanofthetermantiwhitewhy i am not a fan of the term antiwhitea appeared first on a relnofollow hrefhttpscounterweightsupportcomcounterweightap | pa hrefhttpsi2wpcomcounterweightsupportcomwpcontentuploads202111biasjpgssl1img dataorigfilehttpsi2wpcomcounterweightsupportcomwpcontentuploads202111biasjpgfit12002c800ampssl1 dataorigsize1200800 datamediumfilehttpsi2wpcomcounterweightsupportcomwpcontentuploads202111biasjpgfit3002c200ampssl1 dataattachmentid1451 dataimagemetaquotaperturequotquot0quotquotcreditquotquotquotquotcameraquotquotquotquotcaptionquotquotquotquotcreated_timestampquotquot1599652092quotquotcopyrightquotquotquotquotfocal_lengthquotquot0quotquotisoquotquot0quotquotshutter_speedquotquot0quotquottitlequotquotquotquotorientationquotquot0quot dataimagedescription srchttpsi2wpcomcounterweightsupportcomwpcontentuploads202111biasjpgresize7202c480ssl1 datapermalinkhttpscounterweightsupportcom20211105whyiamnotafanofthetermantiwhitebias datalargefilehttpsi2wpcomcounterweightsupportcomwpcontentuploads202111biasjpgfit7202c480ampssl1 alt dataimagetitlebias srcsethttpsi2wpcomcounterweightsupportcomwpcontentuploads202111biasjpgw1200ampssl1 1200w httpsi2wpcomcounterweightsupportcomwpcontentuploads202111biasjpgresize3002c200ampssl1 300w httpsi2wpcomcounterweightsupportcomwpcontentuploads202111biasjpgresize10242c683ampssl1 1024w httpsi2wpcomcounterweightsupportcomwpcontentuploads202111biasjpgresize7682c512ampssl1 768w httpsi2wpcomcounterweightsupportcomwpcontentuploads202111biasjpgresize6002c400ampssl1 600w sizesmaxwidth 720px 100vw 720px width720 dataimagecaption datacommentsopened1 classwpimage1451 datarecalcdims1 height480abr people questioned use term antiwhite describe aspects critical social justice theory activism explicitly generalise negatively white people instead points statement racist white people focusing fact denigrated group white likely address failure consistently oppose racial essentialism evaluation worth individual racep pthe main reason think important focus primarily principles identity principle liberal opposition racism stupid unethical evaluate peoples worth race attribute characteristics traits values behaviours colour skin principle liberal approaches racial equality individual universal racist generalisations factually ethically wrong enormous value foregrounding universal principle liberally minded people races consistency opposition racism bring oppose ideological loons negative racial generalisations black andor brown people emand emthe ideological loons negative racial generalisations white peoplep pnegative generalisation individuals grounds race concern shared people oppose racism genuinely liberal ways people denigrate black brown people people denigrate white people different people motivated different ideologies value pointing manifesting factual moral failures despite fact negative assumptions black brown people white identitarians different negative assumptions white people critical social justice antiracists impact people differently value calling principle liberal opposition racism order oppose bothp pthis mean address differences want oppose white supremacist ideas need focus ideological framework necessary look specifically antiblack specific false claims unintelligence criminality black people important look specifically affects black people want oppose csj approaches antiracism need focus ideological framework need look specifically antiwhite specific false claims white people racist arrogant ignorant entitled affects white people dont need false equivalencies addressing forms racial stereotypes openly acknowledge mountains historical evidence people grievously impacted racist views black acknowledge legacy measured today comparative prosperity white black peoplep phowever need look best address remedy legacy historical racism racial polarisation facing today universal liberalism civil rights movement best equipped evidence support view society makes progress appeals shared humanity martin luther king said dreamt day children judged content character colour skin appealing white americans hopes children claimed liberal values saying human like needs personalities abilities feelings like treated inferior denied access society appeal empathy common humanity white people relate board liberal feminism gay pride working way saw legal progress 1960 1980 seen social progress works best impulses fairness empathy reciprocityp pidentity politics hand works best impulses brings worst human nature ingroup bias tribalism tendency callously disregard wellbeing outgroup robin diangelo calls white people white means arrogant ignorant oppressive appeal empathy create sense shared humanity fact rejects universalism explicitly causes resentment white people resulted diangelo writing book fragile white people possible explanation unreceptive approach appeals identity categorise certain groups oppressors oppressed caused closing shutting reaction diangelo fragility completely unnecessary alienation sections society shared endeavour best interests society free racism sexism homophobia bigotriesp pthis think term antiwhite seldom useful certainly valid use term point race denigrated case white order address problem specifically general rule better refer principles identity shared principles bring shared identities drive apartp pa black person abused race antiblack wrong white person abused race antiwhite wrong prejudice individual skin colour wrong case element identity politics consistently liberal principlesp pwe seeing rise new largely reactive white identity politics new white victimhood narrative moment white identity politics existed course thats underlies historical racism caused harm nonwhite people remarkable progress overcoming old racism ignorantly assumed superiority white people seeing new appearing response identity politics victim narratives critical social justice movement defensive response theories negative claims white people racist oppressive arrogant entitled selfish ignorant occurs alongside development concepts like whiteness nebulous indefinable explained theory kind ideology held white people upholds white supremacy practice mean existing white inherently badp pthere good grounds seeing ideas racist antiwhite fragile white person feels wronged presented way actually things feeling sting injustice natural feel defensive essential defend consistent principles opposing racial essentialism forms evaluating people race defend white thisis accident birth feel proud ashamed credited blamed find defending white identity slipping white identity politics separate everybody consistently opposes evaluating people race fatal error postracial future vitally important goal requires combined efforts future truly liberal outcome impeded anybody behaves ways add salience race consistently opposing racemismem claim people use term antiwhite embracing white identity politics asserting white victimhood narrative simply describing incident specifically advise strategically avoid thisp pinstead rise efforts demean person skin happens white consistently objecting anybody demeaned colour skin keeps sync liberal opponents racism races come races people come counterweight help defending white colleagues language demeaning white people black said experienced racism know feels like stand allow people denigrated solely basis skin colour genuine liberals opposition racist generalisations absolutely consistent greatest respect join liberals races working postracial future benefit allp pp pthe post relnofollow hrefhttpscounterweightsupportcom20211105whyiamnotafanofthetermantiwhitewhy fan term antiwhitea appeared relnofollow hrefhttpscounterweightsupportcomcounterweightap |
61870248a7f18d889f04ce7e | The economics of medical procedure innovation | pa relnoopener hrefhttpswwwnberorgpapersw29438 target_blankimportant nber worka from david dranove craig garthwaite christopher heard and bingxiao wu on an understudied interventionp
blockquotepthis paper explores the economic incentives for medical procedure innovation using a proprietary dataset on billing code applications for emerging medical procedures we highlight two mechanisms that could hinder innovation first the administrative hurdle of securing permanent reimbursable billing codes substantially delays innovation diffusion we find that medicare utilization of innovative procedures increases nearly ninefold after the billing codes are promoted to permanent reimbursable from provisional nonreimbursable however only 29 percent of the provisional codes are promoted within the fiveyear probation period second medical procedures lack intellectual property rights especially those without patented devices when appropriability is limited specialty medical societies lead the applications for billing codes we indicate that the ad hoc process for securing billing codes for procedure innovations creates uncertainty about both the development process and the allocation and enforceability of property rights this stands in stark contrast to the more deliberate regulatory oversight for pharmaceutical innovationspblockquote
phere are a relnoopener hrefhttpswwwgooglecomsearchqtheeconomicsofmedicalprocedureinnovationsourcehpeinysgyehwimo1ytmpu6mrkaoiflsigalswamaaaaayyasrtys5jdt229icdtiulim2xhuwzlsoqtheeconomicsofmedicalprocedureinnovationgs_lcpcgdnd3mtd2l6eam6eqgueiaeeledemcbekmcejmcogsiabcabbcxaxcdatoicc4qsqmqgwe6eqgueiaeeledeimbemcbenedog4ilhcabbcxaxdharcjajoicc4qgaqqsqm6cagaeiaeeledog4ilhcabbcxaxcdarctajolcc4qgaqqsqmqgwe6bqgueiaeoggiabcxaxcdatofcaaqgaq6cwgueiaeemcbek8bogsilhcabbdhardrazoicaaqgaqqyqm6dggueiaeemcbek8bejmcoggilhcabbctajohcaaqgaqqcjoecaaqcjoecc4qcjogcaaqfhaeoggiabaweaoqhjoicceqfhadeb46bagheao6bwgheaoqoae6bqghekaboguiircrakofcdwsatnqafjrnmdyomgdcab4ayabhwgiabagkgefmzcumtgyaqcgaqesclientgwswizved0ahukewih3f27ip0ahxdmniehbtubkiq4dudcaguact5 target_blankungated copiesap
pthe post a relnofollow hrefhttpmarginalrevolutioncommarginalrevolution202111theeconomicsofmedicalprocedureinnovationhtmlthe economics of medical procedure innovationa appeared first on a relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap | pa relnoopener hrefhttpswwwnberorgpapersw29438 target_blankimportant nber worka david dranove craig garthwaite christopher heard bingxiao wu understudied interventionp blockquotepthis paper explores economic incentives medical procedure innovation proprietary dataset billing code applications emerging medical procedures highlight mechanisms hinder innovation administrative hurdle securing permanent reimbursable billing codes substantially delays innovation diffusion find medicare utilization innovative procedures increases nearly ninefold billing codes promoted permanent reimbursable provisional nonreimbursable 29 percent provisional codes promoted fiveyear probation period second medical procedures lack intellectual property rights especially patented devices appropriability limited specialty medical societies lead applications billing codes indicate ad hoc process securing billing codes procedure innovations creates uncertainty development process allocation enforceability property rights stands stark contrast deliberate regulatory oversight pharmaceutical innovationspblockquote phere relnoopener hrefhttpswwwgooglecomsearchqtheeconomicsofmedicalprocedureinnovationsourcehpeinysgyehwimo1ytmpu6mrkaoiflsigalswamaaaaayyasrtys5jdt229icdtiulim2xhuwzlsoqtheeconomicsofmedicalprocedureinnovationgs_lcpcgdnd3mtd2l6eam6eqgueiaeeledemcbekmcejmcogsiabcabbcxaxcdatoicc4qsqmqgwe6eqgueiaeeledeimbemcbenedog4ilhcabbcxaxdharcjajoicc4qgaqqsqm6cagaeiaeeledog4ilhcabbcxaxcdarctajolcc4qgaqqsqmqgwe6bqgueiaeoggiabcxaxcdatofcaaqgaq6cwgueiaeemcbek8bogsilhcabbdhardrazoicaaqgaqqyqm6dggueiaeemcbek8bejmcoggilhcabbctajohcaaqgaqqcjoecaaqcjoecc4qcjogcaaqfhaeoggiabaweaoqhjoicceqfhadeb46bagheao6bwgheaoqoae6bqghekaboguiircrakofcdwsatnqafjrnmdyomgdcab4ayabhwgiabagkgefmzcumtgyaqcgaqesclientgwswizved0ahukewih3f27ip0ahxdmniehbtubkiq4dudcaguact5 target_blankungated copiesap pthe post relnofollow hrefhttpmarginalrevolutioncommarginalrevolution202111theeconomicsofmedicalprocedureinnovationhtmlthe economics medical procedure innovationa appeared relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap |
618853a707c3691e2635897f | Markets in everything | blockquotepa louisiana widow is left horrified at the news that her deceased husband was dissected in front of a live paying audience after she donated his body to scientific researchp
pelsie saunders had carried out the wishes of her late husband david saunders who wanted his body donated to help advance medical science according to a hrefhttpswwwtheadvocatecombaton_rougenewsarticle_cca7c34c3cdd11ec9cb9f3d0a583c921htmlthe advocatea david saunders a world war ii and korean war veteran died of covid19 on august 24 at the age of 98 donating his body was his last act of patriotism elsie saunders saidp
pbut instead of being delivered to a research facility david saunders body ended up in a marriott hotel ballroom in portland oregon where deathscienceorg held an oddities and curiosities expo at the october 17 event members of the public sat ringside from 9 am to 4 pmwith a break for lunchto watch david saunders body be carefully dissected tickets for the dissection sold for up to 500 per personp
pelsie saunders learned of the dissection from a seattlebased reporter at king 5 who was investigating the event and tracked her down a photojournalist who attended undercover for king 5 had noted that the body had a bracelet with the typed name david saundersp
pas far as im concerned its horrible unethical and i just dont have the words to describe it elsie saunders told the advocate i have all this paperwork that says his body would be used for sciencenothing about this commercialization of his deathpblockquote
pare medical students allowed to pay tuition is science allowed to balance the books here is a relnoopener hrefhttpsarstechnicacomscience202111mandonatedhisbodytosciencecompanysold500ticketstohisdissection target_blankthe full storya via the excellent a relnoopener hrefhttpstwittercomsamirvarma target_blanksamir varmaap
pthe post a relnofollow hrefhttpmarginalrevolutioncommarginalrevolution202111marketsineverything67htmlmarkets in everythinga appeared first on a relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap | blockquotepa louisiana widow left horrified news deceased husband dissected live paying audience donated body scientific researchp pelsie saunders carried wishes late husband david saunders wanted body donated help advance medical science according toa hrefhttpswwwtheadvocatecombaton_rougenewsarticle_cca7c34c3cdd11ec9cb9f3d0a583c921htmlthe advocatea david saunders world war ii korean war veteran died covid19 august 24 age 98 donating body act patriotism elsie saunders saidp pbut instead delivered research facility david saunders body ended marriott hotel ballroom portland oregon deathscienceorg held oddities curiosities expo october 17 event members public sat ringside 9 4 pmwith break lunchto watch david saunders body carefully dissected tickets dissection sold 500 personp pelsie saunders learned dissection seattlebased reporter king 5 investigating event tracked photojournalist attended undercover king 5 noted body bracelet typed david saundersp pas far im concerned horrible unethical dont words describe elsie saunders told advocate paperwork says body sciencenothing commercialization deathpblockquote pare medical students allowed pay tuition science allowed balance books relnoopener hrefhttpsarstechnicacomscience202111mandonatedhisbodytosciencecompanysold500ticketstohisdissection target_blankthe storya excellent relnoopener hrefhttpstwittercomsamirvarma target_blanksamir varmaap pthe post relnofollow hrefhttpmarginalrevolutioncommarginalrevolution202111marketsineverything67htmlmarkets everythinga appeared relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap |
618853d607c3691e26358987 | Down the QAnon rabbit hole | plies in many cases are comparable to sparks they might not be very dangerous in and of themselves but under the right conditions or perhaps the wrong conditions they can lead to spectacular firesp
pconsider for example how a chain of events that began with an anonymous message being posted on an obscure message board in october 2017 led four years later to hundreds of americans gathering in dallas texas to await the return of the long dead jfk jrp
pback in october 2017 someone calling themselves q began posting bizarre messages on the pol board of the notorious website 4chan q claiming to have high level white house security clearance spoke of the storm an event in which president trump and his allies would arrest hundreds of his rivals and expose them as childeating luciferians somehow this event failed to transpirep
pin fact q had something of a talent for failed predictions he and his followers in the colorful protrump movement that we know as qanon predicted the arrests of everyone from hillary clinton to tom hanks all of whom have remained conspicuously free they predicted that donald trump would be inaugurated which somehow has failed to happenp
pin an insightful 2018 essay michael barkun an american political scientist predicted that the less heavily invested [qanon believers] will eventually drop away but that a core group will remain even in the face of predictions or prophecies that simply didnt happen when it comes to true believers barkun wrotep
pthe belief is likely to be one around which they have structured their view of the world that certainly was the case with qanons predictions this was to be the final battle between the virtuous forces of trump and his allies against the quintessential evil of the deep state after whose defeat some final quasiparadise would presumably emerge when that kind of prediction goes wrong it carries a lot of potential psychological damage with itp
pmany q believers have drifted away firstly and perhaps most significantly a concerted attempt by big tech to stamp out the movement which entailed the banning of hundreds of accounts from facebook twitter and elsewhere has limited its reach an approving report from the atlantic council found that in the aftermath of this campaign qanon advocacy all but evaporated from the mainstream internetp
pbut i think q would have many lost adherents anyway other causes have attracted more marginal followers such as campaigns against vaccine mandates and critical race theory a republican comeback vividly manifested in glenn youngkins triumph in virginia has also given american rightists optimism with less need to seek grandiose rationalizations of failurep
peven ron watkins the shadowy administrator of the 4chan spinoff 8chan who appeared to make an accidental admission to posting as q in a recent documentary said after president bidens inauguration that it was time to go back to our lives as best we are ablep
pbut a core group remains many of them have invested thousands of hours and dollars and alienated friends and relatives in furthering their cause their imaginative framework is built around the movement so even though q himself apparently advised them in 2018 that jfk jr was not alive and thus had no chance of returning to endorse donald trump hundreds of hardcore q believers gathered in dallas to welcome him speculating allegedly that other dead celebrities like robin williams and kobe bryant would also join this eccentric entouragep
pit is easy to laugh but it is also too easy not because there is anything credible in these beliefs but because scorn for true believers can become a badge of honor oh im crazy or is everyone crazy everyone has heard the often misattributed quote first they ignore you then they laugh at you then they fight you then you win fewer reflect that people might laugh at you for good reasonsp
pthe marginalization of qanon has led to division some think the jfk jr stuff is a bizarre distraction and it takes a lot for qanon believers to think that others under the guidance of a man named michael brian protzman aka negative48 think it is just the beginning they have been employing halfbaked numerology to predict the resurrection of jfk himself yes jfk is basically christ and trump is the holy spirit foreshadowing his returnp
pas if this was not enough these qinspired numerologists qmerologists are enriching their millenarian beliefs with speculations about ancient bloodlines according to another qanon guru quru whiplash347 jfk abraham lincoln elvis presley and julian assange are descended from the arabic minority the druze who according to qanon lore are the real jews you can see the direction that could go inp
pwithin a few years then a theory that posited a clash between donald trump and the deep state has spiraled into an ornate intricate fantasy about a clash between the soldiers of god and the forces of the devilp
pwhere does it end one hopes not with q believers doing a great deal of harm to themselves and others but if they are prepared to swallow as much as they have done no one should be confident that they would reject the murderous or selfdestructive claims of a modern jim jones or marshall applewhite more peripheral believers could hop out of the rabbit hole without having a lot of dirt attached to themselves the minority of people who are prepared to accept that jfk will return to represent the noble druze bloodline on the other hand have gone so deep into the dark that they can digp
pthe moral of this story is to base your beliefs on truth if you start with an element of sheer fantasy you can expect it to mutate and expand out of controlp
panyway i have to dash im interviewing kurt cobain about his little known levantine heritagep
pthe post a relnofollow hrefhttpsspectatorworldcomtopicdownqanonrabbitholedown the qanon rabbit holea appeared first on a relnofollow hrefhttpsspectatorworldcomthe spectator worldap | plies cases comparable sparks dangerous right conditions wrong conditions lead spectacular firesp pconsider example chain events began anonymous message posted obscure message board october 2017 led years later hundreds americans gathering dallas texas await return long dead jfk jrp pback october 2017 calling q began posting bizarre messages pol board notorious website 4chan q claiming high level white house security clearance spoke storm event president trump allies arrest hundreds rivals expose childeating luciferians event failed transpirep pin fact q talent failed predictions followers colorful protrump movement know qanon predicted arrests hillary clinton tom hanks remained conspicuously free predicted donald trump inaugurated failed happenp pin insightful 2018 essay michael barkun american political scientist predicted heavily invested [qanon believers] eventually drop away core group remain face predictions prophecies simply didnt happen comes true believers barkun wrotep pthe belief likely structured view world certainly case qanons predictions final battle virtuous forces trump allies quintessential evil deep state defeat final quasiparadise presumably emerge kind prediction goes wrong carries lot potential psychological damage itp pmany q believers drifted away firstly significantly concerted attempt big tech stamp movement entailed banning hundreds accounts facebook twitter limited reach approving report atlantic council found aftermath campaign qanon advocacy evaporated mainstream internetp pbut think q lost adherents causes attracted marginal followers campaigns vaccine mandates critical race theory republican comeback vividly manifested glenn youngkins triumph virginia given american rightists optimism need seek grandiose rationalizations failurep peven ron watkins shadowy administrator 4chan spinoff 8chan appeared accidental admission posting q recent documentary said president bidens inauguration time lives best ablep pbut core group remains invested thousands hours dollars alienated friends relatives furthering cause imaginative framework built movement q apparently advised 2018 jfk jr alive chance returning endorse donald trump hundreds hardcore q believers gathered dallas welcome speculating allegedly dead celebrities like robin williams kobe bryant join eccentric entouragep pit easy laugh easy credible beliefs scorn true believers badge honor oh im crazy crazy heard misattributed quote ignore laugh fight win fewer reflect people laugh good reasonsp pthe marginalization qanon led division think jfk jr stuff bizarre distraction takes lot qanon believers think guidance man named michael brian protzman aka negative48 think beginning employing halfbaked numerology predict resurrection jfk yes jfk basically christ trump holy spirit foreshadowing returnp pas qinspired numerologists qmerologists enriching millenarian beliefs speculations ancient bloodlines according qanon guru quru whiplash347 jfk abraham lincoln elvis presley julian assange descended arabic minority druze according qanon lore real jews direction inp pwithin years theory posited clash donald trump deep state spiraled ornate intricate fantasy clash soldiers god forces devilp pwhere end hopes q believers great deal harm prepared swallow confident reject murderous selfdestructive claims modern jim jones marshall applewhite peripheral believers hop rabbit hole having lot dirt attached minority people prepared accept jfk return represent noble druze bloodline hand gone deep dark digp pthe moral story base beliefs truth start element sheer fantasy expect mutate expand controlp panyway dash im interviewing kurt cobain little known levantine heritagep pthe post relnofollow hrefhttpsspectatorworldcomtopicdownqanonrabbitholedown qanon rabbit holea appeared relnofollow hrefhttpsspectatorworldcomthe spectator worldap |
618af6c66d61b2c27f5ba3bc | The Big Impact of Little Barriers to Public Benefits | pempaul shafer is an assistant professor of health law policy and management at the boston university school of public health he tweets shaferpremp
pa recent article i published in a hrefhttpstradeoffsorg20211029administrativeburdenhealthwictradeoffsa looks at a study in jama network open examining how needing to physically show up at a social service agency office dampened participation in a critical food assistance programspecial supplemental nutrition program for women infants and children wicduring covid19 administrative burdens can keep people out of programs that they are eligible for with big implications for health and health equity given the populations that programs like this servep
pin it i writep
blockquotepthe a hrefhttpswwwfnsusdagovwicspecial supplemental nutrition program for women infants and childrena wic supports women with low incomes and their children and the program has proven to help a hrefhttpspubmedncbinlmnihgov33626410narrow racial and ethnic disparitiesa in infant health wic benefits are provided on an electronic debit card which some states automatically reload online states and others reload only at inperson wic office visits offline statesp
pthe authors estimated that offline states experienced a nearly 10 drop 93 in wic participation during the first nine months of the covid19 pandemic relative to online states this was a product of both increased participation in online states and decreased participation in offline states meanwhile the authors found that participation in the supplemental nutrition assistance program often referred to as food stamps a program that renews remotely in all states saw no significant changes in participation during covid19pblockquote
pread the full piece at a hrefhttpstradeoffsorg20211029administrativeburdenhealthwictradeoffsap
pemresearch for this piece was supported by arnold venturesempthe post a hrefhttpstheincidentaleconomistcomwordpressthebigimpactoflittlebarrierstopublicbenefitsthe big impact of little barriers to public benefitsa first appeared on a hrefhttpstheincidentaleconomistcomwordpressthe incidental economista | pempaul shafer assistant professor health law policy management boston university school public health tweets shaferpremp pa recent article published hrefhttpstradeoffsorg20211029administrativeburdenhealthwictradeoffsa looks study jama network open examining needing physically social service agency office dampened participation critical food assistance programspecial supplemental nutrition program women infants children wicduring covid19 administrative burdens people programs eligible big implications health health equity given populations programs like servep pin writep blockquotepthea hrefhttpswwwfnsusdagovwicspecial supplemental nutrition program women infants childrenawic supports women low incomes children program proven helpa hrefhttpspubmedncbinlmnihgov33626410narrow racial ethnic disparitiesain infant health wic benefits provided electronic debit card states automatically reload online states reload inperson wic office visits offline statesp pthe authors estimated offline states experienced nearly 10 drop 93 wic participation months covid19 pandemic relative online states product increased participation online states decreased participation offline states authors found participation supplemental nutrition assistance program referred food stamps program renews remotely states saw significant changes participation covid19pblockquote pread piece hrefhttpstradeoffsorg20211029administrativeburdenhealthwictradeoffsap pemresearch piece supported arnold venturesempthe post hrefhttpstheincidentaleconomistcomwordpressthebigimpactoflittlebarrierstopublicbenefitsthe big impact little barriers public benefitsa appeared hrefhttpstheincidentaleconomistcomwordpressthe incidental economista |
618c482ce619af73ac7369f3 | Nicholas Christakis: How To End the Covid Pandemic (Podcast) | div
picture
source sizesminwidth 600px 331px 100vw typeimagewebp srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202111nchristakishs1jpgwebp 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202111nchristakishs11200x675jpgwebp 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202111nchristakishs1800x450jpgwebp 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202111nchristakishs1600x338jpgwebp 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202111nchristakishs1331x186jpgwebp 331w
source sizesminwidth 600px 331px 100vw typeimagejpeg srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202111nchristakishs1jpg 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202111nchristakishs11200x675jpg 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202111nchristakishs1800x450jpg 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202111nchristakishs1600x338jpg 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202111nchristakishs1331x186jpg 331w
img width1200 altnchristakishs1 srchttpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202111nchristakishs1800x450jpg height675
picture
div
pspanall respiratory pandemics follow a script one thats as much social and political as it is medical or epidemiological says spanspanyale sociologist and medical doctor nicholas christakis who has just released a new paperback edition of his authoritative book spana hrefhttpswwwamazoncomexecobidosasinb0895jc98freasonmagazinea20ispanapollos arrow the profound and enduring impact of coronavirus on the way we livespaniap
pspanin his conversation with nick gillespie christakis pulls no punches when slamming the failures of our politicians and public health officials to act quickly and speak honestly about the covid19 pandemic which has left 750000 americans dead spanp
pspanas a newly minted member of the a hrefhttpswwwthefireorgaboutusadvisorycounciladvisory councila for the foundation for individual rights in education fire and a hrefhttpsreasoncomvideo20190405theyaleprofessorattackedbyangrystua highprofile targeta of ultrawoke campus activists christakis talks about how covid misinformation has also been spread by pundits and politicians who seem more interested in pushing ideology than science and why the best way forwardreally the only way forwardis through robust debate in the public square he also argues that recent events on campusessuch as massachusetts institute of technology a hrefhttpsreasoncom20211021mitdorianabbotcancellectureaffirmativeactioncanceling a talka by a scientist due to his critical views on affirmative actionunderscore the need for a radical shift in favor of free speech at our colleges and universities spanp
pchristakis previously appeared on emtheem emreason interviewem in april 2019 to discuss his book emblueprint the evolutionary origins of a good society emand his viral showdown with students over halloween costumes a hrefhttpsreasoncompodcast20190405theyaleprofessorattackedbyangrystulisten to ita or a hrefhttpswwwyoutubecomwatchvf56xghhzq_awatch it hereap | div picture source sizesminwidth 600px 331px 100vw typeimagewebp srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202111nchristakishs1jpgwebp 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202111nchristakishs11200x675jpgwebp 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202111nchristakishs1800x450jpgwebp 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202111nchristakishs1600x338jpgwebp 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202111nchristakishs1331x186jpgwebp 331w source sizesminwidth 600px 331px 100vw typeimagejpeg srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202111nchristakishs1jpg 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202111nchristakishs11200x675jpg 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202111nchristakishs1800x450jpg 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202111nchristakishs1600x338jpg 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202111nchristakishs1331x186jpg 331w img width1200 altnchristakishs1 srchttpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202111nchristakishs1800x450jpg height675 picture div pspanall respiratory pandemics follow script thats social political medical epidemiological says spanspanyale sociologist medical doctor nicholas christakis released new paperback edition authoritative book spana hrefhttpswwwamazoncomexecobidosasinb0895jc98freasonmagazinea20ispanapollos arrow profound enduring impact coronavirus way livespaniap pspanin conversation nick gillespie christakis pulls punches slamming failures politicians public health officials act quickly speak honestly covid19 pandemic left 750000 americans deadspanp pspanas newly minted member hrefhttpswwwthefireorgaboutusadvisorycounciladvisory councila foundation individual rights education fire hrefhttpsreasoncomvideo20190405theyaleprofessorattackedbyangrystua highprofile targeta ultrawoke campus activists christakis talks covid misinformation spread pundits politicians interested pushing ideology science best way forwardreally way forwardis robust debate public square argues recent events campusessuch massachusetts institute technology hrefhttpsreasoncom20211021mitdorianabbotcancellectureaffirmativeactioncanceling talka scientist critical views affirmative actionunderscore need radical shift favor free speech colleges universities spanp pchristakis previously appeared emtheem emreason interviewem april 2019 discuss book emblueprint evolutionary origins good societyemand viral showdown students halloween costumes hrefhttpsreasoncompodcast20190405theyaleprofessorattackedbyangrystulisten itaor hrefhttpswwwyoutubecomwatchvf56xghhzq_awatch hereap |
618c4854e619af73ac7369f7 | The Influence of Gingrich, the Triumph of Trump, and the Legacy of Conservative Court Appointments, with Jackie Calmes | pjackie calmes is one of the countrys foremost political reporters as the emwall street journalems chief political correspondent the white house correspondent for the emnew york timesem during the obama administration and now a columnist for the emlos angeles timesem she has an unparalleled knowledge of how congress and american politics have changed in recent decades particularly on the republican side p
pher new book emdissent the radicalization of the republican party and its capture of the courtem is at the same time a revealing biography of supreme court justice brett kavanaugh an indepth analysis of his controversial 2018 confirmation hearings and what they left out and a historical examination of the republican partys radicalization leading to the presidency of donald trump as she writes in the books preface trumps rise in the republican party was the logical result of the partys everrightward populist and antigovernment evolution a shift that coincided with my career in political journalism and was its single biggest storyp
pin this interview jackie discusses her four decades in journalism her studies of the influence of rightwing media on republican politics and her writing of emdissentem she covers the influence of newt gingrich in shifting the republican party toward populist conservatism the rise of the federalist society and its role in conservative battles over court appointments and trumps triumph in the 2016 republican primaries she describes the sexual assault allegations leveled against kavanaugh by christine blasey ford in the confirmation hearings but also the allegations that the fbi inadequately investigated she also predicts what kavanaugh as the pivotal justice in whats now a 63 conservativedominated supreme court may rule on contentious issues like abortion and gun rights p
iframe srchttpsplayersimplecastcom3b6556158087421dbb6a62e242720fdedarkfalse width100 height200pxiframe
h2transcript h2
pstrongjackie calmesstrong the tea party there was no leader it was almost amorphous but it was the base that writ large had been created and radicalized by this combination of postnewt gingrich politics and conservative mediap
pstronggeoff kabaservicestrong hello im geoff kabaservice for the niskanen center welcome to the vital center podcast where we try to sort through the problems of the muddled moderate majority of americans drawing upon history biography and current events im thrilled to be joined today by jackie calmes whos one of americas greatest political reporters she covered congress and the white house for 18 years with the emwall street journalem starting in 1990 and ultimately becoming the papers chief political correspondent she was then a white house correspondent for the emnew york timesem during the obama administration as well as a national politics reporter and chief economic correspondentp
psince then shes been the white house editor and a correspondent with the emlos angeles timesem washington bureau and she is the author of the terrific new book a hrefhttpswwwamazoncomdissentradicalizationrepublicanpartycaptureebookdpb08mzt57ncrefsr_1_1keywordsjackiecalmesqid1636485339sr81emdissent the radicalization of the republican party and its capture of the courtema welcome jackiep
pstrongjackie calmesstrong good to be with you geoffp
pstronggeoff kabaservicestrong good to have you here jackie as you know i am a big fan of the reportage in emdissentem which focuses on brett kavanaughs personal history his rise through conservative activist circles and his tumultuous supreme court confirmation hearings but im equally a fan of your work in that book as a historian and your ability to place the kavanaugh hearings as well as the trump presidency in the context of changes in the republican party and i want to read from the opening lines of emdissentem because i was so struck by this you wrote as my fortieth anniversary in journalism approached donald trump had just been elected president while his victory was a surprise including to himself he was no political aberrationp
ptrumps rise in the republican party was the logical result of the partys everrightward populist and antigovernment evolution a shift that coincided with my career in political journalism and was its single biggest story in many ways that is the history that ive been following as well in my own research and writing and i really love how you told this tale but before we get into some of the specifics of your pursuit of that story can you tell me something about your own background and how you came to be interested in political reporting as a careerp
pstrongjackie calmesstrong wow thats a big question well from my earliest childhood i gravitated to reading books of history and biographies as a child i remember there was this series of biographies in the public library that were biographies written for children about famous characters mostly men of course but there were a few on women and i read them all and so when people talk about nancy drew and those sorts of books i dont know what theyre talking about because i wasnt reading fiction i was just reading historyp
pthen as i got older and i knew i liked to write i loved history it was a matter of figuring out how do i make a living at that the only way i really could figure that out was journalism and the other advantage journalism has is you can do you can get a job with a bachelors degree i wouldnt have had to come up with the money for advanced degrees although i then did get a masters degree in journalism at northwestern but thats another separate story i wont bore you withp
pi also got into journalism because i wanted to see the country when i grew up people think i gravitated towards journalism because i sort of came of age during the watergate period bernstein and woodward and i wanted to be the female version but i had actually my interest predated that like i say it went back into elementary school so when i was at northwestern a recruiter came to the school for a chain of texas papers and he had an opening at one of their fourteen papers in abilene texas in west texas and so i thought well ive never been out of the ohiomichiganillinois area so thats a part of the country id like to seep
pi took the job i didnt particularly like living in abilene but within the year i was transferred and promoted to cover state government in austin for the papers chain so within a year of getting out of college i was covering politics and government and ive never stopped ive loved it from the start and ive seen the country ive seen the world with presidents and theres really no better way to see the world than traveling with a us president you get into rooms you would never get into as a tourist and see people like a drunk boris yeltsin in moscow one time its been great all around i never wouldve guessed how much the journalism industry would change and how much politics would change in that forty years so its been quite a ridep
pstronggeoff kabaservicestrong you grew up in the toledo ohio area correctp
pstrongjackie calmesstrong yesp
pstronggeoff kabaservicestrong did you grow up reading the emtoledo bladeemp
pstrongjackie calmesstrong yes im old enough that my father also subscribed to the emtoledo timesem which for a while was what we called the morning paper and the emtoledo bladeem was the afternoon paper that also made me interested in journalism how in the world do you know about the emtoledo bladeemp
pstronggeoff kabaservicestrong well ive actually been thinking about this because the niskanen center website just published a hrefhttpswwwniskanencenterorglocalbeatsnationalconsequencesthelinkbetweenlocalnewsandamericandemocratichealtha papera that i edited by robert saldin kal munis and richard burke on the decline of local newspapers that has a real connection to the decline of local community and perhaps the decline of local democracy as well on the television side there actually was an interesting a hrefhttpscronkitenewslabcommanagement20211021localnewsroomrecruitmentcrisispart1seta of a hrefhttpscronkitenewslabcommanagement20211020localnewsroomrecruitmentcrisispart2postsa in the i think its the knightcronkite news lab on the talent shortage in local tv newsrooms it really seems to me that there actually was great value in having started your reporting career in a place like abilene texas after having read a strong quality local newspaper like the toledo bladep
pstrongjackie calmesstrong right its interesting because when i was at northwestern a lot of my shall we say more privileged classmates were holding out for job offers from the likes of the networks or the national newspapers and probably well i know it was because i didnt have the luxury i needed to immediately get a job so i could pay all of my school debt i took the job as i did at a small paper and i have ever since that time i have considered that i was the smarter not only did my friends not get those jobs they were holding out for but they didnt get the sort of experience i didp
pyou get to do everything when youre at a small local paper and you get to i think its important especially if youre going to go on to cover politics that you see things from that local level i mean it was just a stroke of luck that i was seeing texas when i did at that point where the government it was just the eve of the reagan revolution and the south including texas was about to switch from oneparty democratic to eventually oneparty republican im looking forward to this paper you described because i really do think the decline of local journalism and its getting worse by the day is one of the reasons we find ourselves in the position we do of our democracy being under threatp
pi have a friend for instance who used to he had been in journalism with me years ago but then he got a law degree and ultimately became chief of staff to a governor of oregon and he told me not so long ago that theres next to no local coverage in the state capital or local papers in the state capital press corps in salem oregon and he said the state legislators can get away with murder thats the thing i mean the accountability youre missing a whole level of accountability nonpartisan accountability that voters need to make informed decisionsp
pstronggeoff kabaservicestrong i totally agree as you mentioned 1978 was a momentous midterm election during the jimmy carter presidency in the south because that really marked some of the first breakthroughs of the republican party into what had been the solid south and texans elected bill clements who was the first republican governor since reconstruction and even some of the democrats who got elected that year like phil gramm were very conservative boll weevil democratsp
pstrongjackie calmesstrong charlie stenholm in abilenep
pstronggeoff kabaservicestrong right who went on to become protorepublicans what i find interesting is you also reported that year on one of the republicans who lost which was george w bush who was running in texass 19th district which i guess is somewhat near abilenep
pstrongjackie calmesstrong yeah to the west midlandodessap
pstronggeoff kabaservicestrong theres a great story i still remember that he lost to democrat kent hance who was kind of a folksy guy george w bush had been a yale graduate and business school graduate not that long beforehand and he shot a campaign ad that showed him jogging presenting a strong physical appearance but joggers were pretty rare in that part of texas and hances comment was the only time folks around here go running is when someones chasing emp
pstrongjackie calmesstrong i tell you hance had a great sense of humor that was one of the things that helped get him elected he had been a state senator in texas and yes it was but again george w bush did better in that election in 1978 than he was expected to but democrats had a real advantage back then and the fact that bush did as well as he did was a sign of the wave to come for republicansp
pstronggeoff kabaservicestrong and then of course texas went for ronald reagan in 1980 although they had gone for carter in 76 the senate also turned republican for the first time since the eisenhower presidency you really were sort of witnessing the beginning of the conservative revolution at that timep
pstrongjackie calmesstrong absolutelyp
pstronggeoff kabaservicestrong then you moved to washington in 1984 to work for emcongressional quarterlyem for our friends who dont live inside the beltway what is cqp
pstrongjackie calmesstrong well cq is not back then it was different from what exists today its been sort of folded into other publications now but back then it was a weekly magazine even though it was called emcongressional quarterlyem and then they took to calling it emcq weeklyem it was someone who when they heard i was coming to washington said that if i really wanted to learn about congress i should go to emcongressional quarterlyem it was sort of an adjustment because i like newspapering and daily deadlines and just the pace of a newsroom cq was a little bit more it was slower and more detailoriented but boy did i get to know about congress down to the technical and procedural parliamentary levelp
pi was there for the better part of five years it was another advantage i had over daily newspapers is that not having a daily deadline i could at the end of a day walk around the halls of the congressional offices and just pop in and talk to staffers even talk to a member sometimes after hours id have red wine with senator pete domenici of new mexico the republican whose family were italian immigrants and he loved to get out the red wine it was a real learning experience not just in what i was writing but in what i was able to do in taking the time to build sourcing and learn things that reporters dont really have today in our 247 internet agep
pstronggeoff kabaservicestrong i know its a big and ultimately unanswerable question but how was washington how was congress how was politics different at that time from what it is nowp
pstrongjackie calmesstrong well it was all new to me at the time pretty much but it was interesting in that it seemed very partisan i mean i remember writing things and wed talk and members would kvetch about just how partisan things were and yet you had in each party you had a range of members from left to right on the spectrum you had liberal republicans and you had very conservative democrats over time they all left the liberal republicans their party got rid of them in republican primaries when more conservative people ran against them and a lot of the most conservative democrats either switched parties to the republican party or lost in their party primariesp
pso you had this homogenization of both parties over time but in the reagan era it still seemed very partisan and yet now we look back and it seems like the good old days compared to what we have now i dont even consider it partisanship its polarization now its almost a parliamentary government where you have each party sort of voting in lockstep for the most part democrats as we see are less guilty of that than republicans are but it was really exciting because you had diversity within each party to some extent it made the votes on legislation hard to predict and more sort of exciting to watchp
pwhat i saw really started to change bigtime with the newt gingrich era in the 90s in the house i say in the 90s but it had actually started by the midtolate 80s when i was there you could see the ferment among house republicans who had been a minority since the early 50s and were restless about it they considered that the leadership of the party was too complacent too cooperative with the democrats and had a minority mindset the republicans in the house started to radicalize when they decided that the way to shake things up was to be far more militant forget legislative compromises lets just battle it out and then take it to the votersp
pstronggeoff kabaservicestrong and how much of that change do you ascribe to gingrichp
pstrongjackie calmesstrong i ascribe a lot of it to gingrich but he started out as a what you and i know or used to call rockefeller republicans the more liberaltomoderate variety of republicans that reflected former new york governor and then vice president nelson rockefeller he was an opportunist gingrich was who sort of saw that this was taking hold in the republican party because it was taking hold already because of the license that ronald reagan had given to the conservatives in the party ronald reagan represented you know better than me a victory for the conservative wing of the party in what had been a decadeslong battle within the party between the moderate establishment and the conservative activists and the conservative wing this wing under reagan became empowered and through the 80s they became restive and wanted to exert their powerp
pand reagan likewise gave rise to things like very conservative think tanks on the right that also provided ideas new ideas for republicans there were also groups empowered that brought a more militant style to the party and gingrich harnessed all of that by the midtolate 80s he had started what was called the conservative opportunity society as i write in my book some of the members who were aligned with him on that came to say that newt gingrich was more opportunist than conservative but nonetheless he by the late 80s had made his way into house republican leadership and the establishment chafed at his stylep
phe didnt come to congress to pass legislation that became more and more true of republicans in general that were elected with his help he had what was called gopac the political action committee which provided not just money for other conservative candidates but also tapes for them about how to talk in fact and his slogan was be nasty which pretty much encapsulated his style he i think harnessed what was already percolating within the republican party and then took it to a whole new level and personalized itp
ppeople that werent around at the time dont realize just he was sort of the pretrump he was everywhere he was on the cover you remember he was emtimeem magazines man of the year and he was a big deal and the pretrumpp
pstronggeoff kabaservicestrong yeah which segments of the republican party or the conservative movement seemed to care most about the courts in your estimationp
pstrongjackie calmesstrong the courts were more in the background in my experience up to then i mean i knew about the federalist society which was one when i say that reagans victory and his presidency empowered and gave license to some of these groups the federalist society was formed on yales campus yale and university of chicago law professors were its mentors not least antonin scalia and robert bork and it formed in 1982 like i say and it just surprised itself by its success in going from an organization of conservative students on campuses to when they graduated becoming lawyer groups in the cities where they found jobs and the next thing you know theres a de facto job ladder for federalist society members who could then get into administration jobs in the reagan and bush administrations and then get on federal judgeships and all the way on up until we have now today all six of our republican appointees on the supreme court have been or are federalist society membersp
pi dont remember there were fights over judicial nominees in the senate from the time i came but they again were not as pitched as they would become in part because you had republican senators for instance who would vote against a reagan appointee or a george bush appointee as being too extreme too far right and it was really obviously the bork robert borks nomination to the supreme court in 1987 was the first big fight that i covered and that a lot of people will remember and to this day obviously conservatives go back to in the book i could refer to robert borks nomination fight and then clarence thomas in 1991 as the bloody shirts that conservatives to this day like to wave whenever theres a supreme court nomination as if to suggest that democrats are more liable than republicans for making battles against judicial nominees and doing so in a way that amounts to what the other side would call character assassination and so that really was something that evolved too on a parallel track with the increased radicalization of the republican party itselfp
pstronggeoff kabaservicestrong so skipping ahead a bit you and i first crossed paths i think in early 2015 when you were a fellow at the shorenstein center on media politics and public policy at harvards kennedy school how did that fellowship come aboutp
pstrongjackie calmesstrong it fell in my lap luckily at the time i was a emnew york timesem white house reporter all throughout my career id been too busy mostly with my job but also raising two kids to think about taking things or applying for seminars or fellowships and i got a call one day from the head of the program at the shorenstein center asking if i would like to be a fellow and i said sure i checked with my bureau chief at the emnew york timesem she was very supportive but that meant since i hadnt applied that i also didnt have a research topic to propose working on during the semester and i pretty quickly i talked to a couple of my colleagues and i pretty quickly came to one idea that had been gnawing at me for a long time which was to summarize my area of study what i researched at that point was the expansion of conservative media in the internet age and its corrosive of impact on the republican partyp
pand so in my earliest research in order to see how the republican party had come to where it was one of the first if not the very first books i read was yours emrule and ruinem i always have to look if its emrule or ruinem or emrule and ruinem emthe downfall of moderation and the destruction of the republican party from eisenhower to the tea partyem and then i also had consulted in addition to you also central to my thinking on getting me started was nicole hemmer a political scientist who was working on her doctorate and she was studying and continues to study the impact of conservative mediap
pand i was so interested in this because i had this it wasnt actually i didnt consider it a particularly novel idea to say the least but having watched the gingrich era and then on through george w bushs presidency and the tea party and in that time from 1996 on i had seen the growth of fox news but even more influential it seemed were these websites that were forming that were on the far right like breitbartcomp
pnot only could i see the impact it was having on among republicans in congress but i was fielding complaints and had been for several years from republican leadership staffers or members about just what a corrosive impact it was having on their members they had no control over their members anymore because their members were just going on fox or going to breitbart there was just this backandforth that empowered the members that had this channel to this media that was it was sort of a chickenandtheegg which one was calling the shots were the conservative media just trying to get clicks and viewers by putting out really rightwing stuff extreme stuff or were they reflecting what the grassroots wanted and in any case there was this crosspollination that was just really coming to impact what was happening on the hill and the increasing polarization and so it was a really good opportunity for me to stop and look into thatp
pstronggeoff kabaservicestrong and your paper called they dont give a damn about governing conservative medias influence on the republican party did anticipate a lot of the themes of niki hemmers book a hrefhttpswwwamazoncomdpb01kjcu648refdpkindleredirect_encodingutf8btkr1emmessengers on the rightema and i particularly like the quote you had from tom latham who i guess had just retired as a republican member of the house which gave your paper that quote he was talking about conservative media how they really just ignored the need for deliberation and compromise that the founders built into the legislative process and he told you they will not take 80 percent its got to be 100 percent or youre not pure they dont give a damn about governingp
pstrongjackie calmesstrong yeah the interesting thing about tom latham at that point a retiring congressman from iowa is that he had been a member of the gingrich revolutionary republican class of 1994 elected in 1994 and he began at the time he arrived in congress in january 95 he was among the most conservative members and by the time he left he was completely disillusioned and worried for his partyp
pand it was worse than what you say about they discouraged or looked down on compromise which as you and i would agree is essential as they say its the art of politics they not only looked down they penalized it you had seen by 2015 a number of examples of prominent and undeniably conservative republicans who were challenged and defeated in republican primary elections or conventions because they had committed the mortal sin of compromising with a democratp
pi mean the best example that pops to mind and which really put a chill in many republicans in congress was in 2010 the tea party year when robert bennett a conservative senator from utah was defeated for renomination in a convention of the utah republican party chiefly because he had specifically compromised come up with a compromise healthcare plan with democrat ron wyden of oregon and the idea that this respected conservative could be not conservative enough simply because he had compromised with a democrat was just so memorable im here talking about it today but it really did scare other republicans into not compromising anymore you could just see it the impact of that so the extent to which compromise became a fourletter word was so destructivep
pstronggeoff kabaservicestrong your paper didnt quite predict the triumph of donald trumpp
pstrongjackie calmesstrong nop
pstronggeoff kabaservicestrong but you did notice that trump was one of the relatively few republican presidential candidates in 2015 who would repeatedly appear on second or thirdtier radio shows like the steve deace show out of iowa and would get a very favorable response from his audiencep
pstrongjackie calmesstrong yeah because he really was speaking to that audience people just liked that he was saying what they thought and saying it in a way that they especially and were talking i mean these audiences were predominantly white male and he had great appeal to them now steve deace himself the conservative whos still a conservative broadcaster in iowa and who takes his influence from the fact that he does work in the state that is the first to vote in presidential nominating contests he came not to like trump himself and especially was turned off when in 2015 later after id already written my paper when trump famously said that he didnt like senator john mccain because he didnt like people in the military who got captured and deace that turned him off but deace has since become much he seems pretty trumpy to me as i follow him on twitter so he just is indicative of much of the rest of the republican party which in fact has become the trump partyp
pstronggeoff kabaservicestrong there are a thousand reasons we could come up with for trumps success both in the republican presidential primaries in 2016 and then in the general election but what in hindsight seemed to be to you to be some of the big reasonsp
pstrongjackie calmesstrong for the rise of trump i think trump was the ultimate opportunist he saw that the republican party base was one that i mean it played to the issues that he had actually in fairness been talking about since the late 80s a xenophobic message against immigrants he went back and forth sort of like the republican party was doing at that point on military he didnt like military adventurism and yet he wasnt quite isolationist to this day he insists he wasnt once in favor of the iraq invasion when actually he wasp
pbut this base was there and he having been 14 seasons on the apprentice he knew how to play the media use the media and to a mass audience of i dont want to say lowestcommondenominator but it wasnt exactly highbrow television the apprentice and so he was very adept at the media and like i say he spoke their language he had been shameless from the time he was in the new york tabloids in the 80s and he shocked everyonep
phe was in a field in 2015 2016 for that 2016 nomination fight that included some of the stars of the republican party led perhaps by jeb bush and senator marco rubio and ted cruz was in the mix of course and scott walker the governor of wisconsin i mean nobody in the republican party i talked to was predicting that trump would emerge as the winner and people didnt even take him seriously including in journalism people put their bteam reporters on trump and within a short time he had come to the front of the polls as you remember and then once the voting started it was virtually over and by march of 2016 he was the nominee apparentp
pbut he took this base that had already been radicalized by first newt and then through the tea party era and he spoke their language and he was shameless and unlike the members the leadership of the party which had been throwing red meat to the base for years but knowing that they wouldnt do anything about it once they were elected because they either couldnt like as in balancing the budget or knew it would be terrible politics for general elections like defunding planned parenthood or repealing obamacare the base had become so disillusioned by all of these broken promises and stoked by conservative media which was constantly complaining about the republican establishment at that point that trump was able to waltz in as the most antiestablishment candidate of them all and win the nominationp
pstronggeoff kabaservicestrong i agree but to return to those first sentences in your book you said that trump was no political aberration his rise was the logical result of the partys rightward trajectory you know in 2015 2016 he was far from the most orthodox conservative candidate in fact he might have been the most unorthodox conservativep
pstrongjackie calmesstrong rightp
pstronggeoff kabaservicestrong so was there a contradiction therep
pstrongjackie calmesstrong i dont think so in part because of what the base had the extent to which by the time he came along the base was sort of like the tail wagging the dog the base was effectively calling the shots the leadership of the party was reacting to the base and conservatism as we think of it policy ideas no longer seemed to be all that important or at least the old ideas that united the party werent you had trade free trade and immigration of a somewhat liberal i dont mean open borders but immigration was considered a good thing and balanced budgets low spending and trump was opposed to all of that but so was the basep
pin the tea party for instance you had people protesting congress saying keep your hands off my medicare the base had rejected the paul ryan kind of ideas of entitlement reform and so when i say trump was the logical extension im thinking in terms of what that the leadership of the party had and not just gingrich and postgingrich had created this more militant base that eschewed compromise but also the conservative media had done so i mean i think we all tend to underestimate the impact of conservative media in this i cant think of the word the relationship was sort of like i say chickenandegg between the audience and who was influencing whom the audience or the broadcasters but in any case there was this mutual radicalization thats what trump was the logical extension of the fact that the party had become [radical]p
pi talk about four revolutions of which trump was the fourth reagan and then gingrich and then that third revolution the one that was the predicate for trump which was bottomup any previous political movement usually had a leader that was associated with it in this one the tea party there was no leader it was almost amorphous but it was the base that had been writ large that had been created and radicalized by this combination of postnewt gingrich politics and conservative media and so that was what trump was an extension of he took that headless movement and he harnessed it and he became the leader of itp
pstronggeoff kabaservicestrong in hindsight one of trumps most durable legacies i am sure will be seen to have been his appointment of three conservative supreme court justices neil gorsuch brett kavanaugh and amy coney barrettp
pstrongjackie calmesstrong yesp
pstronggeoff kabaservicestrong and the nomination process for each was extremely controversial in gorsuchs case because then senate majority leader mitch mcconnell failed to allow a vote to confirm president obamas nominee merrick garland allegedly because the vacancy occurred during the 2016 election year in barretts case the nomination was controversial because the senate controlled by republicans confirmed her days before the 2020 election then controversies surrounding kavanaugh of course were in a different register altogether but the appointment of those three judges as you describe it brings to fruition this fortyyear conservative movement plan to get a conservative majority on the court even though that goal was tangential at best to trumps populist vision to the extent that he had one so how did you come to the idea of writing a book about brett kavanaugh as a representative figure for the republican partys rightward transformationp
pstrongjackie calmesstrong well again it was one of these things that fell in my lap which is why i guess i was smart to never make fiveyear plans but i had been talking to an agent and an editor at one of the publishing houses since early 2017 after trumps election and i had left the emnew york timesem and wanted to do more indepth journalism including writing a book so i was talking to this agent and this editor about trying to come up with a book concept that would allow me to tell the story of the forty years that i had witnessed or was coming up on forty years of the evolution of the republican party at that point i was calling it the evolution or the transformation i thought radicalization was a bridge too far but i quickly dispensed with that thinking and radicalization seemed just rightp
pbut in any case because of the press of i then got a job as a white house editor and i was just too busy to think about the book then they came to me in 2018 just as brett kavanaugh was about to be confirmed and they wanted a book on the controversial confirmation of brett kavanaugh about him i didnt particularly want to write a book that was just about him so i countered by suggesting by that point i knew a little bit about him and i thought he was the perfect what some people call petri dish republican that he represented the perfect specimen of what it takes to succeed in the republican party these days which is a blend of politics as well as conservative policies recordp
pbut he just was again also what a couple senators called him was a forrest gump or zeliglike figure where he just was uncannily at the scene of some of the biggest moments in the republican partys evolution so what we came to is i would write this book about kavanaugh and his story from his birth within the beltway of washington dc to a republican lobbyist father and a mother who had changed parties from democrat to republican in this same era as so many people did and juxtapose his story with what was happening more broadly in the republican party both in the political arena and in this evolution of the federalist society and other conservative organs to create this de facto system of identifying and vetting what would be considered true conservatives for the judiciary from district to appeals court to supreme court which has been successful beyond any of the founders dreamsp
pso thats what i did i think it worked pretty well i mean just to summarize kavanaugh when i say that he was a zelig or zeliglike figure he was like i say born within the beltway he went to yale which was the founding camp and yale law school and joined the federalist society just a couple years after it had been formed he quickly saw that it was a good point of reference to have on your resum if you wanted to move up in republican circles he worked for ken starr who was the solicitor general under george h w bush did i get that rightp
pstronggeoff kabaservicestrong yesp
pstrongjackie calmesstrong or was it at the end of reagan i think it was george h w bush and he clerked for some of the most conservative judges on the federal bench and then ultimately for anthony kennedy who wasnt one of the most conservative but he was a republican appointee on the supreme court so from there kavanaugh went to ken starr and for four years worked for ken starr on the investigation of bill and hillary clinton which i think was really the era in which he like so many other people became much more he became more partisan and the country became more divided along political lines then he briefly did some private practice in which he worked at what he considered pro bono on some politically charged cases that were popular in the conservative communityp
pand then from embush v goreem in which he like a lot of republican lawyers had a role he secured a job in the west wing of george bushs white house george w bushs white house and immediately was seen as again hed been marked for the federal bench because he was not just a proven conservative but a loyal republican so the rest is historyp
pthe other thing when he was nominated for the dc circuit court of appeals he became representative of what had become by that point you asked earlier about the judicial fights by the george w bush era the judicial confirmations there were more battles than not in a lot of these appeals court nominations his took three years and then george w bush predicted that some republican president would make brett kavanaugh a supreme court justice and indeed trump didp
pstronggeoff kabaservicestrong although interestingly you also point out that kavanaughs associations with the bushes counted against him in the trump era at least among some of trumps most populist advisorsp
pstrongjackie calmesstrong yes so trump had come out with these three lists to reassure evangelical voters and conservative voters generally that he would indeed name conservatives to the court and to the courts of all levels he put out this list twice before he was elected of actual people he would name no one had done this yet brett kavanaughs name even though anybody you asked in the conservative legal community wouldve named brett kavanaugh as among their prospective supreme court candidates he didnt make trumps list until after trump was already president and it was a year into his presidency or nearly a year when trump came out with a third list a lot of it was just thisp
ptrump as you suggest wanted nothing to do with anything that smacked of the bush era he was as dismissive of george w bush and everything he represented as he was of barack obama but i think the thing that overcame it was in a large part trumps white house counsel don mcgahn he knew kavanaugh well and really liked the fact that kavanaugh like neil gorsuch is somebody who casts a real skeptical eye opposes much federal regulation of business and the environment and such the administrative state as they say and so he was really keen i think without don mcgahn brett kavanaugh would not have been a trump nomineep
pstronggeoff kabaservicestrong but then curiously what does endear kavanaugh to trump supporters is his lashing out at the left during his confirmation hearingsp
pstrongjackie calmesstrong yesp
pstronggeoff kabaservicestrong you provide a very detailed sensitive nuanced discussion of those hearings the accusations brought against kavanaugh by psychologist christine blasey ford as well as what really had been underreported stories about sexual incidents in which hed been involved as an undergraduate at yalep
pstrongjackie calmesstrong yeah i do think i mean a lot of people will say that trump should not have gotten to fill the scalia seat that went to neil gorsuch or the ruth bader ginsburg seat that went to amy coney barrett but i think the one seat trump was obviously within his rights as president to have filled was the one from anthony kennedys retirement but theres a lot of other conservatives who could have filled that seat other than brett kavanaughp
pi think we all know about christine blasey ford but the case that republicans being the majority in the senate right then were able to just railroad was the allegation from debbie ramirez who had been his classmate at yale she suggested that he had and she acknowledged she had been very drunk that he had exposed himself to her and with his friends essentially forced her to handle his penisp
pshe never got the hearing that christine blasey ford did i met debbie and talked to her at length multiple times i think she wouldve been at least as credible a witness as christine blasey ford and you dont have to take my word i mean it was trump himself who after christine blasey ford testified publicly said she was both credible and compelling of course this was before he subsequently and ever since has called her a liar it was disturbing to me the way they were able to just railroad it through they only allowed for an fbi investigation when they had to because they wouldve lost at least two republican votes if they didnt have this investigation but the investigation was a sham it was really no investigation at all as i go into in my bookp
pthere were so many of brett kavanaughs classmates who wanted to testify as to his it didnt have anything to do with the sexual assault allegations but the fact that they felt and these were people who had been friends of his friendly acquaintances of his and they said when they saw him on fox news and then in his testimony before the senate that he had lied about the extent of his drinking he had lied when he denied that he had never blacked out from drinking couldnt remember what he had done all of that was central to his defense because if he had blacked out or couldnt remember what he had done it wouldve been more possible to believe that he had sexually assaulted someone when he was terribly drunk and just didnt remember it so it would undercut his denialsp
pbut in addition to that there was a third allegation from another yale woman who and this has been reported which never came out she says she does not remember ive talked to her friends she was so drunk that she didnt remember but there is an eyewitness a very credible eyewitness but he wanted only to talk to the fbi and to the senate and off the record the thinking being that if he told them what he had seen on top of the other allegations that the senators would go to the white house and tell trump to nominate someone else he was never allowed to talk to the fbi to this day has not contacted him he was never allowed to talk to the senators privately and so kavanaughs confirmation was rushed throughp
pbut as i say in the book and ive written since you can set aside the sexual assault allegations if you like if you think those things can never be determined there are other what i think are lies that brett kavanaugh told under oath not just about his collegeage drinking but also about things that he had been asked about incidents that occurred when he was a white house aide to george w bush having to do with a senate scandal over democrat stolen emails over judicial nominees that brett kavanaugh worked on and some policy areas for instance having to do with the handling of foreign detainees in what the bush administration called the war on terror all of these things undercut his credibility even before you get into a hesaidshesaid fightp
pto me the argument is compelling when you take the allegations which cant be answered the record that suggests very strongly that he at best misled the senators under oath at worst lied and add to that what i would consider and frankly what former now the late justice john paul stevens considered his disqualifying tirade on september 27th 2018 when he testified after christine blasey ford before the senate judiciary committee in such an angry partisan confrontational manner completely opposite to anything we would consider as reflecting judicial temperament i think by all rights his nomination should have been withdrawn and another conservative put in his placep
pstronggeoff kabaservicestrong i was a year behind kavanaugh in college i do remember him with a beer in hand and a look of an aggrieved opossum on his face which i suppose is neither here nor there but i guess the question is do you think the democrats could have handled this nomination in a way that wouldve led to some other outcome or is his nomination simply a product of the polarized dynamic that we have now in congressp
pstrongjackie calmesstrong i dont think there were i mean there are certainly things democrats could have done better and should have done i mean somehow the allegation from the eyewitness there should have been a way to force that into the senate inner circle in a way that maybe wouldve kept it from becoming public but at least senators wouldve known about it but frankly i dont think theres anything democrats could have done that was going to overcome thensenate majority leader mitch mcconnells determination to ram that nomination through and combined with that what was critical to kavanaughs success was the continued support of donald trump i mean we all watched donald trump for four years he could just as well have kicked kavanaugh to the curb and named somebody else on his list but he didnt and perversely i think part of that is because of the nature of the allegations against trumpp
ptrump has a wellknown record and long one and hes added to it since of coming not only when allegations are lodged against him but against any man of a sexual nature it just gets his juices going and he came to the defense this was his kind of fight he was going to defend brett kavanaugh against this and brett kavanaughs angry performance before the senate judiciary committee was like so many other things republicans did in the trump era it was for an audience of onep
pit pleased trump who already had made known that he was not happy with brett kavanaughs appearance on fox news with his wife earlier in which he thought kavanaugh had been too much of a whimpering puppy and he wanted him to go on the attack and don mcgahn coached kavanaugh to that effect but im not kavanaugh was politically savvy i dont even think he well people have suggested to me forget what i think republicans have suggested he didnt need don mcgahn to tell him to come out with all guns blazing before the senate judiciary committee he knew thats what trump wanted and trump embraced it trump nominated him and trump made sure he got confirmed and mitch mcconnell of course was equally responsiblep
pstronggeoff kabaservicestrong there was an a hrefhttpswwwnytimescom20211031uspoliticskavanaughtexasabortionlawhtmlarticlea just a few days ago in the emnew york timesem which is talking about how kavanaugh has come to wield enormous power as the justice at the courts ideological center which of course is not to be confused with making him a moderate hes not a moderatep
pstrongjackie calmesstrong nop
pstronggeoff kabaservicestrong hes come down on the right side on a number of issues but he has voted i think 91 percent of the time in divided decisions with john roberts the chief justice and he seems to share some of roberts concerns for protecting the institutional authority of the courtp
pstrongjackie calmesstrong yeahp
pstronggeoff kabaservicestrong so its the sort of 64 question here in washington but how do you think kavanaugh is likely to vote in some contentious issues we can see coming up particularly abortionp
pstrongjackie calmesstrong well abortion specifically i see him i mean i ultimately think the court is going to find a way the conservatives on the court the sixjustice supermajority to greatly undercut if not effectively do away with abortion rights much as texas has effectively done away with abortion rights even though they havent come right out and banned them altogether theyll find a way to do that in these two cases from texas and mississippi without producing the headline that says court overturns emroe v wadeemp
pand i very much think kavanaugh will be in being on the dc court of appeals thats a court considered the secondmost prestigious based here in washington that mainly handles is known for handling cases having to do with issues of which the federal government is a party and so you didnt get a lot of abortion cases but towards the end of his twelveyear tenure there there was one in which he was very much people say he was auditioning for a supreme court nomination by his coming down very strongly in an antiabortion way in a case that came before that courtp
pso i have no doubt that he will be deciding against abortion but i also think that partly because of what you suggest about how he and the chief justice are cognizant of the courts public standing and institutional standing he will not want to just flatout overturn roe but i also think in his case it reflects his political savvy this is a guy who was working from the ken starr years on through the bush first term very much as someone who was at the center of the biggest political fights of our day and i think he knows that it would not be good for the republican party to have an outright overturning of emroe v wadeem but he will support anything that goes right up to that pointp
pthe other major case of the term of course is going to be on gun rights and he has signaled throughout his judicial career on this court of appeals and in his short time on the supreme court that he is very much for expanding gun rights and for expanding the individual right to bear arms which was only carved out on the supreme court in 2008 in the a hrefhttpswwwoyezorgcases200707290hellera casep
pand he in fact was quite vocal in terms of one of his judicial writings in a dissent about well more than just once about bemoaning the fact that the court had not accepted a gun case in a decade in more than a decade since emhellerem and a hrefhttpswwwoyezorgcases2009081521mcdonalda and that he was very eager for the court to take up a case and now they have one and i think he will definitely be in favor of expanding gun rightsp
pstronggeoff kabaservicestrong it does seem for a number of reasons that the republicans have been much more focused on the courts and appointing conservative justices than the democrats have been interested in and made a priority of judicial appointments in recent decades does that seem like a fair statementp
pstrongjackie calmesstrong oh absolutely and its a cause of no small concern to a lot of democratic activists and frankly ive wondered through the years i mean going back to the early 90s when the famous case that upheld emroe v wadeem although it limited it a bit was the a hrefhttpswwwoyezorgcases199191744planned parenthood v caseya case out of pennsylvania in 1993 so those are considered the two big abortion cases roe and emplanned parenthood v caseyemp
pand i have always long seen that abortion rights among others were in danger of the precedents being overruled and democrats democratic voters never seemed to care as much about the courts but when you think about it it makes sense because the earl warren era the 60s that so greatly expanded civil rights and the like criminal rights you know there was a complacency on the left and the centerleft while the right was really mobilized by cases going back to the 60s having to do with prayer in the schools then emroe v wadeem and religious rights there was more reason forp
pand the more you brought evangelicals into the republican party that became even more true and then the business wing of the republican party wanted to fight a lot of these environmental regulations and other business regulations so there was much more incentive on the right and centerright even to have the court be an issuep
pthat started to change with embush v goreem when democrats sat up and thought holy cow a 54 conservative majority could essentially pick the president and so you saw the beginnings of efforts to form an analogue to the federalist society but it just didnt work the democrats just dont have the incentive that the right does to work the courts that is beginning to change has changed some and you see it in joe bidens judicial nominations the sort of people hes nominating to the courts but its still an imbalance a great imbalancep
pstronggeoff kabaservicestrong and one gets a sense for example that a republican administration if the situation had been reversed wouldve strongly encouraged someone like ruth bader ginsburg to retire rather than die in office and give the opposing party a chance to appointp
pstrongjackie calmesstrong yesp
pstronggeoff kabaservicestrong a justice of their liking it doesnt seem that the democrats have been playing politics all that well in recent yearsp
pstrongjackie calmesstrong right and stephen breyer continues to resist the pressure hes under and i get that that said take ruth bader ginsburg i mean barack obama went to the extent of having lunch with her and making it clear we dont know how explicit he was but its clear what the point of their talk was and she essentially she loved her job so much she just wanted to stay therep
pand stephen breyer feels much the same way he sort of operated in ruth bader ginsburgs more senior shadow for years and hes finally now the most senior democratic appointee so whenever theyre in the minority as the three democratic appointees often are he gets to decide who writes the opinion and he gets first dibs and so hes finally for this term for the first time in that position and he doesnt you can see why he doesnt want to give that upp
pthat said hes also someone who worked as a staffer for ted kennedy on the senate judiciary committee he has seen what mitch mcconnell has done to politicize the judicial confirmation process to the extent of giving trump three instead of just one supreme court seats to fill you would think that he would sort of step aside i mean hes in his eighties step aside and let biden name his younger replacementp
pbut this is a club of nine as much as they may disagree on things they also are very protective instead of doing what i just described that i think he should do and what a lot of other people think he should do he has written a book in which he virtually and on his book tour denies that there is any sort of political bent to the supreme court whichp
pall you have to do is read some of the opinions of sam alito and the things they do and the fact that amy coney barrett despite her showing shes not as far right as maybe people thought she nonetheless gives a speech at the mitch mcconnell center with mitch mcconnell at her side to insist that the court isnt very partisan which was like clearly this supreme court justice does not have a press advisor at her side because it was a really stupid thing to do it only made the pointp
pstronggeoff kabaservicestrong since youve mentioned mitch mcconnell nowp
pstrongjackie calmesstrong several timesp
pstronggeoff kabaservicestrong its interesting that your book ends by throwing the spotlight on mcconnell and you seem to give him the award for the most consequential and perhaps malignant figure in american politics of the past several decadesp
pstrongjackie calmesstrong yeah and thats very perceptive of you to bring that up because i thought about that i thought this book is essentially about kavanaugh and what he reflects about the party at large and then im ending with this other individualp
pbut i thought it was appropriate and i do think hes consequential i cant take anything away from mitch mcconnells effectiveness god knows but im not one of these journalists who thinks that effectiveness is the beall and endall i think there has to be a what is the end that justifies these means and he would tell you its a more conservative government i think he has undermined the institution of the senate and the institution of the supreme court two of our branches of government not bad and i think that has consequencesp
pand i can actually say i was covering congress the year he arrived in january of 1985 when he was elected to the senate from kentucky and i was struck from his very first term that this was a guy who like gingrich for instance didnt want to be a legislator he wasnt interested in legislating he was interested in blocking legislation and working to expand things that would help the party things like expanded campaign finance things within the senate he clearly wanted to get on the leadership ladderp
pso where he differed from gingrich is mcconnells was very much an inside game working inside the senate to move up where gingrich wanted to be this sort of outsize outside figure running the house but being this leader of a conservative movement and so mcconnell obviously has been the most longlived and more effective than gingrich ever was and i just think hes had a huge impact and not a good onep
pand i have to add what i think of mcconnell is he is the ultimate of what john mccain used to say party over country and i could but wont tick off examples aside from what weve talked about in terms of his bending all norms and rules to get both gorsuch well gorsuch kavanaugh and amy coney barrett on the court despite any clear hypocrisy that he evidences in doing sop
pbut there have just been so many things over the years as i watched him that i just have to wonder and now ultimately he has said some of the right things about donald trump and his attempted coup and the extent to which donald trump has weakened democracy but hes then turned around and said he would absolutely support him as the nominee of the party in 2024 and in every other way has enabled donald trumpp
pso i just think he will continue on and whatever happens to trumpism mitch mcconnell will remain and so he is i think an overlooked he gets a lot of attention but i still think people overlook just how consequential he has beenp
pstronggeoff kabaservicestrong well jackie congratulations again on your book emdissent the radicalization of the republican party and its capture of the courtem and thanks so much for joining me here todayp
pstrongjackie calmesstrong thank youp
pstronggeoff kabaservicestrong and thank you all for listening to the vital center podcast please subscribe and rate us on your preferred podcasting platform and if you have any questions comments or other responses please include them along with your rating or send us an email at contactniskanencenterorg thanks as always to our technical director kristie eshelman our sound engineer ray ingegneri and the niskanen center in washington dcp
pphoto credit a relnoreferrer noopener hrefhttpswwwistockphotocomphotouscapitol16gm1028327804275663831clarityfalse target_blankistockap
pthe post a relnofollow hrefhttpswwwniskanencenterorgtheinfluenceofgingrichthetriumphoftrumpthelegacyofconservativecourtappointmentswithjackiecalmesthe influence of gingrich the triumph of trump and the legacy of conservative court appointments with jackie calmesa appeared first on a relnofollow hrefhttpswwwniskanencenterorgniskanen centerap | pjackie calmes countrys foremost political reporters theemwall street journalems chief political correspondent white house correspondent theemnew york timesemduring obama administration columnist theemlos angeles timesem unparalleled knowledge congress american politics changed recent decades particularly republican sidep pher new bookemdissent radicalization republican party capture courtemis time revealing biography supreme court justice brett kavanaugh indepth analysis controversial 2018 confirmation hearings left historical examination republican partys radicalization leading presidency donald trump writes books preface trumps rise republican party logical result partys everrightward populist antigovernment evolution shift coincided career political journalism single biggest storyp pin interview jackie discusses decades journalism studies influence rightwing media republican politics writing ofemdissentem covers influence newt gingrich shifting republican party populist conservatism rise federalist society role conservative battles court appointments trumps triumph 2016 republican primaries describes sexual assault allegations leveled kavanaugh christine blasey ford confirmation hearings allegations fbi inadequately investigated predicts kavanaugh pivotal justice whats 63 conservativedominated supreme court rule contentious issues like abortion gun rightsp iframe srchttpsplayersimplecastcom3b6556158087421dbb6a62e242720fdedarkfalse width100 height200pxiframe h2transcript h2 pstrongjackie calmesstrong tea party leader amorphous base writ large created radicalized combination postnewt gingrich politics conservative mediap pstronggeoff kabaservicestrong hello im geoff kabaservice niskanen center welcome vital center podcast try sort problems muddled moderate majority americans drawing history biography current events im thrilled joined today jackie calmes whos americas greatest political reporters covered congress white house 18 years emwall street journalem starting 1990 ultimately papers chief political correspondent white house correspondent emnew york timesem obama administration national politics reporter chief economic correspondentp psince shes white house editor correspondent emlos angeles timesem washington bureau author terrific new book hrefhttpswwwamazoncomdissentradicalizationrepublicanpartycaptureebookdpb08mzt57ncrefsr_1_1keywordsjackiecalmesqid1636485339sr81emdissent radicalization republican party capture courtema welcome jackiep pstrongjackie calmesstrong good geoffp pstronggeoff kabaservicestrong good jackie know big fan reportage emdissentem focuses brett kavanaughs personal history rise conservative activist circles tumultuous supreme court confirmation hearings im equally fan work book historian ability place kavanaugh hearings trump presidency context changes republican party want read opening lines emdissentem struck wrote fortieth anniversary journalism approached donald trump elected president victory surprise including political aberrationp ptrumps rise republican party logical result partys everrightward populist antigovernment evolution shift coincided career political journalism single biggest story ways history ive following research writing love told tale specifics pursuit story tell background came interested political reporting careerp pstrongjackie calmesstrong wow thats big question earliest childhood gravitated reading books history biographies child remember series biographies public library biographies written children famous characters men course women read people talk nancy drew sorts books dont know theyre talking wasnt reading fiction reading historyp pthen got older knew liked write loved history matter figuring living way figure journalism advantage journalism job bachelors degree wouldnt come money advanced degrees masters degree journalism northwestern thats separate story wont bore withp pi got journalism wanted country grew people think gravitated journalism sort came age watergate period bernstein woodward wanted female version actually interest predated like went elementary school northwestern recruiter came school chain texas papers opening fourteen papers abilene texasin west texas thought ive ohiomichiganillinois area thats country id like seep pi took job didnt particularly like living abilene year transferred promoted cover state government austin papers chain year getting college covering politics government ive stopped ive loved start ive seen country ive seen world presidents theres better way world traveling president rooms tourist people like drunk boris yeltsin moscow time great wouldve guessed journalism industry change politics change years ridep pstronggeoff kabaservicestrong grew toledo ohio area correctp pstrongjackie calmesstrong yesp pstronggeoff kabaservicestrong grow reading emtoledo bladeemp pstrongjackie calmesstrong yes im old father subscribed emtoledo timesem called morning paper emtoledo bladeem afternoon paper interested journalism world know emtoledo bladeemp pstronggeoff kabaservicestrong ive actually thinking niskanen center website published hrefhttpswwwniskanencenterorglocalbeatsnationalconsequencesthelinkbetweenlocalnewsandamericandemocratichealtha papera edited robert saldin kal munis richard burke decline local newspapers real connection decline local community decline local democracy television actually interesting hrefhttpscronkitenewslabcommanagement20211021localnewsroomrecruitmentcrisispart1seta hrefhttpscronkitenewslabcommanagement20211020localnewsroomrecruitmentcrisispart2postsa think knightcronkite news lab talent shortage local tv newsrooms actually great value having started reporting career place like abilene texas having read strong quality local newspaper like toledo bladep pstrongjackie calmesstrong right interesting northwestern lot shall privileged classmates holding job offers likes networks national newspapers probably know didnt luxury needed immediately job pay school debt took job small paper time considered smarter friends jobs holding didnt sort experience didp pyou youre small local paper think important especially youre going cover politics things local level mean stroke luck seeing texas point government eve reagan revolution south including texas switch oneparty democratic eventually oneparty republican im looking forward paper described think decline local journalism getting worse day reasons find position democracy threatp pi friend instance journalism years ago got law degree ultimately chief staff governor oregon told long ago theres local coverage state capital local papers state capital press corps salem oregon said state legislators away murder thats thing mean accountability youre missing level accountability nonpartisan accountability voters need informed decisionsp pstronggeoff kabaservicestrong totally agree mentioned 1978 momentous midterm election jimmy carter presidency south marked breakthroughs republican party solid south texans elected bill clements republican governor reconstruction democrats got elected year like phil gramm conservative boll weevil democratsp pstrongjackie calmesstrong charlie stenholm abilenep pstronggeoff kabaservicestrong right went protorepublicans find interesting reported year republicans lost george w bush running texass 19th district guess somewhat near abilenep pstrongjackie calmesstrong yeah west midlandodessap pstronggeoff kabaservicestrong theres great story remember lost democrat kent hance kind folksy guy george w bush yale graduate business school graduate long shot campaign ad showed jogging presenting strong physical appearance joggers pretty rare texas hances comment time folks running someones chasing emp pstrongjackie calmesstrong tell hance great sense humor things helped elected state senator texas yes george w bush better election 1978 expected democrats real advantage fact bush sign wave come republicansp pstronggeoff kabaservicestrong course texas went ronald reagan 1980 gone carter 76 senate turned republican time eisenhower presidency sort witnessing beginning conservative revolution timep pstrongjackie calmesstrong absolutelyp pstronggeoff kabaservicestrong moved washington 1984 work emcongressional quarterlyem friends dont live inside beltway cqp pstrongjackie calmesstrong cq different exists today sort folded publications weekly magazine called emcongressional quarterlyem took calling emcq weeklyem heard coming washington said wanted learn congress emcongressional quarterlyem sort adjustment like newspapering daily deadlines pace newsroom cq little bit slower detailoriented boy know congress technical procedural parliamentary levelp pi better years advantage daily newspapers having daily deadline end day walk halls congressional offices pop talk staffers talk member hours id red wine senator pete domenici new mexico republican family italian immigrants loved red wine real learning experience writing able taking time build sourcing learn things reporters dont today 247 internet agep pstronggeoff kabaservicestrong know big ultimately unanswerable question washington congress politics different time nowp pstrongjackie calmesstrong new time pretty interesting partisan mean remember writing things wed talk members kvetch partisan things party range members left right spectrum liberal republicans conservative democrats time left liberal republicans party got rid republican primaries conservative people ran lot conservative democrats switched parties republican party lost party primariesp pso homogenization parties time reagan era partisan look like good old days compared dont consider partisanship polarization parliamentary government party sort voting lockstep democrats guilty republicans exciting diversity party extent votes legislation hard predict sort exciting watchp pwhat saw started change bigtime newt gingrich era 90s house 90s actually started midtolate 80s ferment house republicans minority early 50s restless considered leadership party complacent cooperative democrats minority mindset republicans house started radicalize decided way shake things far militant forget legislative compromises lets battle votersp pstronggeoff kabaservicestrong change ascribe gingrichp pstrongjackie calmesstrong ascribe lot gingrich started know rockefeller republicans liberaltomoderate variety republicans reflected new york governor vice president nelson rockefeller opportunist gingrich sort saw taking hold republican party taking hold license ronald reagan given conservatives party ronald reagan represented know better victory conservative wing party decadeslong battle party moderate establishment conservative activists conservative wing wing reagan empowered 80s restive wanted exert powerp pand reagan likewise gave rise things like conservative think tanks right provided ideas new ideas republicans groups empowered brought militant style party gingrich harnessed midtolate 80s started called conservative opportunity society write book members aligned came newt gingrich opportunist conservative nonetheless late 80s way house republican leadership establishment chafed stylep phe didnt come congress pass legislation true republicans general elected help called gopac political action committee provided money conservative candidates tapes talk fact slogan nasty pretty encapsulated style think harnessed percolating republican party took new level personalized itp ppeople werent time dont realize sort pretrump cover remember emtimeem magazines man year big deal pretrumpp pstronggeoff kabaservicestrong yeah segments republican party conservative movement care courts estimationp pstrongjackie calmesstrong courts background experience mean knew federalist society reagans victory presidency empowered gave license groups federalist society formed yales campus yale university chicago law professors mentors antonin scalia robert bork formed 1982 like surprised success going organization conservative students campuses graduated lawyer groups cities found jobs thing know theres de facto job ladder federalist society members administration jobs reagan bush administrations federal judgeships way today republican appointees supreme court federalist society membersp pi dont remember fights judicial nominees senate time came pitched republican senators instance vote reagan appointee george bush appointee extreme far right obviously bork robert borks nomination supreme court 1987 big fight covered lot people remember day obviously conservatives book refer robert borks nomination fight clarence thomas 1991 bloody shirts conservatives day like wave theres supreme court nomination suggest democrats liable republicans making battles judicial nominees way amounts character assassination evolved parallel track increased radicalization republican party itselfp pstronggeoff kabaservicestrong skipping ahead bit crossed paths think early 2015 fellow shorenstein center media politics public policy harvards kennedy school fellowship come aboutp pstrongjackie calmesstrong fell lap luckily time emnew york timesem white house reporter career id busy job raising kids think taking things applying seminars fellowships got day head program shorenstein center asking like fellow said sure checked bureau chief emnew york timesem supportive meant hadnt applied didnt research topic propose working semester pretty quickly talked couple colleagues pretty quickly came idea gnawing long time summarize area study researched point expansion conservative media internet age corrosive impact republican partyp pand earliest research order republican party come books read emrule ruinem look emrule ruinem emrule ruinem emthe downfall moderation destruction republican party eisenhower tea partyem consulted addition central thinking getting started nicole hemmer political scientist working doctorate studying continues study impact conservative mediap pand interested wasnt actually didnt consider particularly novel idea having watched gingrich era george w bushs presidency tea party time 1996 seen growth fox news influential websites forming far right like breitbartcomp pnot impact having republicans congress fielding complaints years republican leadership staffers members corrosive impact having members control members anymore members going fox going breitbart backandforth empowered members channel media sort chickenandtheegg calling shots conservative media trying clicks viewers putting rightwing stuff extreme stuff reflecting grassroots wanted case crosspollination coming impact happening hill increasing polarization good opportunity stop look thatp pstronggeoff kabaservicestrong paper called dont damn governing conservative medias influence republican party anticipate lot themes niki hemmers book hrefhttpswwwamazoncomdpb01kjcu648refdpkindleredirect_encodingutf8btkr1emmessengers rightema particularly like quote tom latham guess retired republican member house gave paper quote talking conservative media ignored need deliberation compromise founders built legislative process told 80 percent got 100 percent youre pure dont damn governingp pstrongjackie calmesstrong yeah interesting thing tom latham point retiring congressman iowa member gingrich revolutionary republican class 1994 elected 1994 began time arrived congress january 95 conservative members time left completely disillusioned worried partyp pand worse discouraged looked compromise agree essential art politics looked penalized seen 2015 number examples prominent undeniably conservative republicans challenged defeated republican primary elections conventions committed mortal sin compromising democratp pi mean best example pops mind chill republicans congress 2010 tea party year robert bennett conservative senator utah defeated renomination convention utah republican party chiefly specifically compromised come compromise healthcare plan democrat ron wyden oregon idea respected conservative conservative simply compromised democrat memorable im talking today scare republicans compromising anymore impact extent compromise fourletter word destructivep pstronggeoff kabaservicestrong paper didnt predict triumph donald trumpp pstrongjackie calmesstrong nop pstronggeoff kabaservicestrong notice trump relatively republican presidential candidates 2015 repeatedly appear second thirdtier radio shows like steve deace iowa favorable response audiencep pstrongjackie calmesstrong yeah speaking audience people liked saying thought saying way especially talking mean audiences predominantly white male great appeal steve deace conservative whos conservative broadcaster iowa takes influence fact work state vote presidential nominating contests came like trump especially turned 2015 later id written paper trump famously said didnt like senator john mccain didnt like people military got captured deace turned deace pretty trumpy follow twitter indicative rest republican party fact trump partyp pstronggeoff kabaservicestrong thousand reasons come trumps success republican presidential primaries 2016 general election hindsight big reasonsp pstrongjackie calmesstrong rise trump think trump ultimate opportunist saw republican party base mean played issues actually fairness talking late 80s xenophobic message immigrants went forth sort like republican party point military didnt like military adventurism wasnt isolationist day insists wasnt favor iraq invasion actually wasp pbut base having 14 seasons apprentice knew play media use media mass audience dont want lowestcommondenominator wasnt exactly highbrow television apprentice adept media like spoke language shameless time new york tabloids 80s shocked everyonep phe field 2015 2016 2016 nomination fight included stars republican party led jeb bush senator marco rubio ted cruz mix course scott walker governor wisconsin mean republican party talked predicting trump emerge winner people didnt seriously including journalism people bteam reporters trump short time come polls remember voting started virtually march 2016 nominee apparentp pbut took base radicalized newt tea party era spoke language shameless unlike members leadership party throwing red meat base years knowing wouldnt elected couldnt like balancing budget knew terrible politics general elections like defunding planned parenthood repealing obamacare base disillusioned broken promises stoked conservative media constantly complaining republican establishment point trump able waltz antiestablishment candidate win nominationp pstronggeoff kabaservicestrong agree return sentences book said trump political aberration rise logical result partys rightward trajectory know 2015 2016 far orthodox conservative candidate fact unorthodox conservativep pstrongjackie calmesstrong rightp pstronggeoff kabaservicestrong contradiction therep pstrongjackie calmesstrong dont think base extent time came base sort like tail wagging dog base effectively calling shots leadership party reacting base conservatism think policy ideas longer important old ideas united party werent trade free trade immigration somewhat liberal dont mean open borders immigration considered good thing balanced budgets low spending trump opposed basep pin tea party instance people protesting congress saying hands medicare base rejected paul ryan kind ideas entitlement reform trump logical extension im thinking terms leadership party gingrich postgingrich created militant base eschewed compromise conservative media mean think tend underestimate impact conservative media cant think word relationship sort like chickenandegg audience influencing audience broadcasters case mutual radicalization thats trump logical extension fact party [radical]p pi talk revolutions trump fourth reagan gingrich revolution predicate trump bottomup previous political movement usually leader associated tea party leader amorphous base writ large created radicalized combination postnewt gingrich politics conservative media trump extension took headless movement harnessed leader itp pstronggeoff kabaservicestrong hindsight trumps durable legacies sure seen appointment conservative supreme court justices neil gorsuch brett kavanaugh amy coney barrettp pstrongjackie calmesstrong yesp pstronggeoff kabaservicestrong nomination process extremely controversial gorsuchs case senate majority leader mitch mcconnell failed allow vote confirm president obamas nominee merrick garland allegedly vacancy occurred 2016 election year barretts case nomination controversial senate controlled republicans confirmed days 2020 election controversies surrounding kavanaugh course different register altogether appointment judges describe brings fruition fortyyear conservative movement plan conservative majority court goal tangential best trumps populist vision extent come idea writing book brett kavanaugh representative figure republican partys rightward transformationp pstrongjackie calmesstrong things fell lap guess smart fiveyear plans talking agent editor publishing houses early 2017 trumps election left emnew york timesem wanted indepth journalism including writing book talking agent editor trying come book concept allow tell story years witnessed coming years evolution republican party point calling evolution transformation thought radicalization bridge far quickly dispensed thinking radicalization rightp pbut case press got job white house editor busy think book came 2018 brett kavanaugh confirmed wanted book controversial confirmation brett kavanaugh didnt particularly want write book countered suggesting point knew little bit thought perfect people petri dish republican represented perfect specimen takes succeed republican party days blend politics conservative policies recordp pbut couple senators called forrest gump zeliglike figure uncannily scene biggest moments republican partys evolution came write book kavanaugh story birth beltway washington dc republican lobbyist father mother changed parties democrat republican era people juxtapose story happening broadly republican party political arena evolution federalist society conservative organs create de facto system identifying vetting considered true conservatives judiciary district appeals court supreme court successful founders dreamsp pso thats think worked pretty mean summarize kavanaugh zelig zeliglike figure like born beltway went yale founding camp yale law school joined federalist society couple years formed quickly saw good point reference resum wanted republican circles worked ken starr solicitor general george h w bush rightp pstronggeoff kabaservicestrong yesp pstrongjackie calmesstrong end reagan think george h w bush clerked conservative judges federal bench ultimately anthony kennedy wasnt conservative republican appointee supreme court kavanaugh went ken starr years worked ken starr investigation bill hillary clinton think era like people partisan country divided political lines briefly private practice worked considered pro bono politically charged cases popular conservative communityp pand embush v goreem like lot republican lawyers role secured job west wing george bushs white house george w bushs white house immediately seen hed marked federal bench proven conservative loyal republican rest historyp pthe thing nominated dc circuit court appeals representative point asked earlier judicial fights george w bush era judicial confirmations battles lot appeals court nominations took years george w bush predicted republican president brett kavanaugh supreme court justice trump didp pstronggeoff kabaservicestrong interestingly point kavanaughs associations bushes counted trump era trumps populist advisorsp pstrongjackie calmesstrong yes trump come lists reassure evangelical voters conservative voters generally conservatives court courts levels list twice elected actual people brett kavanaughs anybody asked conservative legal community wouldve named brett kavanaugh prospective supreme court candidates didnt trumps list trump president year presidency nearly year trump came list lot thisp ptrump suggest wanted smacked bush era dismissive george w bush represented barack obama think thing overcame large trumps white house counsel don mcgahn knew kavanaugh liked fact kavanaugh like neil gorsuch somebody casts real skeptical eye opposes federal regulation business environment administrative state keen think don mcgahn brett kavanaugh trump nomineep pstronggeoff kabaservicestrong curiously endear kavanaugh trump supporters lashing left confirmation hearingsp pstrongjackie calmesstrong yesp pstronggeoff kabaservicestrong provide detailed sensitive nuanced discussion hearings accusations brought kavanaugh psychologist christine blasey ford underreported stories sexual incidents hed involved undergraduate yalep pstrongjackie calmesstrong yeah think mean lot people trump gotten fill scalia seat went neil gorsuch ruth bader ginsburg seat went amy coney barrett think seat trump obviously rights president filled anthony kennedys retirement theres lot conservatives filled seat brett kavanaughp pi think know christine blasey ford case republicans majority senate right able railroad allegation debbie ramirez classmate yale suggested acknowledged drunk exposed friends essentially forced handle penisp pshe got hearing christine blasey ford met debbie talked length multiple times think wouldve credible witness christine blasey ford dont word mean trump christine blasey ford testified publicly said credible compelling course subsequently called liar disturbing way able railroad allowed fbi investigation wouldve lost republican votes didnt investigation investigation sham investigation bookp pthere brett kavanaughs classmates wanted testify didnt sexual assault allegations fact felt people friends friendly acquaintances said saw fox news testimony senate lied extent drinking lied denied blacked drinking couldnt remember central defense blacked couldnt remember wouldve possible believe sexually assaulted terribly drunk didnt remember undercut denialsp pbut addition allegation yale woman reported came says remember ive talked friends drunk didnt remember eyewitness credible eyewitness wanted talk fbi senate record thinking told seen allegations senators white house tell trump nominate allowed talk fbi day contacted allowed talk senators privately kavanaughs confirmation rushed throughp pbut book ive written set aside sexual assault allegations like think things determined think lies brett kavanaugh told oath collegeage drinking things asked incidents occurred white house aide george w bush having senate scandal democrat stolen emails judicial nominees brett kavanaugh worked policy areas instance having handling foreign detainees bush administration called war terror things undercut credibility hesaidshesaid fightp pto argument compelling allegations cant answered record suggests strongly best misled senators oath worst lied add consider frankly late justice john paul stevens considered disqualifying tirade september 27th 2018 testified christine blasey ford senate judiciary committee angry partisan confrontational manner completely opposite consider reflecting judicial temperament think rights nomination withdrawn conservative placep pstronggeoff kabaservicestrong year kavanaugh college remember beer hand look aggrieved opossum face suppose guess question think democrats handled nomination way wouldve led outcome nomination simply product polarized dynamic congressp pstrongjackie calmesstrong dont think mean certainly things democrats better mean allegation eyewitness way force senate inner circle way maybe wouldve kept public senators wouldve known frankly dont think theres democrats going overcome thensenate majority leader mitch mcconnells determination ram nomination combined critical kavanaughs success continued support donald trump mean watched donald trump years kicked kavanaugh curb named somebody list didnt perversely think nature allegations trumpp ptrump wellknown record long hes added coming allegations lodged man sexual nature gets juices going came defense kind fight going defend brett kavanaugh brett kavanaughs angry performance senate judiciary committee like things republicans trump erait audience onep pit pleased trump known happy brett kavanaughs appearance fox news wife earlier thought kavanaugh whimpering puppy wanted attack don mcgahn coached kavanaugh effect im kavanaugh politically savvy dont think people suggested forget think republicans suggested didnt need don mcgahn tell come guns blazing senate judiciary committee knew thats trump wanted trump embraced trump nominated trump sure got confirmed mitch mcconnell course equally responsiblep pstronggeoff kabaservicestrong hrefhttpswwwnytimescom20211031uspoliticskavanaughtexasabortionlawhtmlarticlea days ago emnew york timesem talking kavanaugh come wield enormous power justice courts ideological center course confused making moderate hes moderatep pstrongjackie calmesstrong nop pstronggeoff kabaservicestrong hes come right number issues voted think 91 percent time divided decisions john roberts chief justice share roberts concerns protecting institutional authority courtp pstrongjackie calmesstrong yeahp pstronggeoff kabaservicestrong sort 64 question washington think kavanaugh likely vote contentious issues coming particularly abortionp pstrongjackie calmesstrong abortion specifically mean ultimately think court going find way conservatives court sixjustice supermajority greatly undercut effectively away abortion rights texas effectively away abortion rights havent come right banned altogether theyll find way cases texas mississippi producing headline says court overturns emroe v wadeemp pand think kavanaugh dc court appeals thats court considered secondmost prestigious based washington mainly handles known handling cases having issues federal government party didnt lot abortion cases end twelveyear tenure people auditioning supreme court nomination coming strongly antiabortion way case came courtp pso doubt deciding abortion think partly suggest chief justice cognizant courts public standing institutional standing want flatout overturn roe think case reflects political savvy guy working ken starr years bush term center biggest political fights day think knows good republican party outright overturning emroe v wadeem support goes right pointp pthe major case term course going gun rights signaled judicial career court appeals short time supreme court expanding gun rights expanding individual right bear arms carved supreme court 2008 hrefhttpswwwoyezorgcases200707290hellera casep pand fact vocal terms judicial writings dissent bemoaning fact court accepted gun case decade decade emhellerem hrefhttpswwwoyezorgcases2009081521mcdonalda eager court case think definitely favor expanding gun rightsp pstronggeoff kabaservicestrong number reasons republicans focused courts appointing conservative justices democrats interested priority judicial appointments recent decades like fair statementp pstrongjackie calmesstrong oh absolutely cause small concern lot democratic activists frankly ive wondered years mean going early 90s famous case upheld emroe v wadeem limited bit hrefhttpswwwoyezorgcases199191744planned parenthood v caseya case pennsylvania 1993 considered big abortion cases roe emplanned parenthood v caseyemp pand long seen abortion rights danger precedents overruled democrats democratic voters care courts think makes sense earl warren era 60s greatly expanded civil rights like criminal rights know complacency left centerleft right mobilized cases going 60s having prayer schools emroe v wadeem religious rights reason forp pand brought evangelicals republican party true business wing republican party wanted fight lot environmental regulations business regulations incentive right centerright court issuep pthat started change embush v goreem democrats sat thought holy cow 54 conservative majority essentially pick president saw beginnings efforts form analogue federalist society didnt work democrats dont incentive right work courts beginning change changed joe bidens judicial nominations sort people hes nominating courts imbalance great imbalancep pstronggeoff kabaservicestrong gets sense example republican administration situation reversed wouldve strongly encouraged like ruth bader ginsburg retire die office opposing party chance appointp pstrongjackie calmesstrong yesp pstronggeoff kabaservicestrong justice liking doesnt democrats playing politics recent yearsp pstrongjackie calmesstrong right stephen breyer continues resist pressure hes said ruth bader ginsburg mean barack obama went extent having lunch making clear dont know explicit clear point talk essentially loved job wanted stay therep pand stephen breyer feels way sort operated ruth bader ginsburgs senior shadow years hes finally senior democratic appointee theyre minority democratic appointees gets decide writes opinion gets dibs hes finally term time position doesnt doesnt want upp pthat said hes worked staffer ted kennedy senate judiciary committee seen mitch mcconnell politicize judicial confirmation process extent giving trump instead supreme court seats fill think sort step aside mean hes eighties step aside let biden younger replacementp pbut club disagree things protective instead described think lot people think written book virtually book tour denies sort political bent supreme court whichp pall read opinions sam alito things fact amy coney barrett despite showing shes far right maybe people thought nonetheless gives speech mitch mcconnell center mitch mcconnell insist court isnt partisan like clearly supreme court justice press advisor stupid thing pointp pstronggeoff kabaservicestrong youve mentioned mitch mcconnell nowp pstrongjackie calmesstrong timesp pstronggeoff kabaservicestrong interesting book ends throwing spotlight mcconnell award consequential malignant figure american politics past decadesp pstrongjackie calmesstrong yeah thats perceptive bring thought thought book essentially kavanaugh reflects party large im ending individualp pbut thought appropriate think hes consequential cant away mitch mcconnells effectiveness god knows im journalists thinks effectiveness beall endall think end justifies means tell conservative government think undermined institution senate institution supreme court branches government bad think consequencesp pand actually covering congress year arrived january 1985 elected senate kentucky struck term guy like gingrich instance didnt want legislator wasnt interested legislating interested blocking legislation working expand things help party things like expanded campaign finance things senate clearly wanted leadership ladderp pso differed gingrich mcconnells inside game working inside senate gingrich wanted sort outsize outside figure running house leader conservative movement mcconnell obviously longlived effective gingrich think hes huge impact good onep pand add think mcconnell ultimate john mccain party country wont tick examples aside weve talked terms bending norms rules gorsuch gorsuch kavanaugh amy coney barrett court despite clear hypocrisy evidences sop pbut things years watched wonder ultimately said right things donald trump attempted coup extent donald trump weakened democracy hes turned said absolutely support nominee party 2024 way enabled donald trumpp pso think continue happens trumpism mitch mcconnell remain think overlooked gets lot attention think people overlook consequential beenp pstronggeoff kabaservicestrong jackie congratulations book emdissent radicalization republican party capture courtem thanks joining todayp pstrongjackie calmesstrong thank youp pstronggeoff kabaservicestrong thank listening vital center podcast subscribe rate preferred podcasting platform questions comments responses include rating send email contactniskanencenterorg thanks technical director kristie eshelman sound engineer ray ingegneri niskanen center washington dcp pphoto credit relnoreferrer noopener hrefhttpswwwistockphotocomphotouscapitol16gm1028327804275663831clarityfalse target_blankistockap pthe post relnofollow hrefhttpswwwniskanencenterorgtheinfluenceofgingrichthetriumphoftrumpthelegacyofconservativecourtappointmentswithjackiecalmesthe influence gingrich triumph trump legacy conservative court appointments jackie calmesa appeared relnofollow hrefhttpswwwniskanencenterorgniskanen centerap |
618c48b4e619af73ac7369fd | Economics is not very socioeconomically diverse model this | blockquote datawidth500 classtwittertweet datadnttrue
p langen dirltrkey stylized fact p
pamongst usborn phds economics is less socioeconomically diverse than all the major phd fields including math computer science physical and biological sciences and other social sciencesp
p3n a hrefhttpstcoywvvgqn1rkpictwittercomywvvgqn1rkap
p anna stansbury annastansbury a hrefhttpstwittercomannastansburystatus1458209180356055046ref_srctwsrc5etfwnovember 9 2021apblockquote
pp
pthe post a relnofollow hrefhttpmarginalrevolutioncommarginalrevolution202111economicsisnotverysocioeconomicallydiversehtmleconomics is not very socioeconomically diverse model thisa appeared first on a relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap | blockquote datawidth500 classtwittertweet datadnttrue p langen dirltrkey stylized fact p pamongst usborn phds economics socioeconomically diverse major phd fields including math computer science physical biological sciences social sciencesp p3n hrefhttpstcoywvvgqn1rkpictwittercomywvvgqn1rkap p anna stansbury annastansbury hrefhttpstwittercomannastansburystatus1458209180356055046ref_srctwsrc5etfwnovember 9 2021apblockquote pp pthe post relnofollow hrefhttpmarginalrevolutioncommarginalrevolution202111economicsisnotverysocioeconomicallydiversehtmleconomics socioeconomically diverse model thisa appeared relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap |
618c48c0e619af73ac7369ff | 2.7 Degrees Warming is Madness – Greta Thunberg | a relnofollow hrefhttpstheanalysisnews27degreeswarmingismadnessgretathunberg title27 degrees warming is madness greta thunbergimg sizesmaxwidth 1024px 100vw 1024px srchttpstheanalysisnewswpcontentuploads202111img_2628a1024x576jpg width1024 alt srcsethttpstheanalysisnewswpcontentuploads202111img_2628a1024x576jpg 1024w httpstheanalysisnewswpcontentuploads202111img_2628a300x169jpg 300w httpstheanalysisnewswpcontentuploads202111img_2628a768x432jpg 768w httpstheanalysisnewswpcontentuploads202111img_2628a1536x864jpg 1536w httpstheanalysisnewswpcontentuploads202111img_2628ajpg 1920w classwebfeedsfeaturedvisual wppostimage height576aparve error src mismatch url httpswwwyoutubecomwatchvkkts0j6r6w src in httpswwwyoutubecomembedkkts0j6r6wfeatureoembedampenablejsapi1amporiginhttpstheanalysisnews src gen httpswwwyoutubecomembedkkts0j6r6wactual comparison url httpswwwyoutubecomwatchvkkts0j6r6w src in httpswwwyoutubecomembedkkts0j6r6wenablejsapi1amporiginhttps3a2f2ftheanalysisp
pa relnofollow hrefhttpstheanalysisnews27degreeswarmingismadnessgretathunbergsourceap | relnofollow hrefhttpstheanalysisnews27degreeswarmingismadnessgretathunberg title27 degrees warming madness greta thunbergimg sizesmaxwidth 1024px 100vw 1024px srchttpstheanalysisnewswpcontentuploads202111img_2628a1024x576jpg width1024 alt srcsethttpstheanalysisnewswpcontentuploads202111img_2628a1024x576jpg 1024w httpstheanalysisnewswpcontentuploads202111img_2628a300x169jpg 300w httpstheanalysisnewswpcontentuploads202111img_2628a768x432jpg 768w httpstheanalysisnewswpcontentuploads202111img_2628a1536x864jpg 1536w httpstheanalysisnewswpcontentuploads202111img_2628ajpg 1920w classwebfeedsfeaturedvisual wppostimage height576aparve error src mismatch url httpswwwyoutubecomwatchvkkts0j6r6w src httpswwwyoutubecomembedkkts0j6r6wfeatureoembedampenablejsapi1amporiginhttpstheanalysisnews src gen httpswwwyoutubecomembedkkts0j6r6wactual comparison url httpswwwyoutubecomwatchvkkts0j6r6w src httpswwwyoutubecomembedkkts0j6r6wenablejsapi1amporiginhttps3a2f2ftheanalysisp pa relnofollow hrefhttpstheanalysisnews27degreeswarmingismadnessgretathunbergsourceap |
618c48d5e619af73ac736a01 | Why White Voters With Racist Views Often Still Support Black Republicans | p dataparagraphmaincan white voters who back a black candidate still hold racist beliefs and viewsp
p dataparagraphmainthat question has come to the fore in the wake of glenn youngkins a relnoopener hrefhttpsfivethirtyeightcomfeatureshowrepublicanswonthevirginiagovernorsrace target_blankgubernatorial victory in the blueish state of virginiaa conservatives were quick to a relnoopener hrefhttpswwwnationalreviewcom202111progressivescryracismtoexcusedemocraticlossesinvirginia target_blankcounter claimsa that youngkins win a relnoopener hrefhttpswwwtheguardiancomusnews2021nov03republicanscriticalracetheorywinningelectoralissue target_blankrepresented the effectiveness of stoking racial fearsa with results from virginias downballot election for lieutenant governor a contest where the republican candidate winsome sears made history by becoming the first black woman elected to statewide office in virginia the wall street journals a relnoopener hrefhttpswwwwsjcomarticlesvirginiagovernorelectionglennyoungkinrace11635979212 target_blankeditorial boarda for example emphatically mocked the notion that voters called white supremacists elected a black lt gov conservative commentators on a relnoopener hrefhttpswwwfoxnewscommediathefivemediaglennyoungkinwinsomesearsvirginiacriticalracetheory target_blankfox news and twittera including a relnoopener hrefhttpswwwfoxnewscommediajemelehillroastedfortweetallegingthiscountrysimplyloveswhitesupremacy target_blanksears herselfa also used the historic victory as an ostensible shield against accusations of republican racismp
p dataparagraphmainbut supporting a black candidate hardly precludes voters from harboring racist beliefs and motivations republicans are a relnoopener hrefhttpspressprincetonedubookspaperback9780691196435identitycrisis target_blankincreasingly more likely than democratsa to hold prejudiced views of minorities so black republicans like sears often draw especially strong support from white americans with otherwise antiblack views simply because they draw most of their support from republican votersp
p dataparagraphmaina clear example of this was in the 2016 republican presidential primary when ben carson made a bid to become the gops first african american presidential nominee support for carson was positively correlated with the belief that black americans have too much influence on us politics according to data from a relnoopener hrefhttpswcwustledutapsdataarchive target_blankwashington university in st louiss american panel survey tapsa in late 2015p
figure classwpblockimageimg datasrchttpsfivethirtyeightcomwpcontentuploads202111jeffersonteslerblackcandidates111011png srchttpsfivethirtyeightcomwpcontentuploads202111jeffersonteslerblackcandidates111011png width1150 alt datasrcsethttpsfivethirtyeightcomwpcontentuploads202111jeffersonteslerblackcandidates111011pngw700 1x httpsfivethirtyeightcomwpcontentuploads202111jeffersonteslerblackcandidates111011pngw1400 2x srcsethttpsfivethirtyeightcomwpcontentuploads202111jeffersonteslerblackcandidates111011pngw700 1x httpsfivethirtyeightcomwpcontentuploads202111jeffersonteslerblackcandidates111011pngw1400 2x classwpimage320567 height1194figurep dataparagraphmainwhites who thought african americans had far too little influence disliked carson and preferred hillary clinton by 60 percentage points in a hypothetical general election matchup meanwhile carson was very popular among whites who were most concerned about african americans having too much influence in politics so much so that whites who thought african americans have far too much influence preferred carson to clinton by 45 points p
p dataparagraphmainagain much of that relationship is down to partisanship republicans are more likely to hold prejudiced views and also more likely to support a republican candidate but thats the point for many white gop voters antiblack views dont seem to get in the way of supporting a black republicanp
p dataparagraphmainyou can see a similar pattern in the january a relnoopener hrefhttpselectionstudiesorgdatacenteranes2016pilotstudy target_blank2016 american national election studies pilot studya carson received more favorable evaluations among the sizable minority 40 percent of overtly prejudiced whites who agreed with the racist stereotype that most african americans are more violent than most whites this group rated carson significantly more favorably on a 0100 scale than the white moderate republican presidential candidate jeb bush 52 to 39 respectively thencandidate donald trump was the only politician in the survey who was rated higher than carson among overtly prejudiced whitesa datafootnotecontentltpgtltpgtthe politicians evaluated in the 2016 anes pilot study were barack obama hillary clinton bernie sanders marco rubio ted cruz carly fiorina donald trump jeb bush and ben carsonltpgt
ltpgt hrefhttpsfivethirtyeightcomfeatureswhyracistwhitevotersoftenfavorblackrepublicansfn1 datafootnoteid1sup1supa p
figure classwpblockimageimg datasrchttpsfivethirtyeightcomwpcontentuploads202111jeffersonteslerblackcandidates111021png srchttpsfivethirtyeightcomwpcontentuploads202111jeffersonteslerblackcandidates111021png width1150 alt datasrcsethttpsfivethirtyeightcomwpcontentuploads202111jeffersonteslerblackcandidates111021pngw700 1x httpsfivethirtyeightcomwpcontentuploads202111jeffersonteslerblackcandidates111021pngw1400 2x srcsethttpsfivethirtyeightcomwpcontentuploads202111jeffersonteslerblackcandidates111021pngw700 1x httpsfivethirtyeightcomwpcontentuploads202111jeffersonteslerblackcandidates111021pngw1400 2x classwpimage320568 height1002figurep dataparagraphmainthe contrast between how prejudiced whites rated carson and obama is rather revealing as well the sharp negative relationship between support for obama and the endorsement of antiblack stereotypes is consistent with a relnoopener hrefhttpsyalebooksyaleedubook9780300175196endrace target_blankseverala a relnoopener hrefhttpspressuchicagoeduucpbooksbookchicagoobo10443910html target_blankstudiesa a relnoopener hrefhttpswwwjournalsuchicagoedudoiabs101017s0022381612000904 target_blankshowinga a relnoopener hrefhttpsonlinelibrarywileycomdoiabs101111j15405907201100564x target_blankthata a relnoopener hrefhttpslinkspringercomarticle101007s111090109108y target_blankprejudicea was an a relnoopener hrefhttpswwwjstororgstable41319767 target_blankunusually stronga a relnoopener hrefhttpswwwsciencedirectcomsciencearticleabspiis0047272714000929 target_blankpredictora of opposition to obama from the 2008 election a relnoopener hrefhttpswwwamazoncompostracialmostracialpoliticschicagoamericandp022635301x target_blankthrough the end of his presidencya these patterns also fit well with a relnoopener hrefhttpswwwjstororgstable2749510 target_blankothera a relnoopener hrefhttpswwwcambridgeorgcorebookschangingwhiteattitudestowardblackpoliticalleadershipd118208ec01bdf5b0ff0a99c92d3ba2e target_blankpolitical sciencea a relnoopener hrefhttpwwwstanfordlawrevieworgwpcontentuploadssites32016068__ansolabehere__68_stan_l_revpdf target_blankresearcha showing that racially prejudiced whites tend to be more opposed to black democrats than to white democrats p
p dataparagraphmainto make sense of why racially prejudiced white americans are willing to support some black candidates it is worth considering why they so strongly oppose black democrats in the first place given the a relnoopener hrefhttpspressprincetonedubookspaperback9780691153889racialrealignment target_blankracialized nature of the twoparty systema in the united states most black political candidates are democrats who embrace liberal positions on issues of race and justice when asked whether they would support such a candidate a relnoopener hrefhttpsglobaloupcomacademicproductvotinghopesorfears9780195101621ccuslangen target_blankresearch showsa that racially prejudiced white voters worry that these candidates will represent the interests of black americans both because of a shared african american identity and because democrats are a relnoopener hrefhttpspressprincetonedubookspaperback9780691196435identitycrisis target_blankperceived as the party more supportive of black interestsa so it makes sense that racially resentful white americans oppose candidates like obama as his racial identity emandem partisanship signaled to voters that he was a relnoopener hrefhttpswwwamazoncompostracialmostracialpoliticschicagoamericandp022635301x target_blankmore supportive of black interestsa than prior presidents p
p dataparagraphmainput another way racially prejudiced white voters are not opposed to black candidates simply because they are black but because they believe that most black candidates will fight for those people and not people like usp
p dataparagraphmainblack republicans on the other hand are a relnoopener hrefhttpsacademicoupcompoqarticle7021391912448 target_blankperceived differentlya by racially prejudiced white americans their embrace of the republican party and its conservative ideology help assure racially prejudiced whites that unlike black democrats they are not in the business of carrying water for their own racial group instead they are viewed as distinct from other black elites if blackness is viewed as intertwined with a kind of racial liberalism that is antagonistic to the interests of white americans black republicans partisan and ideological commitments allay concerns that they are for them not usp
p dataparagraphmainthis argument is buttressed by more a relnoopener hrefhttpswwwjournalsuchicagoedudoiabs101086708952journalcodejop target_blankrecent scholarshipa in political science which has found that black candidates who embrace a bootstrap ideology an ideology that focuses on individual versus structural explanations of inequality are more positively evaluated by racially prejudiced whites relative to their white competitors explaining this finding the authors note that racially prejudiced white voters might find black republicans delivering an individualism message more favorable than they might find other candidates delivering a similar message precisely because the aesthetic character and the partisan affiliation of the messenger contradict racial and political expectations lafleur stephensdougan a professor of political science at princeton university similarly shows in her book a relnoopener hrefhttpspressuchicagoeduucpbooksbookchicagorbo50271574html target_blankrace to the bottoma that racially resentful whites respond well to black candidates who take stances against the expected positions of their racial group a phenomenon she calls a relnoopener hrefhttpsnewsharvardedugazettestory202011howpoliticianspracticeracialdistancing target_blankracial distancingap
p dataparagraphmainfinally voting for black republicans may also be especially appealing to racially prejudiced whites because it a relnoopener hrefhttpsfivethirtyeightcomfeatureshowthepoliticsofwhiteliberalsandwhiteconservativesareshapedbywhiteness target_blankassuages concerns of being seen as racista by enabling them to say in essence i cant be racist i voted for a black candidate psychologists call this a relnoopener hrefhttpsjournalssagepubcomdoipdf1011770146167210385920casa_tokenzys_nqsq6uuaaaaacytnozxmv1baxuxxgofltzudzbambqdoq45nk4do8o1rr3iuzetnjebltdk5si9ztd7x9jyxzfksjg target_blankmoral credentialinga and theres even a relnoopener hrefhttpsnewsstanfordedunews2009march4obamamoralcredentialsfavorwhites030409html target_blanksome evidencea that voters who expressed support for obama shortly after the 2008 election felt more justified in favoring white americans over black americans electing a black republican like sears who a relnoopener hrefhttpswwwfoxnewscommediavirginiarepublicanwinsomesearscriticalracetheorynonsense target_blankrailed against critical race theorya during the runup to the election and a relnoopener hrefhttpstwittercomwinsomesearsstatus1372941065007816705langen target_blanksupports voting restrictionsa that a relnoopener hrefhttpswwwbrennancenterorgourworkresearchreportsnewvotersuppression target_blankadversely affect racial minoritiesa is similarly used as a symbolic shield by the entire party from inevitable charges of championing racist policies as we mentioned earlier conservative media outlets and politicians are already weaponizing her victory against anyone who would dare suggest so p
p dataparagraphmainbut of course the role race and racism play in american politics is much more nuanced than those simplistic defenses suggest when racially prejudiced whites oppose black candidates its not just because of the candidates skin color its also because they perceive a relnoopener hrefhttpswwwjstororgstablepdf3791741pdfcasa_tokenuykoesmyykcaaaaadynnvbpircuvw4lxifninvlzmidnoyoxqtynx6pa_gczcm6mtgtsku5yefrykwwdm1lcw0wce0zpc6v1hvbavigo5du16ggvf0tcyzevra9wrrw_c target_blanksometimes wronglya that black candidates especially black democrats have ideological commitments that are at odds with the interests of white americans likewise when racially prejudiced whites support black republicans its hardly the case that theyve become progressive on race racially prejudiced whites did not vote for sears because they appreciated her attachment and commitment to black people they were willing to support her because they discounted it p
p dataparagraphmainrace after all is a social construct it has meaning because we imbue it with meaning racially prejudiced whites are not hostile to blackness per se they are hostile to a particular manifestation of blackness one that reflects a commitment to racial justice and the advancement of the groups collective goals racially prejudiced whites are not bothered much by a manifestation of blackness that is ideologically consistent with their own identities and attitudes why would they be searss conservative politics dont threaten the racial hierarchy and her candidacy provides cover for a party thats often antagonistic to racial minorities for racially prejudiced whites the real question is what is there emnotem to love about black politicians like sears p | p dataparagraphmaincan white voters black candidate hold racist beliefs viewsp p dataparagraphmainthat question come fore wake glenn youngkins relnoopener hrefhttpsfivethirtyeightcomfeatureshowrepublicanswonthevirginiagovernorsrace target_blankgubernatorial victory blueish state virginiaa conservatives quick relnoopener hrefhttpswwwnationalreviewcom202111progressivescryracismtoexcusedemocraticlossesinvirginia target_blankcounter claimsa youngkins win relnoopener hrefhttpswwwtheguardiancomusnews2021nov03republicanscriticalracetheorywinningelectoralissue target_blankrepresented effectiveness stoking racial fearsa results virginias downballot election lieutenant governor contest republican candidate winsome sears history black woman elected statewide office virginia wall street journals relnoopener hrefhttpswwwwsjcomarticlesvirginiagovernorelectionglennyoungkinrace11635979212 target_blankeditorial boarda example emphatically mocked notion voters called white supremacists elected black lt gov conservative commentators relnoopener hrefhttpswwwfoxnewscommediathefivemediaglennyoungkinwinsomesearsvirginiacriticalracetheory target_blankfox news twittera including relnoopener hrefhttpswwwfoxnewscommediajemelehillroastedfortweetallegingthiscountrysimplyloveswhitesupremacy target_blanksears herselfa historic victory ostensible shield accusations republican racismp p dataparagraphmainbut supporting black candidate hardly precludes voters harboring racist beliefs motivations republicans relnoopener hrefhttpspressprincetonedubookspaperback9780691196435identitycrisis target_blankincreasingly likely democratsa hold prejudiced views minorities black republicans like sears draw especially strong support white americans antiblack views simply draw support republican votersp p dataparagraphmaina clear example 2016 republican presidential primary ben carson bid gops african american presidential nominee support carson positively correlated belief black americans influence politics according data relnoopener hrefhttpswcwustledutapsdataarchive target_blankwashington university st louiss american panel survey tapsa late 2015p figure classwpblockimageimg datasrchttpsfivethirtyeightcomwpcontentuploads202111jeffersonteslerblackcandidates111011png srchttpsfivethirtyeightcomwpcontentuploads202111jeffersonteslerblackcandidates111011png width1150 alt datasrcsethttpsfivethirtyeightcomwpcontentuploads202111jeffersonteslerblackcandidates111011pngw700 1x httpsfivethirtyeightcomwpcontentuploads202111jeffersonteslerblackcandidates111011pngw1400 2x srcsethttpsfivethirtyeightcomwpcontentuploads202111jeffersonteslerblackcandidates111011pngw700 1x httpsfivethirtyeightcomwpcontentuploads202111jeffersonteslerblackcandidates111011pngw1400 2x classwpimage320567 height1194figurep dataparagraphmainwhites thought african americans far little influence disliked carson preferred hillary clinton 60 percentage points hypothetical general election matchup carson popular whites concerned african americans having influence politics whites thought african americans far influence preferred carson clinton 45 pointsp p dataparagraphmainagain relationship partisanship republicans likely hold prejudiced views likely support republican candidate thats point white gop voters antiblack views dont way supporting black republicanp p dataparagraphmainyou similar pattern january relnoopener hrefhttpselectionstudiesorgdatacenteranes2016pilotstudy target_blank2016 american national election studies pilot studya carson received favorable evaluations sizable minority 40 percent overtly prejudiced whites agreed racist stereotype african americans violent whites group rated carson significantly favorably 0100 scale white moderate republican presidential candidate jeb bush 52 39 respectively thencandidate donald trump politician survey rated higher carson overtly prejudiced whitesa datafootnotecontentltpgtltpgtthe politicians evaluated 2016 anes pilot study barack obama hillary clinton bernie sanders marco rubio ted cruz carly fiorina donald trump jeb bush ben carsonltpgt ltpgt hrefhttpsfivethirtyeightcomfeatureswhyracistwhitevotersoftenfavorblackrepublicansfn1 datafootnoteid1sup1supap figure classwpblockimageimg datasrchttpsfivethirtyeightcomwpcontentuploads202111jeffersonteslerblackcandidates111021png srchttpsfivethirtyeightcomwpcontentuploads202111jeffersonteslerblackcandidates111021png width1150 alt datasrcsethttpsfivethirtyeightcomwpcontentuploads202111jeffersonteslerblackcandidates111021pngw700 1x httpsfivethirtyeightcomwpcontentuploads202111jeffersonteslerblackcandidates111021pngw1400 2x srcsethttpsfivethirtyeightcomwpcontentuploads202111jeffersonteslerblackcandidates111021pngw700 1x httpsfivethirtyeightcomwpcontentuploads202111jeffersonteslerblackcandidates111021pngw1400 2x classwpimage320568 height1002figurep dataparagraphmainthe contrast prejudiced whites rated carson obama revealing sharp negative relationship support obama endorsement antiblack stereotypes consistent relnoopener hrefhttpsyalebooksyaleedubook9780300175196endrace target_blankseverala relnoopener hrefhttpspressuchicagoeduucpbooksbookchicagoobo10443910html target_blankstudiesa relnoopener hrefhttpswwwjournalsuchicagoedudoiabs101017s0022381612000904 target_blankshowinga relnoopener hrefhttpsonlinelibrarywileycomdoiabs101111j15405907201100564x target_blankthata relnoopener hrefhttpslinkspringercomarticle101007s111090109108y target_blankprejudicea relnoopener hrefhttpswwwjstororgstable41319767 target_blankunusually stronga relnoopener hrefhttpswwwsciencedirectcomsciencearticleabspiis0047272714000929 target_blankpredictora opposition obama 2008 election relnoopener hrefhttpswwwamazoncompostracialmostracialpoliticschicagoamericandp022635301x target_blankthrough end presidencya patterns fit relnoopener hrefhttpswwwjstororgstable2749510 target_blankothera relnoopener hrefhttpswwwcambridgeorgcorebookschangingwhiteattitudestowardblackpoliticalleadershipd118208ec01bdf5b0ff0a99c92d3ba2e target_blankpolitical sciencea relnoopener hrefhttpwwwstanfordlawrevieworgwpcontentuploadssites32016068__ansolabehere__68_stan_l_revpdf target_blankresearcha showing racially prejudiced whites tend opposed black democrats white democratsp p dataparagraphmainto sense racially prejudiced white americans willing support black candidates worth considering strongly oppose black democrats place given relnoopener hrefhttpspressprincetonedubookspaperback9780691153889racialrealignment target_blankracialized nature twoparty systema united states black political candidates democrats embrace liberal positions issues race justice asked support candidate relnoopener hrefhttpsglobaloupcomacademicproductvotinghopesorfears9780195101621ccuslangen target_blankresearch showsa racially prejudiced white voters worry candidates represent interests black americans shared african american identity democrats relnoopener hrefhttpspressprincetonedubookspaperback9780691196435identitycrisis target_blankperceived party supportive black interestsa makes sense racially resentful white americans oppose candidates like obama racial identity emandem partisanship signaled voters relnoopener hrefhttpswwwamazoncompostracialmostracialpoliticschicagoamericandp022635301x target_blankmore supportive black interestsa prior presidentsp p dataparagraphmainput way racially prejudiced white voters opposed black candidates simply black believe black candidates fight people people like usp p dataparagraphmainblack republicans hand relnoopener hrefhttpsacademicoupcompoqarticle7021391912448 target_blankperceived differentlya racially prejudiced white americans embrace republican party conservative ideology help assure racially prejudiced whites unlike black democrats business carrying water racial group instead viewed distinct black elites blackness viewed intertwined kind racial liberalism antagonistic interests white americans black republicans partisan ideological commitments allay concerns usp p dataparagraphmainthis argument buttressed relnoopener hrefhttpswwwjournalsuchicagoedudoiabs101086708952journalcodejop target_blankrecent scholarshipa political science found black candidates embrace bootstrap ideology ideology focuses individual versus structural explanations inequality positively evaluated racially prejudiced whites relative white competitors explaining finding authors note racially prejudiced white voters find black republicans delivering individualism message favorable find candidates delivering similar message precisely aesthetic character partisan affiliation messenger contradict racial political expectations lafleur stephensdougan professor political science princeton university similarly shows book relnoopener hrefhttpspressuchicagoeduucpbooksbookchicagorbo50271574html target_blankrace bottoma racially resentful whites respond black candidates stances expected positions racial group phenomenon calls relnoopener hrefhttpsnewsharvardedugazettestory202011howpoliticianspracticeracialdistancing target_blankracial distancingap p dataparagraphmainfinally voting black republicans especially appealing racially prejudiced whites relnoopener hrefhttpsfivethirtyeightcomfeatureshowthepoliticsofwhiteliberalsandwhiteconservativesareshapedbywhiteness target_blankassuages concerns seen racista enabling essence cant racist voted black candidate psychologists relnoopener hrefhttpsjournalssagepubcomdoipdf1011770146167210385920casa_tokenzys_nqsq6uuaaaaacytnozxmv1baxuxxgofltzudzbambqdoq45nk4do8o1rr3iuzetnjebltdk5si9ztd7x9jyxzfksjg target_blankmoral credentialinga theres relnoopener hrefhttpsnewsstanfordedunews2009march4obamamoralcredentialsfavorwhites030409html target_blanksome evidencea voters expressed support obama shortly 2008 election felt justified favoring white americans black americans electing black republican like sears relnoopener hrefhttpswwwfoxnewscommediavirginiarepublicanwinsomesearscriticalracetheorynonsense target_blankrailed critical race theorya runup election relnoopener hrefhttpstwittercomwinsomesearsstatus1372941065007816705langen target_blanksupports voting restrictionsa relnoopener hrefhttpswwwbrennancenterorgourworkresearchreportsnewvotersuppression target_blankadversely affect racial minoritiesa similarly symbolic shield entire party inevitable charges championing racist policies mentioned earlier conservative media outlets politicians weaponizing victory dare suggest sop p dataparagraphmainbut course role race racism play american politics nuanced simplistic defenses suggest racially prejudiced whites oppose black candidates candidates skin color perceive relnoopener hrefhttpswwwjstororgstablepdf3791741pdfcasa_tokenuykoesmyykcaaaaadynnvbpircuvw4lxifninvlzmidnoyoxqtynx6pa_gczcm6mtgtsku5yefrykwwdm1lcw0wce0zpc6v1hvbavigo5du16ggvf0tcyzevra9wrrw_c target_blanksometimes wronglya black candidates especially black democrats ideological commitments odds interests white americans likewise racially prejudiced whites support black republicans hardly case theyve progressive race racially prejudiced whites vote sears appreciated attachment commitment black people willing support discounted itp p dataparagraphmainrace social construct meaning imbue meaning racially prejudiced whites hostile blackness se hostile particular manifestation blackness reflects commitment racial justice advancement groups collective goals racially prejudiced whites bothered manifestation blackness ideologically consistent identities attitudes searss conservative politics dont threaten racial hierarchy candidacy provides cover party thats antagonistic racial minorities racially prejudiced whites real question emnotem love black politicians like searsp |
618c48fde619af73ac736a05 | An Astronomer Cancels His Own Research—Because the Results Weren’t Popular | img altan astronomer cancels his own researchbecause the results werent popular srchttpss3amazonawscomprodstaticcontentquillettecom202111the_iram_30meter_telescope_scanning_the_night_skyjpgpastronomy seems to be in trouble as it is increasingly populated by researchers who seem more concerned with terrestrial politics than celestial objects and who at times view the search for truths about nature as threatening this became obvious in recent years once the proposed thirty meter telescope tmt project in hawaii was being a hrefhttpswwwkitvcomstory44918991debateoverthirtymetertelescopeprojectheatsupamidnewuhmasterplanformaunakeablockeda by indigenous protestors who view the mountain it is to be built on as sacred with a resolution 12 times a hrefhttpswwwtmtorgpageaboutwhatistmtfinera than the hubble space telescope the tmt could offer abundant new observational opportunities in astronomy and astrophysics but a protest in support of the indigenous groups by a hrefhttpspsmagcomnewsscientistsvoicetheirsupportfornativehawaiiansprotestingthethirtymetertelescopeadvocatesa in the astronomy a hrefhttpsdocsgooglecomdocumentd1yr8m4eborjjssfvvtmukb6ddguondbdmj9au0h1rkmyeditcommunitya now means that it is an open a hrefhttpswwwspacecomthirtymetertelescopecontroversyroilsastronomyconferencehtmlquestiona as to whether the tmt will ever be builtpfigureblockquote classtwittertweetp langen dirltrmauna kea is sacred to native hawaiian people the hawaiians who have been protesting construction of the thirty meter telescope are trying to protect a sacred site from further desecration i stand in solidarity with them a hrefhttpstwittercomhashtagtmtsrchashref_srctwsrc5etfwtmta a hrefhttpstcouinzgrrqp6httpstcouinzgrrqp6ap elizabeth warren ewarren a hrefhttpstwittercomewarrenstatus1153500734006185985ref_srctwsrc5etfwjuly 23 2019ablockquote
figureplast week yielded another ominous sign of the times as eminent astronomer john kormendy a hrefhttpswwwinsidehigheredcomnews20211104astronomerwithdrawspaperamidconcernsretracteda an article intended for publication in the emproceedings of the national academy of sciencesem from a a hrefhttpsarxivorgabs211014115preprinta website his a hrefhttpswebarchiveorgweb20211028230225httpsarxivorgpdf211014115pdfarticlea focused on statistical results relating to the evaluation of the future impact of astronomers research as a means to inform decisions on resource allocation such as job hires and tenure decisions online critics attacked kormendys use of quantitative metrics which may be seen as casting doubt on the application of diversity criteria in personnel decisions at which point kormendy felt the need to release an abject a hrefhttpschandraasutexaseduapologyhtmlapologya more on this belowpfigureimg srchttpss3amazonawscomprodstaticcontentquillettecom202111screenshot20211109at21750pmpng altan astronomer cancels his own researchbecause the results werent popular width1346 height944figcaptionastronomer john kormendy photographed in 2006 figcaptionfigurepof course statistical analyses of realworld human data are always subject to the possibility that systematic biases can inappropriately skew the claimed results and i would never suggest that kormendys work is beyond criticism but the traditional scientific manner of engaging in such criticism is that other scientists present alternative proposals and explore other data sets to search for possible flaws in the original analysis that is how science should be done those who claim emin advanceem without new analysis or data that someone elses research results are harmful or threatening without challenging its emaccuracyem should consider another professionppi have been a professor of astronomy as well as physics for over 35 years at a variety of research institutions on three continents but i wouldnt classify myself as an astronomer my educational background is in another areatheoretical particle physicsand my professional forays into astrophysics and cosmology have stemmed from my longstanding interest in observing scientific phenomena from a wide variety of disciplinary perspectives astronomy included as a means of testing fundamental notions about natureppnevertheless i have worked with many astronomers over the course of my career and consulted and learned from a far larger number so i know enough about the social and professional dynamics of the profession to be concernedppone of the astronomers whose work i have been aware of for decadesand which reflects my interest in dark matter and the formation of the universes structureis john kormendy himself indeed i briefly met him while visiting the dominion astrophysics observatory in victoria canadappthat was several decades ago but when i recently checked in with a colleague to determine how kormendys reputation had fared during the interim i was told he stands as one of the worlds premier researchers on the formation and structure of galaxies he is a member of the national academy of sciences winner of numerous awards in his field and his research work has been cited over 33000 times by other astronomersppkormendy has been interested for some time in metrics that scientists can use to ensure that their assessment of potential hires and promotions are less subjective as with all areas in which decisions depend on human perceptions there is no methodology that is universally guaranteed to work though i personally wouldnt spend my own research time exploring this area i appreciate that there are those willing to try to investigate it systematically in spite of the many obvious obstaclesppfollowing five years of accumulating data and consulting colleagues across the globe kormendy produced a book on the subject published in august by the astronomical society of the pacific entitled a hrefhttpwwwaspbooksorgavolumestable_of_contentsbook_id608emmetrics of research impact in astronomyema as well as the related and now retracted paper submitted to the emproceedings of the national academy of sciencesem empnasem on november 1st under the title a hrefhttpswebarchiveorgweb20211028230225httpsarxivorgpdf211014115pdfmetrics of research impact in astronomy predicting later impact from metrics measured 1015 years after the phdapfigureimg srchttpss3amazonawscomprodstaticcontentquillettecom202111screenshot20211109at22135pmjpg altan astronomer cancels his own researchbecause the results werent popular width1700 height1046figcaptionresearch impact versus total citations for studied astronomy scholars adapted from figure 1 in a hrefhttpswebarchiveorgweb20211028230225httpsarxivorgpdf211014115pdfemmetrics of research impact in astronomyemaememfigcaptionfigurepkormendy began his paper cautiously recognizing that his emphasis on applying quantitative metrics to humanresource evaluation would be viewed with skepticism by those who claim that such metrics embed systemic biases and that their use presents obstacles to inclusion notwithstanding such anticipated concerns he argued thatpblockquotewe have to judge the impact that [a] candidates research has had or may yet have on the history of his or her subject then metrics such as counts of papers published and citations of those papers are often used but we are uncertain enough about what these metrics measure so that arguments about their interpretation are common confidence is low this can persuade institutions to abandon reliance on metrics [but] we would never dare to do scientific research with the lack of rigor that is common in careerrelated decisions as scientists we should aim to do betterblockquotephe makes it clear up front that quantitative metrics cannot tell us everything we need to know about a candidate in the significance statement provided on the first page he statespblockquotethis paper develops machinery to make quantitative predictions of future scientific impact from metrics measured immediately after the rampup period that follows the phd the aim is to resolve some of the uncertainty in using metrics for one aspect only of career decisionsjudging scientific impact emof course those decisions should be made more holistically taking into account additional factors that this paper does not measureem my emphasisblockquotepthe bulk of the paper focuses on three out of 10 metricscitations of refereed papers citations normalized by numbers of coauthors and firstauthor citationswhich kormendy attempts to develop into a prediction machine correlating the metrics evaluated over the early part of a researchers career with their later impactppthis latter index was constructed by asking 22 scientists who are wellknown in their respective subfields to evaluate the impact of 512 astronomers from 17 major research universities around the world whose other earlycareer metrics could be correlated with those evaluations specifically kormendy sought to determine whether such evaluation of individuals impact 10 to 15 years after theyd received their phds correlated in a significant way with the metrics evaluated at that time and to those corresponding to these scholars during the early period following their phd in other words whether the metrics could predict the evaluations rendered by the advisory panel the paper claimed to demonstrate not surprisingly that averaging the three different metrics produces on average a better predictive estimate than any of the metrics do separatelyppone can question many aspects of this model including the significance of its conclusions that earlycareer citation counts correlate with later impact may seem almost tautological why would you emnotem expect that having a large number of citations early on in ones career would be correlated with attaining a reputation as a highimpact scholar later on also the proposition that averaging several metrics produces a better predictive fit than does any individual metric in isolation would only really be noteworthy if it turned out emnot emto be trueppfinally one can always question the subjective assessments of those 22 designated sages tasked with measuring impact especially since their assessments and kormendys own decisions in regard to who performs this task may reflect the same kind of subjectivity that kormendys whole project is designed to avoidppi am not sure kormendy understood the can of worms he was opening but the response from the astronomy twittersphere was swift one could have anticipated the arguments in advance if one were familiar with the standard concerns of those who tend to view emany emquantitative metrics applied to assessment including standardized test results as being inherently suspect at best or sexist and racist at worst kormendy further tempted fate by focusing only on subjects from wellknown schools and by recruiting mostly wellknown male senior scientists as members of his expert impact panelppas it happened those who rained criticism on kormendy didnt just limit themselves to these generalities it was also specifically claimed that junior researchers who might read kormendys paper would feel threatened or that their careers might be negatively impacted by selection committees whose members were now further encouraged to be systematically biased against themppnevertheless even imperfect quantitative metrics can improve on qualitative assessments made in the absence of such metrics and it is quite true that kormendys analysis if applied as a means to recruit or promote would expose for better or worse those whose metrics are low there may be lots of reasons for such low scores including bias but low scores can also mean that the evaluated researchers are simply not productive or impactful either way it exposes potential problems either with the candidate or his or her academic environment that could be addressed moreover as much as one might dislike quantitativeor objectivemeritbased metrics the alternatives have historically usually been worseand include nepotism and cronyismppyet by the standards of modern cancel culture the online barrage of criticism against kormendy did not seem especially ferocious unlike other furors this one did not feature virally circulated demands for his sacking or other forms of cancellation but surely there must have been some other pressure coming to bear on kormendy because he not only retracted his published paper and put further publication of his book on hold but he also posted an apology whose language seemed out of all proportion to his actionspblockquotei apologize most humbly and sincerely for the stress that i have caused with the pnas preprint the pnas paper and my book on using metrics of research impact to help to inform decisions on career advancement my goal was entirely supportive i wanted to promote fairness and concreteness in judgments that now are based uncomfortably on personal opinion i wanted to contribute to a climate that favors good science and good citizenship my work was intended to be helpful not harmful it was intended to decrease bias and to improve fairness it was hoped to favor inclusivity it was especially intended to help us all to do the best science that we can but intentions do not in the end matter what matters is what my actions achieve and i now see that my work has hurt people i apologize to you all for the stress and the pain that i have caused nothing could be further from my hopes the pnas paper and preprint have been withdrawn as thoroughly as the publication system allows the withdrawalif accepted by themshould be in the wednesday posting i fully support all efforts to promote fairness inclusivity and a nurturing environment for all only in such an environment can people and creativity thriveblockquotepit is hard to know what specifically induced this kind of maoist emmea culpaem but kormendy or someone with authority over him presumably was swayed by the online tempest and an unfortunate effect will be that anyone observing how this played out will be warned off making their own inquiries in this field for fear that they will meet the same fate this is one reason why scientific articles should never be retracted simply because they might cause offense truth can hurt but too badppwhat makes this example particularly sad is that kormendys intent was clearly to stimulate healthy discussion and improve fairnessnotwithstanding the fact that the mobs claimed and if his apology is to be taken at face value convinced him that he was doing exactly the opposite in his lengthy apology he writes that intentions do not in the end matter but emof courseem they matter and in this case not only were kormendys intentions benign but his original paper actually addressed and even echoed many of the critiques he later gotpblockquotei emphasize that the goal of this paper is to estimate impact accrued not impact deserved historically some people who made major contributions were at the time undervalued by the astronomical community i hope that this work will help to make people more aware of the dangers of biased judgments and more focused on giving fair credit how to make judgment and attribution more fair is very important but it is not directly the subject of this workblockquoteblockquotemy goal has been to lend a little of the analysis rigor that we use when we do research to the difficult and subjective process of judging research careers but i do not suggest that we base decisions only on metrics judgmentsespecially decisions about hiring and tenureshould be and are made more holistically weighing factors that metrics do not measure for faculty jobs these include teaching ability good departmental citizenship collegiality and the impedance match between a persons research interests and the resources that are available at that institute also many factors other than research have in the 2020s become deservedly prominent in resource decisions heightened awareness of the importance of inclusivity has the result that institutions put special emphasis on redressing historically underrepresented cohorts urgent concerns are gender balance and the balance of ethnic minorities how relatively to weight research impact and these concerns are issues that each institution must decide for itself my job is restricted to one aspect only of career decisionsthe judgment of research impact as it has already happened and as it can with due regard for statistical uncertainties and outliers be predicted to happen in futureblockquoteblockquotei emphasize again that metrics measure the impact that happens not the impact that should happen it helps us to understand what happens in the real world the real world is the only one that we have to live in my hope is that a healthybut not excessiveinvestment in impact measures will make a modest contribution to better scienceblockquotepunfortunately for kormendy the real world is also a place in which claims of victimization and inequity now dominate many academic discussions to such extent that attempting a modest contribution to better science can be attackedand in this case literally expungedby those who believe that a quantitative exploration of certain data sets can be harmful or threateningp | img altan astronomer cancels researchbecause results werent popular srchttpss3amazonawscomprodstaticcontentquillettecom202111the_iram_30meter_telescope_scanning_the_night_skyjpgpastronomy trouble increasingly populated researchers concerned terrestrial politics celestial objects times view search truths nature threatening obvious recent years proposed thirty meter telescope tmt project hawaii hrefhttpswwwkitvcomstory44918991debateoverthirtymetertelescopeprojectheatsupamidnewuhmasterplanformaunakeablockeda indigenous protestors view mountain built sacred resolution 12 times hrefhttpswwwtmtorgpageaboutwhatistmtfinera hubble space telescope tmt offer abundant new observational opportunities astronomy astrophysics protest support indigenous groups hrefhttpspsmagcomnewsscientistsvoicetheirsupportfornativehawaiiansprotestingthethirtymetertelescopeadvocatesa astronomy hrefhttpsdocsgooglecomdocumentd1yr8m4eborjjssfvvtmukb6ddguondbdmj9au0h1rkmyeditcommunitya means open hrefhttpswwwspacecomthirtymetertelescopecontroversyroilsastronomyconferencehtmlquestiona tmt builtpfigureblockquote classtwittertweetp langen dirltrmauna kea sacred native hawaiian people hawaiians protesting construction thirty meter telescope trying protect sacred site desecration stand solidarity hrefhttpstwittercomhashtagtmtsrchashref_srctwsrc5etfwtmta hrefhttpstcouinzgrrqp6httpstcouinzgrrqp6ap elizabeth warren ewarren hrefhttpstwittercomewarrenstatus1153500734006185985ref_srctwsrc5etfwjuly 23 2019ablockquote figureplast week yielded ominous sign times eminent astronomer john kormendy hrefhttpswwwinsidehigheredcomnews20211104astronomerwithdrawspaperamidconcernsretracteda article intended publication emproceedings national academy sciencesem hrefhttpsarxivorgabs211014115preprinta website hrefhttpswebarchiveorgweb20211028230225httpsarxivorgpdf211014115pdfarticlea focused statistical results relating evaluation future impact astronomers research means inform decisions resource allocation job hires tenure decisions online critics attacked kormendys use quantitative metrics seen casting doubt application diversity criteria personnel decisions point kormendy felt need release abject hrefhttpschandraasutexaseduapologyhtmlapologya belowpfigureimg srchttpss3amazonawscomprodstaticcontentquillettecom202111screenshot20211109at21750pmpng altan astronomer cancels researchbecause results werent popular width1346 height944figcaptionastronomer john kormendy photographed 2006figcaptionfigurepof course statistical analyses realworld human data subject possibility systematic biases inappropriately skew claimed results suggest kormendys work criticism traditional scientific manner engaging criticism scientists present alternative proposals explore data sets search possible flaws original analysis science claim emin advanceem new analysis data elses research results harmful threatening challenging emaccuracyem consider professionppi professor astronomy physics 35 years variety research institutions continents wouldnt classify astronomer educational background areatheoretical particle physicsand professional forays astrophysics cosmology stemmed longstanding interest observing scientific phenomena wide variety disciplinary perspectives astronomy included means testing fundamental notions natureppnevertheless worked astronomers course career consulted learned far larger number know social professional dynamics profession concernedppone astronomers work aware decadesand reflects interest dark matter formation universes structureis john kormendy briefly met visiting dominion astrophysics observatory victoria canadappthat decades ago recently checked colleague determine kormendys reputation fared interim told stands worlds premier researchers formation structure galaxies member national academy sciences winner numerous awards field research work cited 33000 times astronomersppkormendy interested time metrics scientists use ensure assessment potential hires promotions subjective areas decisions depend human perceptions methodology universally guaranteed work personally wouldnt spend research time exploring area appreciate willing try investigate systematically spite obvious obstaclesppfollowing years accumulating data consulting colleagues globe kormendy produced book subject published august astronomical society pacific entitled hrefhttpwwwaspbooksorgavolumestable_of_contentsbook_id608emmetrics research impact astronomyema related retracted paper submitted emproceedings national academy sciencesem empnasem november 1st title hrefhttpswebarchiveorgweb20211028230225httpsarxivorgpdf211014115pdfmetrics research impact astronomy predicting later impact metrics measured 1015 years phdapfigureimg srchttpss3amazonawscomprodstaticcontentquillettecom202111screenshot20211109at22135pmjpg altan astronomer cancels researchbecause results werent popular width1700 height1046figcaptionresearch impact versus total citations studied astronomy scholars adapted figure 1 hrefhttpswebarchiveorgweb20211028230225httpsarxivorgpdf211014115pdfemmetrics research impact astronomyemaememfigcaptionfigurepkormendy began paper cautiously recognizing emphasis applying quantitative metrics humanresource evaluation viewed skepticism claim metrics embed systemic biases use presents obstacles inclusion notwithstanding anticipated concerns argued thatpblockquotewe judge impact [a] candidates research history subject metrics counts papers published citations papers uncertain metrics measure arguments interpretation common confidence low persuade institutions abandon reliance metrics [but] dare scientific research lack rigor common careerrelated decisions scientists aim betterblockquotephe makes clear quantitative metrics tell need know candidate significance statement provided page statespblockquotethis paper develops machinery quantitative predictions future scientific impact metrics measured immediately rampup period follows phd aim resolve uncertainty metrics aspect career decisionsjudging scientific impact emof course decisions holistically taking account additional factors paper measureem emphasisblockquotepthe bulk paper focuses 10 metricscitations refereed papers citations normalized numbers coauthors firstauthor citationswhich kormendy attempts develop prediction machine correlating metrics evaluated early researchers career later impactppthis index constructed asking 22 scientists wellknown respective subfields evaluate impact 512 astronomers 17 major research universities world earlycareer metrics correlated evaluations specifically kormendy sought determine evaluation individuals impact 10 15 years theyd received phds correlated significant way metrics evaluated time corresponding scholars early period following phd words metrics predict evaluations rendered advisory panel paper claimed demonstrate surprisingly averaging different metrics produces average better predictive estimate metrics separatelyppone question aspects model including significance conclusions earlycareer citation counts correlate later impact tautological emnotem expect having large number citations early ones career correlated attaining reputation highimpact scholar later proposition averaging metrics produces better predictive fit individual metric isolation noteworthy turned emnot emto trueppfinally question subjective assessments 22 designated sages tasked measuring impact especially assessments kormendys decisions regard performs task reflect kind subjectivity kormendys project designed avoidppi sure kormendy understood worms opening response astronomy twittersphere swift anticipated arguments advance familiar standard concerns tend view emany emquantitative metrics applied assessment including standardized test results inherently suspect best sexist racist worst kormendy tempted fate focusing subjects wellknown schools recruiting wellknown male senior scientists members expert impact panelppas happened rained criticism kormendy didnt limit generalities specifically claimed junior researchers read kormendys paper feel threatened careers negatively impacted selection committees members encouraged systematically biased themppnevertheless imperfect quantitative metrics improve qualitative assessments absence metrics true kormendys analysis applied means recruit promote expose better worse metrics low lots reasons low scores including bias low scores mean evaluated researchers simply productive impactful way exposes potential problems candidate academic environment addressed dislike quantitativeor objectivemeritbased metrics alternatives historically usually worseand include nepotism cronyismppyet standards modern cancel culture online barrage criticism kormendy especially ferocious unlike furors feature virally circulated demands sacking forms cancellation surely pressure coming bear kormendy retracted published paper publication book hold posted apology language proportion actionspblockquotei apologize humbly sincerely stress caused pnas preprint pnas paper book metrics research impact help inform decisions career advancement goal entirely supportive wanted promote fairness concreteness judgments based uncomfortably personal opinion wanted contribute climate favors good science good citizenship work intended helpful harmful intended decrease bias improve fairness hoped favor inclusivity especially intended help best science intentions end matter matters actions achieve work hurt people apologize stress pain caused hopes pnas paper preprint withdrawn thoroughly publication system allows withdrawalif accepted themshould wednesday posting fully support efforts promote fairness inclusivity nurturing environment environment people creativity thriveblockquotepit hard know specifically induced kind maoist emmea culpaem kormendy authority presumably swayed online tempest unfortunate effect observing played warned making inquiries field fear meet fate reason scientific articles retracted simply cause offense truth hurt badppwhat makes example particularly sad kormendys intent clearly stimulate healthy discussion improve fairnessnotwithstanding fact mobs claimed apology taken face value convinced exactly opposite lengthy apology writes intentions end matter emof courseem matter case kormendys intentions benign original paper actually addressed echoed critiques later gotpblockquotei emphasize goal paper estimate impact accrued impact deserved historically people major contributions time undervalued astronomical community hope work help people aware dangers biased judgments focused giving fair credit judgment attribution fair important directly subject workblockquoteblockquotemy goal lend little analysis rigor use research difficult subjective process judging research careers suggest base decisions metrics judgmentsespecially decisions hiring tenureshould holistically weighing factors metrics measure faculty jobs include teaching ability good departmental citizenship collegiality impedance match persons research interests resources available institute factors research 2020s deservedly prominent resource decisions heightened awareness importance inclusivity result institutions special emphasis redressing historically underrepresented cohorts urgent concerns gender balance balance ethnic minorities relatively weight research impact concerns issues institution decide job restricted aspect career decisionsthe judgment research impact happened regard statistical uncertainties outliers predicted happen futureblockquoteblockquotei emphasize metrics measure impact happens impact happen helps understand happens real world real world live hope healthybut excessiveinvestment impact measures modest contribution better scienceblockquotepunfortunately kormendy real world place claims victimization inequity dominate academic discussions extent attempting modest contribution better science attackedand case literally expungedby believe quantitative exploration certain data sets harmful threateningp |
618c491de619af73ac736a0b | Symposium on my Book, "Repugnant Laws" | pimg sizesmaxwidth 199px 100vw 199px srchttpsd2eehagpk5cl65cloudfrontnetimgq60uploads202111repugnantlawsbookcoverdesign199x300jpg alt width199 srcsethttpsd2eehagpk5cl65cloudfrontnetimgq60uploads202111repugnantlawsbookcoverdesign199x300jpg 199w httpsd2eehagpk5cl65cloudfrontnetimgq60uploads202111repugnantlawsbookcoverdesign678x1024jpg 678w httpsd2eehagpk5cl65cloudfrontnetimgq60uploads202111repugnantlawsbookcoverdesign768x1160jpg 768w httpsd2eehagpk5cl65cloudfrontnetimgq60uploads202111repugnantlawsbookcoverdesign1017x1536jpg 1017w httpsd2eehagpk5cl65cloudfrontnetimgq60uploads202111repugnantlawsbookcoverdesignjpg 1225w classwpimage8138282 height300p
pa hrefhttpsreasoncomwpcontentuploads202111constitutionalcommentaryrepugnantlawssymposiumtableofcontentspdfconstitutional commentary repugnant laws symposium table of contentsai am pleased to see that the symposium issue of a hrefhttpsconservancyumneduhandle11299162881emconstitutional commentaryema focusing on my book a hrefhttpskansaspresskuedu9780700627790htmlemrepugnant laws judicial review of acts of congress from the founding to the presentema is now publicly available the symposium fills issue 1 of volume 35 of the interdisciplinary journal and a hrefhttpsconservancyumneduhandle11299214015it can be accessed herea it features contributions by a hrefhttpsconservancyumneduhandle11299214052sandy levinsona a hrefhttpsconservancyumneduhandle11299214051leslie friedman goldsteina a hrefhttpsconservancyumneduhandle11299214050julie novkova a hrefhttpsconservancyumneduhandle11299214049mark grabera a hrefhttpsconservancyumneduhandle11299214048john comptona and a hrefhttpsconservancyumneduhandle11299214053meap
pa hrefhttpswwwamazoncomexecobidosasin0700627790reasonmagazinea20emrepugnant lawsema provides a comprehensive political history of how the us supreme court has used the power of judicial review to refuse to apply to hem in and most often to uphold federal statutory provisions across american history the book makes use of an original dataset of cases in which the court has substantively evaluated the constitutionality of a federal statute a hrefhttpsscholarprincetonedukewhittjudicialreviewcongressdatabasethe judicial review of congress databasea is now publicly available and i periodically update and revise the dataset i believe it provides the most comprehensive inventory in existence of cases in which the court resolved a constitutional challenge to the legislative authority of congressp
pthe essays in the symposium not only provide an illuminating discussion of the book but also examine broader issues in the history and politics of judicial review a hrefhttpsconservancyumneduhandle11299214015recentsubmissionscheck it outap | pimg sizesmaxwidth 199px 100vw 199px srchttpsd2eehagpk5cl65cloudfrontnetimgq60uploads202111repugnantlawsbookcoverdesign199x300jpg alt width199 srcsethttpsd2eehagpk5cl65cloudfrontnetimgq60uploads202111repugnantlawsbookcoverdesign199x300jpg 199w httpsd2eehagpk5cl65cloudfrontnetimgq60uploads202111repugnantlawsbookcoverdesign678x1024jpg 678w httpsd2eehagpk5cl65cloudfrontnetimgq60uploads202111repugnantlawsbookcoverdesign768x1160jpg 768w httpsd2eehagpk5cl65cloudfrontnetimgq60uploads202111repugnantlawsbookcoverdesign1017x1536jpg 1017w httpsd2eehagpk5cl65cloudfrontnetimgq60uploads202111repugnantlawsbookcoverdesignjpg 1225w classwpimage8138282 height300p pa hrefhttpsreasoncomwpcontentuploads202111constitutionalcommentaryrepugnantlawssymposiumtableofcontentspdfconstitutional commentary repugnant laws symposium table contentsai pleased symposium issue hrefhttpsconservancyumneduhandle11299162881emconstitutional commentaryema focusing book hrefhttpskansaspresskuedu9780700627790htmlemrepugnant laws judicial review acts congress founding presentema publicly available symposium fills issue 1 volume 35 interdisciplinary journal hrefhttpsconservancyumneduhandle11299214015it accessed herea features contributions hrefhttpsconservancyumneduhandle11299214052sandy levinsona hrefhttpsconservancyumneduhandle11299214051leslie friedman goldsteina hrefhttpsconservancyumneduhandle11299214050julie novkova hrefhttpsconservancyumneduhandle11299214049mark grabera hrefhttpsconservancyumneduhandle11299214048john comptona hrefhttpsconservancyumneduhandle11299214053meap pa hrefhttpswwwamazoncomexecobidosasin0700627790reasonmagazinea20emrepugnant lawsema provides comprehensive political history supreme court power judicial review refuse apply hem uphold federal statutory provisions american history book makes use original dataset cases court substantively evaluated constitutionality federal statute hrefhttpsscholarprincetonedukewhittjudicialreviewcongressdatabasethe judicial review congress databasea publicly available periodically update revise dataset believe provides comprehensive inventory existence cases court resolved constitutional challenge legislative authority congressp pthe essays symposium provide illuminating discussion book examine broader issues history politics judicial review hrefhttpsconservancyumneduhandle11299214015recentsubmissionscheck outap |
618c49f0e619af73ac736a1b | Yglesias on CRT | pmatt yglesias has an a hrefhttpswwwslowboringcompcriticalracetheoryandactualeducationexcellent post on schooling and politicsa emphasizing three points first there is a lot of diversity equity inclusion dei nonsense which the schools are using to train teachers and administrators second at the same time the school administratorsteachers unions are generally ignoring the very real cost to children and parents of the school closures including the costs of a widening racial gap third the schools are stigmatizing testing under the guise of promoting equity but in reality because the teachers unions know that when you test children you learn that not all teachers are equally capablep
blockquotep[the dc public schools] also a rel hrefhttpsdcpsdcgovsitesdefaultfilesdcsitesdcpspage_contentattachmentsequitystrategyand20programingrecommendedreadingsandresourcesupdatedjune2020pdfrecommend that people read a bunch of robin diangelo booksa and brag that more than 2000 dcps staff have participated in a rel hrefhttpscourageousconversationcomaboutcourageous conversation traininga but is courageous conversation training a good idea this nyt magazine profile of the company and its founder a rel hrefhttpswwwnytimescom20200715magazinewhitefragilityrobindiangelohtmlmade it sound pretty badap
pemsingleton who holds degrees from the university of pennsylvania and stanford and who did stints in advertising and college admissions before founding whats now known as courageous conversation in 1992 talks about white culture in similar ways there is the myth of meritocracy and valuing written communication over other forms he told me is a hallmark of whiteness which leads to the denigration of black children in school another hallmark is scientific linear thinking cause and effect he said theres this whole group of people who are named the scientists thats where you get into this whole idea that if its not codified in scientific thought that it cant be valid he spoke about how the ancient egyptians had ideas about how humanity works that never had that scientifichypothesis construction and so arent recognized this is a good way of dismissing people and this he continued shifting forward thousands of years is one of the challenges in the diversityequityinclusion space folks keep asking for data how do you quantify in a way that is scientific numbers and that kind of thing what people feel when theyre feeling marginalized for singleton societys primary intellectual values are bound up with this marginalizationemp
pi dont think frankfurt school marxists are going to take over society by injecting these ideas into k12 schools or anything like that what i so think is that time and money is being wasted on initiatives that are run by people who are somewhere between stupid and fraudulentp
pand its important to take that seriously not just because someone somewhere may take these goofy ideas seriously see a rel hrefhttpswwwslowboringcomptemaokunprior commentary about tema okuna but because fiscal tradeoffs are real dollars spent on dei trainings that come with zero proof of efficacy are dollars that cant be invested in things like dcs a rel hrefhttpswwwslowboringcompmoregoodnewsaboutdcsteachersuccessful teacher bonus pay programa a rel hrefhttpswwwnberorgsystemfilesworking_papersw24639w24639pdfupdating school air conditioninga a rel hrefhttpswwwnberorgpapersw23218improving school lunchesa reducing a rel hrefhttpswwwvoxcomfutureperfect20214622364385onesmallideainbidensinfrastructureplanwithbigbenefitselectricschoolbuseskids exposure to air pollutiona and a rel hrefhttpswwwslowboringcompleadpoisoninglead poisoninga or any of the other various interventions that have decent evidence behind themp
pof course when i say that investing in higher quality school lunches is good for kids learning what i mean is that its good as measured on standardized testsp
pstandardized testing has become a weird discourse flashpoint but i think everyone agrees that you can in principle assess someones competence in a given subject area with a test and if you want to compare different people you need to give them the same test its only by making comparisons across classrooms and across time that we are able to persuasively demonstrate that particulates are bad for school performance healthy meals are good for school performance and air conditioning improves school performance in the summerp
pall this would be uncontroversial i think except teachers unions dont like the idea of assessing teachers based on their job performancepblockquote
pread the a hrefhttpswwwslowboringcompcriticalracetheoryandactualeducationwhole thinga and subscribe to slow boringp
pthe post a relnofollow hrefhttpmarginalrevolutioncommarginalrevolution202111yglesiasoncrthtmlyglesias on crta appeared first on a relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap | pmatt yglesias hrefhttpswwwslowboringcompcriticalracetheoryandactualeducationexcellent post schooling politicsa emphasizing points lot diversity equity inclusion dei nonsense schools train teachers administrators second time school administratorsteachers unions generally ignoring real cost children parents school closures including costs widening racial gap schools stigmatizing testing guise promoting equity reality teachers unions know test children learn teachers equally capablep blockquotep[the dc public schools] rel hrefhttpsdcpsdcgovsitesdefaultfilesdcsitesdcpspage_contentattachmentsequitystrategyand20programingrecommendedreadingsandresourcesupdatedjune2020pdfrecommend people read bunch robin diangelo booksa brag 2000 dcps staff participated rel hrefhttpscourageousconversationcomaboutcourageous conversation traininga courageous conversation training good idea nyt magazine profile company founder rel hrefhttpswwwnytimescom20200715magazinewhitefragilityrobindiangelohtmlmade sound pretty badap pemsingleton holds degrees university pennsylvania stanford stints advertising college admissions founding whats known courageous conversation 1992 talks white culture similar ways myth meritocracy valuing written communication forms told hallmark whiteness leads denigration black children school hallmark scientific linear thinking cause effect said theres group people named scientists thats idea codified scientific thought cant valid spoke ancient egyptians ideas humanity works scientifichypothesis construction arent recognized good way dismissing people continued shifting forward thousands years challenges diversityequityinclusion space folks asking data quantify way scientific numbers kind thing people feel theyre feeling marginalized singleton societys primary intellectual values bound marginalizationemp pi dont think frankfurt school marxists going society injecting ideas k12 schools like think time money wasted initiatives run people stupid fraudulentp pand important seriously goofy ideas seriously rel hrefhttpswwwslowboringcomptemaokunprior commentary tema okuna fiscal tradeoffs real dollars spent dei trainings come zero proof efficacy dollars cant invested things like dcs rel hrefhttpswwwslowboringcompmoregoodnewsaboutdcsteachersuccessful teacher bonus pay programa rel hrefhttpswwwnberorgsystemfilesworking_papersw24639w24639pdfupdating school air conditioninga rel hrefhttpswwwnberorgpapersw23218improving school lunchesa reducing rel hrefhttpswwwvoxcomfutureperfect20214622364385onesmallideainbidensinfrastructureplanwithbigbenefitselectricschoolbuseskids exposure air pollutiona rel hrefhttpswwwslowboringcompleadpoisoninglead poisoninga interventions decent evidence themp pof course investing higher quality school lunches good kids learning mean good measured standardized testsp pstandardized testing weird discourse flashpoint think agrees principle assess someones competence given subject area test want compare different people need test making comparisons classrooms time able persuasively demonstrate particulates bad school performance healthy meals good school performance air conditioning improves school performance summerp pall uncontroversial think teachers unions dont like idea assessing teachers based job performancepblockquote pread hrefhttpswwwslowboringcompcriticalracetheoryandactualeducationwhole thinga subscribe slow boringp pthe post relnofollow hrefhttpmarginalrevolutioncommarginalrevolution202111yglesiasoncrthtmlyglesias crta appeared relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap |
618c4a79e619af73ac736a2b | If he can’t cut taxes, Rishi should at least cut the tax code | pthe tax burden in this country does not just consist of a big chunk of our money being handed over to the state the misery is increased by the time taken up in making all the calculations that process is also a significant item of public spending hmrcs recent a relnoopener hrefhttpsassetspublishingservicegovukgovernmentuploadssystemuploadsattachment_datafile1031053hmrc_annual_report_and_accounts_2020_to_2021__print_pdf target_blankannual accountsa show the revenue has a budget of 48bn and employs almost 62000 staff more than the number of gps and double the number of sailors in the royal navyp
pthe true figure for our army of tax collectors is actually even higher when you factor in the thousands working in local authorities administering council tax and business rates then we have all those industry levies which look and feel much like taxes which are imposed by an array of quangosp
pall of which is a roundabout way of saying that tax simplification would not only ease the administrative burden on individuals and businesses but allow some much needed savings in public spending it was heartening to hear the chancellor of the exchequer express support for the general idea of tax simplification in the budget last month and to see him start a bit of rationalisation when it comes to alcohol taxes though we still have a relnoopener hrefhttpscapxcocheersrishibutalcoholtaxesarestillalongwayfromrational target_blanksome way to goa even on that frontp
pbut overall the situation gets worse every year to quote the chartered institute of taxationp
pemsince the turn of the century governments of all political complexions have been adding new taxes to the statute book at an average of one a year this is a one way conveyor belt they have not got rid of any nontemporary taxes this century we should not just keep adding to the number of taxes the uk has the chancellor referred eight times in his speech to tax simplification but we could be set for six new taxes in the space of a couple of years as many as in the previous eight years adding six new taxes to the tax code is not simplificationemp
pback in 2010 new chancellor george osborne complained about the expansion of the tax code under labour the tax system has become hugely complex over the last 13 years since 1997 the tax legislation handbook has more than doubled in length it is now over 11000 pages long this spiderweb of tax rules is holding back people who want to set up businessesp
pby the time he departed as chancellor the tax code had almost doubled in length again to 21000 pages the centre for policy studies calculated that there were 12 times as many words in the uk tax code as in the king james bible what of the philip hammond era perhaps spreadsheet phil would have got to grips with this important task sadly not the taxpayers alliance informs me that tolleys tax guide now weighs in at 25412 pagesp
aside
h1get more from capxh1
ul
li
a hrefhttpstwittercomcapx target_blankiifollow us on twittera
li
li
a hrefhttpswwwfacebookcomcapxco target_blankiijoin us on facebooka
li
li
a hrefhttpswwwcapxcosubscribe target_blankiisign up to our email bulletinsa
li
li
a hrefhttpsitunesapplecomgbpodcastcapxpresentsfreeexchangeid1220313938 target_blankiisubscribe to free exchange the capx podcasta
li
ul
aside
pat least osborne had the excuse that he was only obeying orders great swathes of new tax regulation were imposed each year by the european union it is only this year that those obligations have been lifted yet we are being slow to take up the opportunities which we had years to prepare forp
pin any case if it was all the eus fault then why is tax compliance in the uk more onerous than in some member states the world bank and pwc a relnoopener hrefhttpswwwpwccomgxenservicestaxpublicationspayingtaxes2020overallrankinganddatatableshtml target_blankhave done some calculationsa on the number of hours it takes a small firm to submit its tax returns they put it at 114 for the uk 815 for ireland and 50 for estoniap
pperhaps this is why tax simplification is one of the areas dominic cummings has suggested labour should prioritise if they want to present a winning pitch to the electorate in a a hrefhttpsdominiccummingssubstackcomphowcouldlabourwinswapduddeadrecent bloga which is as far as i can make out entirely sincere boris johnsons former aide says the opposition should offer meaningful ideas about how to remove tax distortions that disincentive longterm investment and helping small businesses for whom tax bureaucracy is a nightmare the prize cummings goes on to say is that you will have tory voters agreeing with your priorities never mind swing votersp
pit would be a good theme for labour tax avoidance thrives amidst the thickets of complexity big firms and wealthy individuals can afford to pay the high fees that really ingenious accountants demand for the selfemployed the small firms the retired with some savings it is rather more onerous sir keir starmer could show sensitivity towards these groups without alienating his existing supporters is anyone really in favour of more complexity and bureaucracy than required would anyone object if the government was able to employ more teachers and fewer tax collectorsp
pthe difficulty is that the budget will always offer a temptation for gimmicks and quick fixes special exemption for this a tough penalty for that an easy route to favourable coverage by contrast stripping away tax regulation is detailed work that is unlikely to prove glamorous enough to grip the attention of the media osborne established an office of tax simplification it is still going but the extent of its failure is all too apparent the saga is worthy of a yes minister episodep
pyet there is nothing inevitable about all this rishi sunak might feel it prudent to wait a year or two before cutting taxes if so then simplifying would be a useful way for him to pass the time he could set some genuinely radical requirements for his officials getting the number of pages in the tax code back down to the 5000 pages we had in 1997 would be a start he could insist that a selfemployed businessman in devon would not have to spend any more hours filling in a tax return than his equivalent in dublin or for a shopkeeper in teesside to one in tallinn sunak could add that if his officials found this all too challenging he would bring in a team of accountants to do it for them there would be no difficulty finding recruits all too well aware of the duplications and contradictions that litter our tax code all those onerous requirements which result in little or no revenuep
pnigel lawson used to abolish an entire tax each year when he was chancellor that is the ultimate simplification even if he cant manage that sunak could do a lot to unshackle us by cutting tolleys printing bill just a few thousand pages would be a welcome startp
aside
h1elsewhere on capxh1
ul
li
a hrefhttpscapxcothecapxpodcastreasonstobecheerfulwithjacobreesmogg target_blankiithe capx podcast with jacob reesmogga
li
li
a hrefhttpscapxcotakingontheidentitymobletshopethedefenceofkathleenstockisasignofthingstocome target_blankiiian acheson taking on the identity mob and winninga
li
li
a hrefhttpscapxcounfairexpensiveandantienterprisescrappingir35islongoverdue target_blankiiharry phibbs scrapping ir35 is long overduea
li
li
a hrefhttpscapxcobuildbackbozzathepmofferedsomethingforeveryonebutputpolishoverpolicy target_blankiijohn ashmore build back bozzaa
li
li
a hrefhttpscapxcoonhgvdrivershortagesbothsidesaremissingthepoint target_blankiipatrick lohlein on hgv driver shortages both sides are missing the pointa
li
ul
aside
pia relnoopener hrefhttpscpsmpagescomwfh31ysignupform datasaferedirecturlhttpswwwgooglecomurlqhttpscpsmpagescomwfh31ysignupformampsourcegmailampust1636534878263000ampusgafqjcnepieooxh3zni_9ph2o0_tc6by3gq target_blankclick here to subscribe to our daily briefinga em the best pieces from capx and across the webemip
pemcapx depends on the generosity of its readers if you value what we do please consider making a donationemp
div
div
divdiv
div
div
pthe post a relnofollow hrefhttpscapxcoifhecantcuttaxesrishishouldatleastcutthetaxcodeif he cant cut taxes rishi should at least cut the tax codea appeared first on a relnofollow hrefhttpscapxcocapxap | pthe tax burden country consist big chunk money handed state misery increased time taken making calculations process significant item public spending hmrcs recent relnoopener hrefhttpsassetspublishingservicegovukgovernmentuploadssystemuploadsattachment_datafile1031053hmrc_annual_report_and_accounts_2020_to_2021__print_pdf target_blankannual accountsa revenue budget 48bn employs 62000 staff number gps double number sailors royal navyp pthe true figure army tax collectors actually higher factor thousands working local authorities administering council tax business rates industry levies look feel like taxes imposed array quangosp pall roundabout way saying tax simplification ease administrative burden individuals businesses allow needed savings public spending heartening hear chancellor exchequer express support general idea tax simplification budget month start bit rationalisation comes alcohol taxes relnoopener hrefhttpscapxcocheersrishibutalcoholtaxesarestillalongwayfromrational target_blanksome way goa frontp pbut overall situation gets worse year quote chartered institute taxationp pemsince turn century governments political complexions adding new taxes statute book average year way conveyor belt got rid nontemporary taxes century adding number taxes uk chancellor referred times speech tax simplification set new taxes space couple years previous years adding new taxes tax code simplificationemp pback 2010 new chancellor george osborne complained expansion tax code labour tax system hugely complex 13 years 1997 tax legislation handbook doubled length 11000 pages long spiderweb tax rules holding people want set businessesp pby time departed chancellor tax code doubled length 21000 pages centre policy studies calculated 12 times words uk tax code king james bible philip hammond era spreadsheet phil got grips important task sadly taxpayers alliance informs tolleys tax guide weighs 25412 pagesp aside h1get capxh1 ul li hrefhttpstwittercomcapx target_blankiifollow twittera li li hrefhttpswwwfacebookcomcapxco target_blankiijoin facebooka li li hrefhttpswwwcapxcosubscribe target_blankiisign email bulletinsa li li hrefhttpsitunesapplecomgbpodcastcapxpresentsfreeexchangeid1220313938 target_blankiisubscribe free exchange capx podcasta li ul aside pat osborne excuse obeying orders great swathes new tax regulation imposed year european union year obligations lifted slow opportunities years prepare forp pin case eus fault tax compliance uk onerous member states world bank pwc relnoopener hrefhttpswwwpwccomgxenservicestaxpublicationspayingtaxes2020overallrankinganddatatableshtml target_blankhave calculationsa number hours takes small firm submit tax returns 114 uk 815 ireland 50 estoniap pperhaps tax simplification areas dominic cummings suggested labour prioritise want present winning pitch electorate hrefhttpsdominiccummingssubstackcomphowcouldlabourwinswapduddeadrecent bloga far entirely sincere boris johnsons aide says opposition offer meaningful ideas remove tax distortions disincentive longterm investment helping small businesses tax bureaucracy nightmare prize cummings goes tory voters agreeing priorities mind swing votersp pit good theme labour tax avoidance thrives amidst thickets complexity big firms wealthy individuals afford pay high fees ingenious accountants demand selfemployed small firms retired savings onerous sir keir starmer sensitivity groups alienating existing supporters favour complexity bureaucracy required object government able employ teachers fewer tax collectorsp pthe difficulty budget offer temptation gimmicks quick fixes special exemption tough penalty easy route favourable coverage contrast stripping away tax regulation detailed work unlikely prove glamorous grip attention media osborne established office tax simplification going extent failure apparent saga worthy yes minister episodep pyet inevitable rishi sunak feel prudent wait year cutting taxes simplifying useful way pass time set genuinely radical requirements officials getting number pages tax code 5000 pages 1997 start insist selfemployed businessman devon spend hours filling tax return equivalent dublin shopkeeper teesside tallinn sunak add officials found challenging bring team accountants difficulty finding recruits aware duplications contradictions litter tax code onerous requirements result little revenuep pnigel lawson abolish entire tax year chancellor ultimate simplification cant manage sunak lot unshackle cutting tolleys printing bill thousand pages welcome startp aside h1elsewhere capxh1 ul li hrefhttpscapxcothecapxpodcastreasonstobecheerfulwithjacobreesmogg target_blankiithe capx podcast jacob reesmogga li li hrefhttpscapxcotakingontheidentitymobletshopethedefenceofkathleenstockisasignofthingstocome target_blankiiian acheson taking identity mob winninga li li hrefhttpscapxcounfairexpensiveandantienterprisescrappingir35islongoverdue target_blankiiharry phibbs scrapping ir35 long overduea li li hrefhttpscapxcobuildbackbozzathepmofferedsomethingforeveryonebutputpolishoverpolicy target_blankiijohn ashmore build bozzaa li li hrefhttpscapxcoonhgvdrivershortagesbothsidesaremissingthepoint target_blankiipatrick lohlein hgv driver shortages sides missing pointa li ul aside pia relnoopener hrefhttpscpsmpagescomwfh31ysignupform datasaferedirecturlhttpswwwgooglecomurlqhttpscpsmpagescomwfh31ysignupformampsourcegmailampust1636534878263000ampusgafqjcnepieooxh3zni_9ph2o0_tc6by3gq target_blankclick subscribe daily briefingaem best pieces capx webemip pemcapx depends generosity readers value consider making donationemp div div divdiv div div pthe post relnofollow hrefhttpscapxcoifhecantcuttaxesrishishouldatleastcutthetaxcodeif cant cut taxes rishi cut tax codea appeared relnofollow hrefhttpscapxcocapxap |
618c4a90e619af73ac736a33 | The gender gap in preferences | pthis is taken from a relnoopener hrefhttpswwwnberorgsystemfilesworking_papersw29451w29451pdf target_blanknew worka by span dirltrngel cuevas spanspan dirltrrubn cuevas spanspan dirltrklaus desmet and spanspan dirltrignacio ortuoortn here is the abstractbr
spanp
blockquotepspan dirltrthis paper uses information on the frequency of 45397 facebook interests to study how the spanspan dirltrdifferencespan span dirltrin preferences between men and women changes with a countrys degree of gender spanspan dirltrequality for preferencespan span dirltrdimensions that are systematically biased toward the same gender across spanspan dirltrthe globe differences betweenspan span dirltrmen and women are larger in more genderequal countries in spanspan dirltrcontrast for preference dimensionsspan span dirltrwith a gender bias that varies across countries the opposite spanspan dirltrholds this finding takes an importantspan span dirltrstep toward reconciling evolutionary psychology and spanspan dirltrsocial role theory as they relate to genderspanpblockquote
phere is a bit morep
blockquotepour premise is that innately genderspecific interests should mostly conform to evolutionary psychology theory whereas other interests should mostly conform to social role theory we find strong evidence consistent with this premisepblockquote
pand some detail on the categoriesp
blockquotepwe say that an interest is genderrelated if it displays a systematic bias toward the same gender across the globe more specifically if in more than 90 of countries an interest is more prevalent among the same gender then we refer to it as genderrelated for example cosmetics and motherhood are universally more common among women whereas motorcycles and lionel messi are universally more commonbr
among men conversely we say that an interest is nongenderrelated if its gender bias varies across countries more specifically if an interest is more common among men in at least 30 of countries and more common among women in at least another 30 of countries then we refer to it as nongenderrelated for example world heritage site and physical fitness do not display a systematic gender bias across the globepblockquote
pand indeed everything works out as one ought to expect in the more genderequal countries men have more male interests and the women have more female interests but for the less genderspecific interests greater equality ends up resulting as for magnitudep
blockquotepspan dirltrthespan span dirltrstandardizedspan span dirltrspan span dirltrisspan span dirltr30span span dirltrwhenspan span dirltrtakingspan span dirltr9span span dirltrdimensionsspan span dirltrmeaningspan span dirltrthatspan span dirltra spanspan dirltronespan span dirltrstandardspan span dirltrdeviationspan span dirltrincreasespan span dirltrinspan span dirltrgenderspan span dirltrequalityspan span dirltrincreasesspan span dirltrthespan span dirltrdifferencespan span dirltrinspan span dirltrpreferencesspan span dirltrbetweenspan span dirltrmenspan span dirltrandspan span dirltrwomenspan span dirltrbyspan span dirltr30span span dirltrofspan span dirltritsspan span dirltrstandardspan span dirltrdeviationspan span dirltrthespan span dirltrcorrespondingspan span dirltrstandardizedspan span dirltrspan span dirltrwhenspan span dirltrtaking spanspan dirltr68span span dirltrdimensionsspan span dirltrisspan span dirltr19span span dirltroverallspan span dirltrthespan span dirltrevidencespan span dirltrpointsspan span dirltrtospan span dirltraspan span dirltrpositivespan span dirltrrelationspan span dirltrbetweenspan span dirltrgenderspan span dirltrequalityspan span dirltrandspan span dirltrthespan span dirltrdifferencespan span dirltrinspan span dirltrinterestsspan span dirltrbetweenspan span dirltrmenspan span dirltrandspan span dirltrwomenspanpblockquote
phope you all are interested in this onep
p p
pthe post a relnofollow hrefhttpmarginalrevolutioncommarginalrevolution202111thegendergapinpreferenceshtmlthe gender gap in preferencesa appeared first on a relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap | pthis taken relnoopener hrefhttpswwwnberorgsystemfilesworking_papersw29451w29451pdf target_blanknew worka span dirltrngel cuevas spanspan dirltrrubn cuevas spanspan dirltrklaus desmet spanspan dirltrignacio ortuoortn abstractbr spanp blockquotepspan dirltrthis paper uses information frequency 45397 facebook interests study spanspan dirltrdifferencespan span dirltrin preferences men women changes countrys degree gender spanspan dirltrequality preferencespan span dirltrdimensions systematically biased gender spanspan dirltrthe globe differences betweenspan span dirltrmen women larger genderequal countries spanspan dirltrcontrast preference dimensionsspan span dirltrwith gender bias varies countries opposite spanspan dirltrholds finding takes importantspan span dirltrstep reconciling evolutionary psychology spanspan dirltrsocial role theory relate genderspanpblockquote phere bit morep blockquotepour premise innately genderspecific interests conform evolutionary psychology theory interests conform social role theory find strong evidence consistent premisepblockquote pand detail categoriesp blockquotepwe interest genderrelated displays systematic bias gender globe specifically 90 countries interest prevalent gender refer genderrelated example cosmetics motherhood universally common women motorcycles lionel messi universally commonbr men conversely interest nongenderrelated gender bias varies countries specifically interest common men 30 countries common women 30 countries refer nongenderrelated example world heritage site physical fitness display systematic gender bias globepblockquote pand works ought expect genderequal countries men male interests women female interests genderspecific interests greater equality ends resulting magnitudep blockquotepspan dirltrthespan span dirltrstandardizedspan span dirltrspan span dirltrisspan span dirltr30span span dirltrwhenspan span dirltrtakingspan span dirltr9span span dirltrdimensionsspan span dirltrmeaningspan span dirltrthatspan span dirltra spanspan dirltronespan span dirltrstandardspan span dirltrdeviationspan span dirltrincreasespan span dirltrinspan span dirltrgenderspan span dirltrequalityspan span dirltrincreasesspan span dirltrthespan span dirltrdifferencespan span dirltrinspan span dirltrpreferencesspan span dirltrbetweenspan span dirltrmenspan span dirltrandspan span dirltrwomenspan span dirltrbyspan span dirltr30span span dirltrofspan span dirltritsspan span dirltrstandardspan span dirltrdeviationspan span dirltrthespan span dirltrcorrespondingspan span dirltrstandardizedspan span dirltrspan span dirltrwhenspan span dirltrtaking spanspan dirltr68span span dirltrdimensionsspan span dirltrisspan span dirltr19span span dirltroverallspan span dirltrthespan span dirltrevidencespan span dirltrpointsspan span dirltrtospan span dirltraspan span dirltrpositivespan span dirltrrelationspan span dirltrbetweenspan span dirltrgenderspan span dirltrequalityspan span dirltrandspan span dirltrthespan span dirltrdifferencespan span dirltrinspan span dirltrinterestsspan span dirltrbetweenspan span dirltrmenspan span dirltrandspan span dirltrwomenspanpblockquote phope interested onep pp pthe post relnofollow hrefhttpmarginalrevolutioncommarginalrevolution202111thegendergapinpreferenceshtmlthe gender gap preferencesa appeared relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap |
618c4ac4e619af73ac736a34 | The Scout Mindset—A Review | img altthe scout mindseta review srchttpss3amazonawscomprodstaticcontentquillettecom202111scoutmindset1pngpppstronga review of ema hrefhttpsamznto3f3bbpqthe scout mindset why some people see things clearly and others donta emby julia galefem emportfolio 288 pages april 2021strongppjulia galefs ema hrefhttpsamznto3f3bbpqthe scout mindset why some people see things clearly and others dontaem is a brisk introduction to a particular way of thinking about the world and our place within it in another era those habits of mind might have been called critical rationalism given how often the emstar trek emcharacter spock features in the narrative you could be forgiven for wondering if the book is promoting the spock mindset after all the vulcans adherence to logic is worldfamous but emthe scout mindset emactually shows that spocks logical deductions led him into error more often than not galef arrived at this conclusion by actually watching the television show and comparing spocks predictions to outcomes in other words she went out and collected evidence galef was an empirical scout tabulating and tracking across the seasons rather than simply a passive observer absorbing each episode in a standalone fashion throughout the book she outlines methods that enable critical rationalism while avoiding excessive anchoring to logical deductions derived from faulty premises like spock rather than a prescribed and specific way of thinking emthe scout mindset emarticulates the importance of attitude a default stance founded on humility and provisionality not often associated with some of the more naive and overly enthusiastic exponents of rationalityppgalef is a 38year old columbia universitytrained statistician and she is wellpositioned to write a book instructing others how to think reason and derive conclusions she was the first president of the center for applied rationality and to this day hosts the popular ema hrefhttprationallyspeakingpodcastorgrationally speakinga empodcast a longtime resident of the bay area until recently galef is someone ive known socially in a casual manner for nearly a decade and two years ago she a hrefhttprationallyspeakingpodcastorg238stuffivebeenwrongaboutrazibkhaninvited me onto her podcasta to discuss various things id got wrong if there is one thing id want readers of emthe scout mindset emto understand it is that galef and her social milieu of bayarea rationalists prize epistemic humility as a means of distinguishing right from wrong it is not uncommon for me to witness an exchange between two rationalists that hinges on the sentence you are wrong and i am right and here is why whereas awkwardness and conflict might ensue in most milieus among rationalists this is an earnest opening to a deep investigation of how and why two individuals differed by the end one interlocutor will often have cheerfully revised their opinionppif this sounds bizarre it is because most human behavior is the outcome of a default state that galef terms the soldier mindset according to which a person is deeply attached to their views and will defend them against all comers in the soldier mindset being wrong is not an opportunity to learn and refine ones positions but an emotionally traumatic admission to be avoided at all costs for my money the soldier mindset actually deserves a more banal and inclusive label the human mindset if the scout mindset turns the human brain into an idealized informationprocessing device computing inferences and absorbing new data the soldier mindset comes preloaded with a few useful programs that are used over and over again though galefem empushes gently against the proposition that humans are naturally irrational it is hard to deny the universality of the soldier mindset that its the default human state indicates that it has not always been beneficial for humans to utilize the scout mindset in the pastppthis is not to say that our forager ancestors did not find aspects of the scout mindset useful otherwise it wouldnt exist among modern humans our lineage of emhomo sapiensem was the first to push into australia and the new world indicating a certain flexibility and openness lacking in our neanderthal cousins but the ubiquity of the soldier mindset across all societies shows that extreme openness and flexibility were the exceptions rather than the rule from the viewpoint of cultural evolution this may actually be optimal in a world where technology changed very slowly and the seasonal cycle repeated endlessly it was logical that humans would assimilate traditional wisdom by rote rather than attempting to learn everything anew risking grave errors the challenges an individual faced would be the same as those faced by their grandparents and their greatgreatgreatgrandparents in our present time it is sometimes hard to remember just how slowly our societies once evolved the magdalenian culture famous for its glorious cave art during the ice age flourished between 17000 and 12000 years ago the 5000 years of this cultures existence would be the equivalent of a society spanning predynastic egypt to the present day for the vast majority of emhomo sapiensemem emexistence over the last 300000 years we were soldiers marching to the tune of our ancestors because their ways had earned them descendants that survived into the next generation right or wrong their instincts were adaptiveppthe problem in 2021 is that technological and cultural change is now so rapid that these instincts seem totally inadequate to the moment contemporary tweens dont even remember an era before the smartphone the wisdom of the eldersby which i mean older zoomersis lost on them it may seem like a whimsical example but this problem characterizes the whole modern era as technological and cultural revolutions have roiled societies transforming them from generation to generation the wisdom of our elders is far less valuable than it was in the past because our grandparents experience of courting during school dances seems quaint and irrelevant in the world of tinderppnevertheless the default settings of the soldier mindset remain with us this means that in a world of protean change and surprising disruptions we dont adapt in a critically rational manner but simply reinterpret the sensory input with our naive intuitions and impulses if the soldier mindset was adaptive on the timescale of millennia the scout mindset is necessary for us to constantly pivot and update in an age when young people dont even remember what a hrefhttpswwwamazoncomexecobidosasin0312199341geneexpressio20netscape timea meant in the 1990s as new startups increased the metabolic rate of cultural change by orders of magnitudeppgalef is perfectly aware of the cultural currents of our age and makes the case for her form of rationality as an antidote to some of the panics and manias she sees around us the last section of emthe scout mindset emis titled rethinking identity and here she contends that strong racial religious and ideological affinities are a barrier to clear thinking the massive cultural changes of the last generation have resulted in a resurgence of human tribalism on a scale that would have left our ancestors aghast whereas pleistocene humans likely had clans that persisted for generations and tribes that lasted for hundreds of years today the identities of young people can change by gender and even a hrefhttpsenwikipediaorgwikiotherkinspeciesa within just a few years and while this may seem farcical many americans now take such fluidity very seriously in contrast to the scout mindset these cultural innovations are invested with deep emotional attachment and brook no rational inquiry they are matters of pure feeling defended with the psychological armamentarium of the paleolithic soldier mindset to question someones identity is akin to psychic violenceppin contrast emthe scout mindset emis trying to resurrect a spirit of inquiry and a set of aspirations that flourished more than a decade ago instantiated in the new atheism which gave rise to the skeptic movement and the rationalist community that still coalesces online around figures like scott alexander and eliezer yudkowsky but in the process galef is updating rationalism and smoothing out some of its rougher edges the scout mindset means replacing militant atheism with a more cautious and nonjudgemental initial stance on matters of religion epitomized in an example galef recounts of a close friendship between the atheist journalist kelsey piper of emvoxem and jen a roman catholic woman piper is prochoice on the question of abortion but her openness to differing views means that she now understands the prolife position far better than she did to the point of having sympathy for some of its arguments where much of the new atheist movement has been absorbed into the culturally left socialjustice rubric emthe scout mindset emhighlights individuals and groups with similar origins who have now moved to idiosyncratic positions like effective altruism which synthesizes a commitment to human wellbeing and flourishing with a rational thought process aimed at achieving hard results rather than stopping at emotional rallying criesppthe scout mindset however does not set aside emotion galef offers an unflattering portrayal of spock because he doesnt seem to have used logic very wellhe was overconfident and refused to reevaluate the reliability of his powers of deduction a passion for human wellbeing has to be paired with a rich and vibrant emotional life the sort of life that spock dismissed as without value david humes dictum that reason is a slave to the passions seems to be empirically correct and galef doesnt dispute this reality rather she outlines how best to understand the world as it is rather than how we wish it to be and argues that this allows us to achieve our goals and dreams more fullyppand yet emthe scout mindsetem is destined to find only a small audience because of the constraints of human nature chapters focusing on selfdeception learning to be wrong and escaping echo chambers find galef taking aim at cognitive biases which muddle and cloud our thinking it is clear that her prescriptions would result in greater epistemological hygiene and a world in which humans are typified by clearer thinking and an ability to achieve their aims more fully but just like children who have better things to do than eat their vegetables i do wonder how many will opt to receive her message of selfimprovement ppdespite its clarity and the sensitivity of galefs manner it is hard for me to imagine the average person walking away from her book reformed the readers upon whom galefs work is likely to have the greatest impact are those who already aspire toward rationality and have some familiarity with topics such as the a hrefhttpsenwikipediaorgwikiheuristics_in_judgment_and_decisionmaking23textthis2520research252c2520called2520the2520heuristicsbeen2520refined2520over2520time252c2520thisheuristics and biases programa of daniel kahneman and amos tversky emthe scout mindsetem is an excellent exposition of a clear and rational way of thinking reshaped and improved by wisdom accumulated in the wake of the early 2010s replication crisis but the empirical reality is that any given army will have only a few intrepid scoutsthe vast majority will always be plodding soldiersp | img altthe scout mindseta review srchttpss3amazonawscomprodstaticcontentquillettecom202111scoutmindset1pngpppstronga review ema hrefhttpsamznto3f3bbpqthe scout mindset people things clearly donta emby julia galefem emportfolio 288 pages april 2021strongppjulia galefs ema hrefhttpsamznto3f3bbpqthe scout mindset people things clearly dontaem brisk introduction particular way thinking world place era habits mind called critical rationalism given emstar trek emcharacter spock features narrative forgiven wondering book promoting spock mindset vulcans adherence logic worldfamous emthe scout mindset emactually shows spocks logical deductions led error galef arrived conclusion actually watching television comparing spocks predictions outcomes words went collected evidence galef empirical scout tabulating tracking seasons simply passive observer absorbing episode standalone fashion book outlines methods enable critical rationalism avoiding excessive anchoring logical deductions derived faulty premises like spock prescribed specific way thinking emthe scout mindset emarticulates importance attitude default stance founded humility provisionality associated naive overly enthusiastic exponents rationalityppgalef 38year old columbia universitytrained statistician wellpositioned write book instructing think reason derive conclusions president center applied rationality day hosts popular ema hrefhttprationallyspeakingpodcastorgrationally speakinga empodcast longtime resident bay area recently galef ive known socially casual manner nearly decade years ago hrefhttprationallyspeakingpodcastorg238stuffivebeenwrongaboutrazibkhaninvited podcasta discuss things id got wrong thing id want readers emthe scout mindset emto understand galef social milieu bayarea rationalists prize epistemic humility means distinguishing right wrong uncommon witness exchange rationalists hinges sentence wrong right awkwardness conflict ensue milieus rationalists earnest opening deep investigation individuals differed end interlocutor cheerfully revised opinionppif sounds bizarre human behavior outcome default state galef terms soldier mindset according person deeply attached views defend comers soldier mindset wrong opportunity learn refine ones positions emotionally traumatic admission avoided costs money soldier mindset actually deserves banal inclusive label human mindset scout mindset turns human brain idealized informationprocessing device computing inferences absorbing new data soldier mindset comes preloaded useful programs galefem empushes gently proposition humans naturally irrational hard deny universality soldier mindset default human state indicates beneficial humans utilize scout mindset pastppthis forager ancestors find aspects scout mindset useful wouldnt exist modern humans lineage emhomo sapiensem push australia new world indicating certain flexibility openness lacking neanderthal cousins ubiquity soldier mindset societies shows extreme openness flexibility exceptions rule viewpoint cultural evolution actually optimal world technology changed slowly seasonal cycle repeated endlessly logical humans assimilate traditional wisdom rote attempting learn anew risking grave errors challenges individual faced faced grandparents greatgreatgreatgrandparents present time hard remember slowly societies evolved magdalenian culture famous glorious cave art ice age flourished 17000 12000 years ago 5000 years cultures existence equivalent society spanning predynastic egypt present day vast majority emhomo sapiensemem emexistence 300000 years soldiers marching tune ancestors ways earned descendants survived generation right wrong instincts adaptiveppthe problem 2021 technological cultural change rapid instincts totally inadequate moment contemporary tweens dont remember era smartphone wisdom eldersby mean older zoomersis lost like whimsical example problem characterizes modern era technological cultural revolutions roiled societies transforming generation generation wisdom elders far valuable past grandparents experience courting school dances quaint irrelevant world tinderppnevertheless default settings soldier mindset remain means world protean change surprising disruptions dont adapt critically rational manner simply reinterpret sensory input naive intuitions impulses soldier mindset adaptive timescale millennia scout mindset necessary constantly pivot update age young people dont remember hrefhttpswwwamazoncomexecobidosasin0312199341geneexpressio20netscape timea meant 1990s new startups increased metabolic rate cultural change orders magnitudeppgalef perfectly aware cultural currents age makes case form rationality antidote panics manias sees section emthe scout mindset emis titled rethinking identity contends strong racial religious ideological affinities barrier clear thinking massive cultural changes generation resulted resurgence human tribalism scale left ancestors aghast pleistocene humans likely clans persisted generations tribes lasted hundreds years today identities young people change gender hrefhttpsenwikipediaorgwikiotherkinspeciesa years farcical americans fluidity seriously contrast scout mindset cultural innovations invested deep emotional attachment brook rational inquiry matters pure feeling defended psychological armamentarium paleolithic soldier mindset question someones identity akin psychic violenceppin contrast emthe scout mindset emis trying resurrect spirit inquiry set aspirations flourished decade ago instantiated new atheism gave rise skeptic movement rationalist community coalesces online figures like scott alexander eliezer yudkowsky process galef updating rationalism smoothing rougher edges scout mindset means replacing militant atheism cautious nonjudgemental initial stance matters religion epitomized example galef recounts close friendship atheist journalist kelsey piper emvoxem jen roman catholic woman piper prochoice question abortion openness differing views means understands prolife position far better point having sympathy arguments new atheist movement absorbed culturally left socialjustice rubric emthe scout mindset emhighlights individuals groups similar origins moved idiosyncratic positions like effective altruism synthesizes commitment human wellbeing flourishing rational thought process aimed achieving hard results stopping emotional rallying criesppthe scout mindset set aside emotion galef offers unflattering portrayal spock doesnt logic wellhe overconfident refused reevaluate reliability powers deduction passion human wellbeing paired rich vibrant emotional life sort life spock dismissed value david humes dictum reason slave passions empirically correct galef doesnt dispute reality outlines best understand world wish argues allows achieve goals dreams fullyppand emthe scout mindsetem destined find small audience constraints human nature chapters focusing selfdeception learning wrong escaping echo chambers find galef taking aim cognitive biases muddle cloud thinking clear prescriptions result greater epistemological hygiene world humans typified clearer thinking ability achieve aims fully like children better things eat vegetables wonder opt receive message selfimprovement ppdespite clarity sensitivity galefs manner hard imagine average person walking away book reformed readers galefs work likely greatest impact aspire rationality familiarity topics hrefhttpsenwikipediaorgwikiheuristics_in_judgment_and_decisionmaking23textthis2520research252c2520called2520the2520heuristicsbeen2520refined2520over2520time252c2520thisheuristics biases programa daniel kahneman amos tversky emthe scout mindsetem excellent exposition clear rational way thinking reshaped improved wisdom accumulated wake early 2010s replication crisis empirical reality given army intrepid scoutsthe vast majority plodding soldiersp |
618c4adbe619af73ac736a36 | How Covid despots humiliated America | pa year after bidens election the question of whether anyone really intended to destroy democratic republicanism in the united states is now moot fortysix years ago a headline in new yorks emdaily newsem read ford to city drop dead today the biden administration and its legion of corporate media and big tech allies communicate the same message to the american people so consistently and so pointedly that one can only conclude the humiliation of the electorate is a matter of policy the administrations undeniable incompetence fresh evidence of which is forthcoming every day as it squabbles over vaccine mandates and fails to address multiple crises of supply inflation and illegal immigration both masks and serves its managerial method not least because the multiplication of crises furnishes a pretext for ever greater extensions of governmental controlp
pi am reminded of a trip through eastern europe that my wife and i took in 1981 in yugoslavia one day we planned to catch a bus in the late morning the bus and driver were there but the departure time came and went after an hour we knocked on the station window and the two or three functionaries behind the glass barely glanced up from their hardboiled eggs and sandwiches the other passengers remained uniformly inert neither requesting nor receiving any explanation for what turned into a twohour delay it would take years of small humiliations to make a formerly free people this compliant but that seems to be the goal of the vast coalition of governmental corporate academic cultural philanthropic and media powers that has just now fused and hardened right before our eyes into an ominous social monsterp
divdiv
pthere is a common playbook for technocratic control of recalcitrant populations the biden administration employs the same siege tactics of declared exigency deception division and intimidation that corporatist progressives used a relnoopener hrefhttpswwwcityjournalorguniversityoftulsa target_blankto destroya my former university tulsa two years agop
pafter a leftwing billionaire engineered a a relnoopener hrefhttpswwwthenationcomarticlearchivehighereducationcorporatetakeoverkaiseruniversityoftulsa target_blankhostile takeovera of the institution it was announced that we faced serious crises of finance and accreditation faculty were subjected to mandatory training sessions and a blizzard of futile paperwork the supposedly datadriven administration ignored or manipulated information that conflicted with their hidden purposes while preparing a comprehensive academic review of our department i learned that the provost had already received the program review committees recommendation that our majors in philosophy and religion be eliminatedp
pthe general idea was to overwhelm and exhaust potential opponents of the universitys plan to gut the liberal arts surprised by strong pushback the administration stirred up staff animosity against faculty critics of the restructuring who were publicly vilified monitored and in some cases including my own subjected to costly and timeconsuming disciplinary actionsp
pi neednt belabour the obvious comparisons with the current state of our american union which has suffered its own hostile takeover i note rather that the logic of 21stcentury technocratic despotism was spelled out long ago in platos republic in that dialogue a class of selfstyled experts the philosopherkings and their academicallytrained ministers considers its exclusive claim to a science of politics as a title to rule contemptuous of what they regard as the ignorant many they treat their fellow citizens as subjects to be manipulated and for reasons matthew crawford suggested in his essay on the new public health despotismp
diva hrefhttpsunherdcom202110thenewcoviddespotismrefinnara hrefhttpsunherdcom202110thenewcoviddespotismrefinnarimg srchttpsunherdcomwpcontentuploads2021102gettyimages1219201731scaled1300x169jpgadiva hrefhttpsunherdcom202110thenewcoviddespotismrefinnarspansuggested readingspanaa hrefhttpsunherdcom202110thenewcoviddespotismrefinnarh5the new public health despotismh5apa hrefhttpsunherdcom202110thenewcoviddespotismrefinnarspanbyspan matthew crawfordapdivadiv
pthey do so first because persuasion takes time and effort and is less efficient than other available methods for achieving the desired results in a democratic republic this is a fundamental corruption of power second because the notion that governance is an applied science or techne encourages the idea that human beings are basically raw materials to be shaped and stamped like blanks at the denver mint left unchecked the states fundamentally idolatrous desire to coin young souls exclusively in its own image leads to the destruction of the family the attorney generals attempt effectively to criminalise parental veto over public school curricula is a step in this direction and third because technocratic elites are inclined to regard the unsophisticated many as cognitively impaired in the beautiful city of the republic the rulers medicinal lies are justified on the ground that one wouldnt give weapons to madmen just so dr faucis supposedly a relnoopener hrefhttpsslatecomtechnology202107nobleliescovidfaucicdcmaskshtml target_blanknoble liesa about covid presuppose that americans are too sick to be entrusted with the truthp
pit is hard to exaggerate the extent to which the therapeutic idiom of bureaucracies has taken hold in united states here again the university of tulsa was ahead of the curve having installed a safespace affirming psychiatrist as president in 2016 it is no coincidence that expressions of the manly confidence candor and masculine independence of opinion that tocqueville saw as essential to the health of a democratic republic are increasingly likely to be condemned as toxic a term that tries to square the circle by implying that the problem is simultaneously one of social disease and moral depravity but this is yesterdays newsp
ptyrants have always attacked the political immune system of the people fearing spirited assertions of free thought ancient greek ones were known to close gymnasiums and ban philosophical discussion at that time medicine was unsophisticated and the psychiatric imprisonment of political opponents was not yet possible things have not gone so far in our country but the identification of unorthodox speech and even of silence with violence itself a symptom of a contagious political madness serves the same purposep
diva hrefhttpsunherdcom202109isthisproofofalableakcoveruprefinnara hrefhttpsunherdcom202109isthisproofofalableakcoveruprefinnarimg srchttpsunherdcomwpcontentuploads202109gettyimages12309099121scalede16312069928901300x169jpgadiva hrefhttpsunherdcom202109isthisproofofalableakcoveruprefinnarspansuggested readingspanaa hrefhttpsunherdcom202109isthisproofofalableakcoveruprefinnarh5is this proof of lab leak liesh5apa hrefhttpsunherdcom202109isthisproofofalableakcoveruprefinnarspanbyspan ian birrellapdivadiv
psuch tactics may be effective in the short term but progressivist technocratic despotism is disastrous as a longterm political strategy in the united states it will either be decisively repudiated or do great and perhaps irreparable harm to the country for it betrays a fundamental ignorance not only of what one might call the physics of democratic republicanism but of the unique nature of the american political experimentp
pplato again illuminates matters in the republic socrates compares individual souls and political communities to spinning tops this is a rich and suggestive image those shortlived wanderers we played with as children setting them in motion like little gods had a lifespan that depended on the rotational impetus imparted by a snap of fingers or string encountering irregularities on the hardwood floor they would wobble and sometimes fall we cheered when they righted themselves and continued to roam as they often did children instinctively understand the allegorical character of such gamesp
pa top that does not lean in any direction as happens only at maximum energy is platos image of the healthy soul and city such vital rectitude which the romans called emreligioem was traditionally formed by social ligaments of ancestral custom and habit that constrained the wild impulses of the young and made them straighten up balancing their characters and aligning them with the ancestors below and the gods above the ancients understood that moral alignment with traditional and transcendent norms optimises the energy of the human organism in a way that is essential for navigation lives tend to drift and fall apart without itp
diva hrefhttpsunherdcom202006covidhasexposedamericaasafailedstaterefinnara hrefhttpsunherdcom202006covidhasexposedamericaasafailedstaterefinnarimg srchttpsunherdcomwpcontentuploads202005gettyimages1235424618300x209jpgadiva hrefhttpsunherdcom202006covidhasexposedamericaasafailedstaterefinnarspansuggested readingspanaa hrefhttpsunherdcom202006covidhasexposedamericaasafailedstaterefinnarh5covid has exposed america as a failed stateh5apa hrefhttpsunherdcom202006covidhasexposedamericaasafailedstaterefinnarspanbyspan aris roussinosapdivadiv
pbut punitive doctrinal correctness is no substitute for the basically healthy mores that have long kept the american polity from falling over our governing elites fail to understand that courage and moderation are the true and steady foundations of prudent policy the good kind of political correctness that the greeks called emorth doxaem upright opinion that furnishes sound premises for political deliberation is rooted in these virtues and cannot be produced by the moral orthopedics of the propaganda state the forceful imposition of woke political orthodoxy on the american public can only breed resentment and promote hypocrisyp
pwhile energy is imparted externally to a spinning top a republic is renewed from within by the exertions of its citizens but even wellfounded ones eventually fall off kilter decline may begin gradually with minute oscillations or suddenly through some external blow but it always terminates in wild gyrations most often decay results when internal forces move large numbers of citizens and impede the motions of many others in ways that throw the whole out of balancep
pthe chafing humiliations of the covid police are just part of a surge of social friction that was gestating for years and exploded with the election of president trump five years ago strong political passions multiplied amplified and frequently concentrated on specific targets by corporate media and big tech have destabilised our essential public and private institutions virtually all of which through some demonic oedipal fatality now seem intent on repudiating their founding principles and betraying their core missionsp
diva hrefhttpsunherdcom202105howsciencehasbeencorruptedrefinnara hrefhttpsunherdcom202105howsciencehasbeencorruptedrefinnarimg srchttpsunherdcomwpcontentuploads202105gettyimages1211656392594x5941300x194jpgadiva hrefhttpsunherdcom202105howsciencehasbeencorruptedrefinnarspansuggested readingspanaa hrefhttpsunherdcom202105howsciencehasbeencorruptedrefinnarh5how science has been corruptedh5apa hrefhttpsunherdcom202105howsciencehasbeencorruptedrefinnarspanbyspan matthew crawfordapdivadiv
psome of those who by reason of experience and accumulated wisdom might still be capable of righting these institutions have been purged the rest have mostly retired or retreated under fire withdrawing much good and necessary energy from our common national life depleted and uncharacteristically depressed the american people now spin and shudder along the edge of the abyss what future awaits us if we forget how to live and work together in amity and if emptied of honest debate on matters of pressing concern the public square echoes with blood curdling war criesp
pi have become convinced that a particular deficit of historical memory lies at the root of all our ills i think there will be no cure for what ails us unless we can recover the answer to one big question what is america for what are we about as a nation lincoln taught at gettysburg that the united states was conceived in liberty and dedicated to the proposition that all men are created equal the twin pillars of our american story are ordered liberty and individual dignityp
pours is a unique experiment in mature selfgovernance testing whether a nation of citizens who are free and equal under the law and therefore free to make mistakes to be wrong or right in their own ways and to stand or fall as they will under the hammer of experience can long endure this experiment involves considerable risk as tocqueville repeatedly reminds us every one of our political institutions and practices balances goods against evils but even when faced with the gravest political exigencies our forefathers reckoned that the rewards of participation in the story of america were too precious to forgop
pthis question of risk goes to a relnoopener hrefhttpsunherdcom202110thenewcoviddespotism target_blankthe heart of the problem crawford raiseda failure to comply with covid regulations is presumed to be irrational because it exposes the populous to unnecessary dangers but risk is always relative to possible outcomes which today are seen darkly through a glass of psychological and physical safetyism to take a real example does the possibility that a student might suffer psychic injury from a book spine justify removing a volume entitled american negro poetry from a high school library but what sort of injury are we talking about and how does it compare to the possibility that a student will never hear langston hughes sing america or speak of rivers or dream a world where every man is free and above all who has the right to decide these mattersp
pour technocratic mandarins dislike such questions and recoil from the political uncertainties of democratic debate whatever its psychological causes their longing for certainty in practice leads them to insist on it in theory and so to end debate by any means necessary this is an engine of comprehensive despotism because it can be satisfied only with the advent of univocal global answersp
pthe best outcome we could hope for if we continue down this road is what tocqueville calls the type of social wellbeing that can be provided by a very centralised administration to the people who submit to it travelers tell us he writes that the chinese have tranquility without happiness industry without progress stability without strength physical order without public morality i imagine that when china opens to europeans the latter will find there the most beautiful model of administrative centralization that exists in the universep
a hrefhttpsunherdcom202111thehumiliationofamericaappcommentsview 9 commentsa | pa year bidens election question intended destroy democratic republicanism united states moot fortysix years ago headline new yorks emdaily newsem read ford city drop dead today biden administration legion corporate media big tech allies communicate message american people consistently pointedly conclude humiliation electorate matter policy administrations undeniable incompetence fresh evidence forthcoming day squabbles vaccine mandates fails address multiple crises supply inflation illegal immigration masks serves managerial method multiplication crises furnishes pretext greater extensions governmental controlp pi reminded trip eastern europe wife took 1981 yugoslavia day planned catch bus late morning bus driver departure time came went hour knocked station window functionaries glass barely glanced hardboiled eggs sandwiches passengers remained uniformly inert requesting receiving explanation turned twohour delay years small humiliations free people compliant goal vast coalition governmental corporate academic cultural philanthropic media powers fused hardened right eyes ominous social monsterp divdiv pthere common playbook technocratic control recalcitrant populations biden administration employs siege tactics declared exigency deception division intimidation corporatist progressives relnoopener hrefhttpswwwcityjournalorguniversityoftulsa target_blankto destroya university tulsa years agop pafter leftwing billionaire engineered relnoopener hrefhttpswwwthenationcomarticlearchivehighereducationcorporatetakeoverkaiseruniversityoftulsa target_blankhostile takeovera institution announced faced crises finance accreditation faculty subjected mandatory training sessions blizzard futile paperwork supposedly datadriven administration ignored manipulated information conflicted hidden purposes preparing comprehensive academic review department learned provost received program review committees recommendation majors philosophy religion eliminatedp pthe general idea overwhelm exhaust potential opponents universitys plan gut liberal arts surprised strong pushback administration stirred staff animosity faculty critics restructuring publicly vilified monitored cases including subjected costly timeconsuming disciplinary actionsp pi neednt belabour obvious comparisons current state american union suffered hostile takeover note logic 21stcentury technocratic despotism spelled long ago platos republic dialogue class selfstyled experts philosopherkings academicallytrained ministers considers exclusive claim science politics title rule contemptuous regard ignorant treat fellow citizens subjects manipulated reasons matthew crawford suggested essay new public health despotismp diva hrefhttpsunherdcom202110thenewcoviddespotismrefinnara hrefhttpsunherdcom202110thenewcoviddespotismrefinnarimg srchttpsunherdcomwpcontentuploads2021102gettyimages1219201731scaled1300x169jpgadiva hrefhttpsunherdcom202110thenewcoviddespotismrefinnarspansuggested readingspanaa hrefhttpsunherdcom202110thenewcoviddespotismrefinnarh5the new public health despotismh5apa hrefhttpsunherdcom202110thenewcoviddespotismrefinnarspanbyspan matthew crawfordapdivadiv pthey persuasion takes time effort efficient available methods achieving desired results democratic republic fundamental corruption power second notion governance applied science techne encourages idea human beings basically raw materials shaped stamped like blanks denver mint left unchecked states fundamentally idolatrous desire coin young souls exclusively image leads destruction family attorney generals attempt effectively criminalise parental veto public school curricula step direction technocratic elites inclined regard unsophisticated cognitively impaired beautiful city republic rulers medicinal lies justified ground wouldnt weapons madmen dr faucis supposedly relnoopener hrefhttpsslatecomtechnology202107nobleliescovidfaucicdcmaskshtml target_blanknoble liesa covid presuppose americans sick entrusted truthp pit hard exaggerate extent therapeutic idiom bureaucracies taken hold united states university tulsa ahead curve having installed safespace affirming psychiatrist president 2016 coincidence expressions manly confidence candor masculine independence opinion tocqueville saw essential health democratic republic increasingly likely condemned toxic term tries square circle implying problem simultaneously social disease moral depravity yesterdays newsp ptyrants attacked political immune system people fearing spirited assertions free thought ancient greek ones known close gymnasiums ban philosophical discussion time medicine unsophisticated psychiatric imprisonment political opponents possible things gone far country identification unorthodox speech silence violence symptom contagious political madness serves purposep diva hrefhttpsunherdcom202109isthisproofofalableakcoveruprefinnara hrefhttpsunherdcom202109isthisproofofalableakcoveruprefinnarimg srchttpsunherdcomwpcontentuploads202109gettyimages12309099121scalede16312069928901300x169jpgadiva hrefhttpsunherdcom202109isthisproofofalableakcoveruprefinnarspansuggested readingspanaa hrefhttpsunherdcom202109isthisproofofalableakcoveruprefinnarh5is proof lab leak liesh5apa hrefhttpsunherdcom202109isthisproofofalableakcoveruprefinnarspanbyspan ian birrellapdivadiv psuch tactics effective short term progressivist technocratic despotism disastrous longterm political strategy united states decisively repudiated great irreparable harm country betrays fundamental ignorance physics democratic republicanism unique nature american political experimentp pplato illuminates matters republic socrates compares individual souls political communities spinning tops rich suggestive image shortlived wanderers played children setting motion like little gods lifespan depended rotational impetus imparted snap fingers string encountering irregularities hardwood floor wobble fall cheered righted continued roam children instinctively understand allegorical character gamesp pa lean direction happens maximum energy platos image healthy soul city vital rectitude romans called emreligioem traditionally formed social ligaments ancestral custom habit constrained wild impulses young straighten balancing characters aligning ancestors gods ancients understood moral alignment traditional transcendent norms optimises energy human organism way essential navigation lives tend drift fall apart itp diva hrefhttpsunherdcom202006covidhasexposedamericaasafailedstaterefinnara hrefhttpsunherdcom202006covidhasexposedamericaasafailedstaterefinnarimg srchttpsunherdcomwpcontentuploads202005gettyimages1235424618300x209jpgadiva hrefhttpsunherdcom202006covidhasexposedamericaasafailedstaterefinnarspansuggested readingspanaa hrefhttpsunherdcom202006covidhasexposedamericaasafailedstaterefinnarh5covid exposed america failed stateh5apa hrefhttpsunherdcom202006covidhasexposedamericaasafailedstaterefinnarspanbyspan aris roussinosapdivadiv pbut punitive doctrinal correctness substitute basically healthy mores long kept american polity falling governing elites fail understand courage moderation true steady foundations prudent policy good kind political correctness greeks called emorth doxaem upright opinion furnishes sound premises political deliberation rooted virtues produced moral orthopedics propaganda state forceful imposition woke political orthodoxy american public breed resentment promote hypocrisyp pwhile energy imparted externally spinning republic renewed exertions citizens wellfounded ones eventually fall kilter decline begin gradually minute oscillations suddenly external blow terminates wild gyrations decay results internal forces large numbers citizens impede motions ways throw balancep pthe chafing humiliations covid police surge social friction gestating years exploded election president trump years ago strong political passions multiplied amplified frequently concentrated specific targets corporate media big tech destabilised essential public private institutions virtually demonic oedipal fatality intent repudiating founding principles betraying core missionsp diva hrefhttpsunherdcom202105howsciencehasbeencorruptedrefinnara hrefhttpsunherdcom202105howsciencehasbeencorruptedrefinnarimg srchttpsunherdcomwpcontentuploads202105gettyimages1211656392594x5941300x194jpgadiva hrefhttpsunherdcom202105howsciencehasbeencorruptedrefinnarspansuggested readingspanaa hrefhttpsunherdcom202105howsciencehasbeencorruptedrefinnarh5how science corruptedh5apa hrefhttpsunherdcom202105howsciencehasbeencorruptedrefinnarspanbyspan matthew crawfordapdivadiv psome reason experience accumulated wisdom capable righting institutions purged rest retired retreated fire withdrawing good necessary energy common national life depleted uncharacteristically depressed american people spin shudder edge abyss future awaits forget live work amity emptied honest debate matters pressing concern public square echoes blood curdling war criesp pi convinced particular deficit historical memory lies root ills think cure ails recover answer big question america nation lincoln taught gettysburg united states conceived liberty dedicated proposition men created equal twin pillars american story ordered liberty individual dignityp pours unique experiment mature selfgovernance testing nation citizens free equal law free mistakes wrong right ways stand fall hammer experience long endure experiment involves considerable risk tocqueville repeatedly reminds political institutions practices balances goods evils faced gravest political exigencies forefathers reckoned rewards participation story america precious forgop pthis question risk goes relnoopener hrefhttpsunherdcom202110thenewcoviddespotism target_blankthe heart problem crawford raiseda failure comply covid regulations presumed irrational exposes populous unnecessary dangers risk relative possible outcomes today seen darkly glass psychological physical safetyism real example possibility student suffer psychic injury book spine justify removing volume entitled american negro poetry high school library sort injury talking compare possibility student hear langston hughes sing america speak rivers dream world man free right decide mattersp pour technocratic mandarins dislike questions recoil political uncertainties democratic debate psychological causes longing certainty practice leads insist theory end debate means necessary engine comprehensive despotism satisfied advent univocal global answersp pthe best outcome hope continue road tocqueville calls type social wellbeing provided centralised administration people submit travelers tell writes chinese tranquility happiness industry progress stability strength physical order public morality imagine china opens europeans find beautiful model administrative centralization exists universep hrefhttpsunherdcom202111thehumiliationofamericaappcommentsview 9 commentsa |
618d9be186f8e2d9329d11e8 | American education needs a revolution | pperhaps i was nave but when brandeis university offered me an honorary degree in 2014 i accepted it in good faith brandeiss motto after all is truth even unto its innermost parts yet what followed proved the very opposite that at brandeis the innermost parts of truth dont countp
pafter a bit of encouragement from my usual critics the council of islamic relations followed by a petition from a motley array of faculty members brandeis rescinded their offer frederick lawrence who was then the universitys president rang me just hours before the university issued a public statementp
pat the time i dismissed it as a oneoff incident an anomaly that could simply be brushed off how wrong i was that same year a group of muslim students tried to cancel my study group on the political theory of islam at harvard universitys belfer center for science and international affairs part of the kennedy school first they complained to the universitys administration when that didnt work they sent a letter to the funders of the harvard kennedy schools middle east initiative then they suggested that i should install an imam in my class to counter my arguments unlike at brandeis the university authorities didnt capitulatep
divdiv
pin both incidents the challenge to academic freedom and free speech was posed by islamists but that didnt disturb me as an apostate who has spent many years criticising them and received death threats in return i was used to their antipathyp
pfast forward to 2021 however and it seems i was wrong to dismiss this censorious attitude as an islamist impulse hardly a week goes by a relnoopener hrefhttpswwwinsidehigheredcomnews20210831firelaunchesnewdatabasetrackingattacksspeech target_blankwithout reportsa of a professor being protested disciplined and sometimes fired for violating the new and stringent norms of academic discourse we read of scholars such as a relnoopener hrefhttpsunherdcom202111kathleenstockiwontbesilenced target_blankkathleen stocka being driven to resign from their positions after constant hounding and threats we read of a a relnoopener hrefhttpsbariweisssubstackcompmitabandonsitsmissionandme target_blanklecturera being noplatformed for daring to suggest that evaluations should be based on academic merit we read of a native american student being forced to apologise by a yale university diversity tsar for making a a relnoopener hrefhttpswwwdailymailcouknewsarticle10089259yalelawstudentpressuredapologizeusingphrasetraphousehtml target_blankharmless jokea in an emailp
diva hrefhttpsunherdcom202110criticalracetheorysnewdisguiserefinnara hrefhttpsunherdcom202110criticalracetheorysnewdisguiserefinnarimg srchttpsunherdcomwpcontentuploads202110gettyimages124498909611300x169jpgadiva hrefhttpsunherdcom202110criticalracetheorysnewdisguiserefinnarspansuggested readingspanaa hrefhttpsunherdcom202110criticalracetheorysnewdisguiserefinnarh5critical race theorys new disguiseh5apa hrefhttpsunherdcom202110criticalracetheorysnewdisguiserefinnarspanbyspan ayaan hirsi aliapdivadiv
pand thats just in the past month we have reached a point where grace and forgiveness are extinct on american campuses where reputations built over decades can be destroyed in a week some people still describe the phenomenon as political correctness but this is much more like a a relnoopener hrefhttpswwwtheatlanticcommagazinearchive202110newpuritansmobjusticecanceled619818 target_blankreligious movementa its hardly surprising that the islamists opportunity to piggyback on existing illiberal and intolerant forces is now even greaterp
psocial justice critical race theory diversity equality and inclusion such terms are difficult to object to when taken at face value and as a consequence they have grown and spread like weeds in almost every institution by the time we recognised the deeply illiberal notions that lurked behind these bland phrases it was too late they had already taken over whole departments embedding their extensive roots into the fabric of academic institutionsp
pi didnt see this coming seven years ago i considered those who sounded the alarm to be engaged in histrionics but today it is impossible to deny that the alarmists were rightp
pafter the brandeis cancellation i published a relnoopener hrefhttpswwwwsjcomarticlessb10001424052702304512504579493410287663906 target_blankmy intended remarksa stating that we need to make our universities temples not of dogmatic orthodoxy but of truly critical thinking where all ideas are welcome and where civil debate is encouraged at the time i was hopeful yet every passing year free discourse increasingly became the exception in academic settingsp
pand while countless academics have been crucified for daring to speak out it is ultimately their students who have suffered most in this tragedy our education system is failing them rather than being a place of learning universities have transformed into a place of fear they demand safe spaces and a life free from all forms of aggressions micro and macro they graduate illprepared for the future no longer equipped with the critical skills needed to thrive in a society where safe spaces trigger warnings and preferred pronouns are not the norm their lives as students have been stripped of opportunities to overcome challenges and adversity to develop innerstrength and confidencep
diva hrefhttpsunherdcom202111didcriticalracetheorylosevirginiarefinnara hrefhttpsunherdcom202111didcriticalracetheorylosevirginiarefinnarimg srchttpsunherdcomwpcontentuploads202111gettyimages13509840581300x169jpgadiva hrefhttpsunherdcom202111didcriticalracetheorylosevirginiarefinnarspansuggested readingspanaa hrefhttpsunherdcom202111didcriticalracetheorylosevirginiarefinnarh5did critical race theory lose virginiah5apa hrefhttpsunherdcom202111didcriticalracetheorylosevirginiarefinnarspanbyspan joel kotkinapdivadiv
pfaced with such a toxic climate riddled with the weeds of intolerance one might think the solution is to simply give up but to do so is not only cowardly it ignores the fact that there is cause for optimism in the future there are seedlings sprouting that point to renewalp
pthis is partly because americas markets remain strong and reactive bringing supply to wherever there is demand the american market is hungry for a new approach to education demand is high for a university that delivers on academic freedom meritbased recruitment of students and is a safe space for people to learn and exchange ideas not imagined injuries and the supply is comingp
pthis week i joined an intellectually diverse and curious group of professors and scholars in launching the a relnoopener hrefhttpswwwuaustinorg target_blankuniversity of austina uatx it is an institution that stands above all for the pursuit of truth it will offer a rigorous liberal education from leading experts in their fields a place that will teach students how to think not what to think a place where they will be intellectually challenged and at times made to feel uncomfortablep
pprofessors will be able to explore ideas and topics that are taboo elsewhere without threats to their reputation livelihoods or wellbeing unlike nearly a relnoopener hrefhttpsfreebeaconcomcampusstudydiversitystatementsrequiredforonefifthofacademicjobs target_blanka fifth of universitiesa we will not require statements of commitment to diversity equity and inclusion all we are looking for is a commitment to emlearningem and that doesnt seem to be in short supply within 12 hours of announcing the university of austin a relnoopener hrefhttpstwittercomuaustinorgstatus1457831990418411527 target_blankmore than 900 academicsa submitted inquiries seeking a positionp
ptheir students once applications open will be accepted on the basis of merit based on an admissions exam the university states uatx will not arbitrarily factor in race gender class or any other form of identity into its decisions uatx stands firmly against that sort of discrimination in admissions of course none of this matters if spaces are only reserved for a wealthy elite so we are working on a financial model that will help lower tuition costs and provide scholarships or bursaries providing an equal opportunity for students regardless of their financial backgroundp
diva hrefhttpsunherdcom202111kathleenstockiwontbesilencedrefinnara hrefhttpsunherdcom202111kathleenstockiwontbesilencedrefinnarimg srchttpsunherdcomwpcontentuploads202111kathleen4e1636027060258300x146jpgadiva hrefhttpsunherdcom202111kathleenstockiwontbesilencedrefinnarspansuggested readingspanaa hrefhttpsunherdcom202111kathleenstockiwontbesilencedrefinnarh5kathleen stock i wont be silencedh5apa hrefhttpsunherdcom202111kathleenstockiwontbesilencedrefinnarspanbyspan julie bindelapdivadiv
pstarting a new university will no doubt be challenging but the truth is that this is only the beginning the first of many new educational institutions american parents all over the country are in revolt against the increasingly divisive educational opportunities available to their children witness the a relnoopener hrefhttpsunherdcom202111didcriticalracetheorylosevirginia target_blankresultsa of the virginian gubernatorial elections in the coming decade it is not inconceivable that the market will deliver new gradeschool opportunities for students as well as other new institutions of higher educationp
pthere are those who fear that the political extremes of the left and right may one day destroy the republic but the only way to destroy america is to destroy our market system as long as individuals have choice and the market selfcorrects we will continue to thrive where there is demand and the result in virginia prove there emisem demand the supply will followp
pthis is what the university of austin symbolises a new choice for all those disillusioned with the established institutions for too long we have looked on as universities have been disfigured blissfully unaware that all we needed to do was create our own lets hope this is the beginning of a new renaissancep
a hrefhttpsunherdcom202111americaneducationneedsarevolutionappcommentsview 5 commentsa | pperhaps nave brandeis university offered honorary degree 2014 accepted good faith brandeiss motto truth unto innermost parts followed proved opposite brandeis innermost parts truth dont countp pafter bit encouragement usual critics council islamic relations followed petition motley array faculty members brandeis rescinded offer frederick lawrence universitys president rang hours university issued public statementp pat time dismissed oneoff incident anomaly simply brushed wrong year group muslim students tried cancel study group political theory islam harvard universitys belfer center science international affairs kennedy school complained universitys administration didnt work sent letter funders harvard kennedy schools middle east initiative suggested install imam class counter arguments unlike brandeis university authorities didnt capitulatep divdiv pin incidents challenge academic freedom free speech posed islamists didnt disturb apostate spent years criticising received death threats return antipathyp pfast forward 2021 wrong dismiss censorious attitude islamist impulse hardly week goes relnoopener hrefhttpswwwinsidehigheredcomnews20210831firelaunchesnewdatabasetrackingattacksspeech target_blankwithout reportsa professor protested disciplined fired violating new stringent norms academic discourse read scholars relnoopener hrefhttpsunherdcom202111kathleenstockiwontbesilenced target_blankkathleen stocka driven resign positions constant hounding threats read relnoopener hrefhttpsbariweisssubstackcompmitabandonsitsmissionandme target_blanklecturera noplatformed daring suggest evaluations based academic merit read native american student forced apologise yale university diversity tsar making relnoopener hrefhttpswwwdailymailcouknewsarticle10089259yalelawstudentpressuredapologizeusingphrasetraphousehtml target_blankharmless jokea emailp diva hrefhttpsunherdcom202110criticalracetheorysnewdisguiserefinnara hrefhttpsunherdcom202110criticalracetheorysnewdisguiserefinnarimg srchttpsunherdcomwpcontentuploads202110gettyimages124498909611300x169jpgadiva hrefhttpsunherdcom202110criticalracetheorysnewdisguiserefinnarspansuggested readingspanaa hrefhttpsunherdcom202110criticalracetheorysnewdisguiserefinnarh5critical race theorys new disguiseh5apa hrefhttpsunherdcom202110criticalracetheorysnewdisguiserefinnarspanbyspan ayaan hirsi aliapdivadiv pand thats past month reached point grace forgiveness extinct american campuses reputations built decades destroyed week people describe phenomenon political correctness like relnoopener hrefhttpswwwtheatlanticcommagazinearchive202110newpuritansmobjusticecanceled619818 target_blankreligious movementa hardly surprising islamists opportunity piggyback existing illiberal intolerant forces greaterp psocial justice critical race theory diversity equality inclusion terms difficult object taken face value consequence grown spread like weeds institution time recognised deeply illiberal notions lurked bland phrases late taken departments embedding extensive roots fabric academic institutionsp pi didnt coming seven years ago considered sounded alarm engaged histrionics today impossible deny alarmists rightp pafter brandeis cancellation published relnoopener hrefhttpswwwwsjcomarticlessb10001424052702304512504579493410287663906 target_blankmy intended remarksa stating need universities temples dogmatic orthodoxy truly critical thinking ideas welcome civil debate encouraged time hopeful passing year free discourse increasingly exception academic settingsp pand countless academics crucified daring speak ultimately students suffered tragedy education system failing place learning universities transformed place fear demand safe spaces life free forms aggressions micro macro graduate illprepared future longer equipped critical skills needed thrive society safe spaces trigger warnings preferred pronouns norm lives students stripped opportunities overcome challenges adversity develop innerstrength confidencep diva hrefhttpsunherdcom202111didcriticalracetheorylosevirginiarefinnara hrefhttpsunherdcom202111didcriticalracetheorylosevirginiarefinnarimg srchttpsunherdcomwpcontentuploads202111gettyimages13509840581300x169jpgadiva hrefhttpsunherdcom202111didcriticalracetheorylosevirginiarefinnarspansuggested readingspanaa hrefhttpsunherdcom202111didcriticalracetheorylosevirginiarefinnarh5did critical race theory lose virginiah5apa hrefhttpsunherdcom202111didcriticalracetheorylosevirginiarefinnarspanbyspan joel kotkinapdivadiv pfaced toxic climate riddled weeds intolerance think solution simply cowardly ignores fact cause optimism future seedlings sprouting point renewalp pthis partly americas markets remain strong reactive bringing supply demand american market hungry new approach education demand high university delivers academic freedom meritbased recruitment students safe space people learn exchange ideas imagined injuries supply comingp pthis week joined intellectually diverse curious group professors scholars launching relnoopener hrefhttpswwwuaustinorg target_blankuniversity austina uatx institution stands pursuit truth offer rigorous liberal education leading experts fields place teach students think think place intellectually challenged times feel uncomfortablep pprofessors able explore ideas topics taboo threats reputation livelihoods wellbeing unlike nearly relnoopener hrefhttpsfreebeaconcomcampusstudydiversitystatementsrequiredforonefifthofacademicjobs target_blanka fifth universitiesa require statements commitment diversity equity inclusion looking commitment emlearningem doesnt short supply 12 hours announcing university austin relnoopener hrefhttpstwittercomuaustinorgstatus1457831990418411527 target_blankmore 900 academicsa submitted inquiries seeking positionp ptheir students applications open accepted basis merit based admissions exam university states uatx arbitrarily factor race gender class form identity decisions uatx stands firmly sort discrimination admissions course matters spaces reserved wealthy elite working financial model help lower tuition costs provide scholarships bursaries providing equal opportunity students regardless financial backgroundp diva hrefhttpsunherdcom202111kathleenstockiwontbesilencedrefinnara hrefhttpsunherdcom202111kathleenstockiwontbesilencedrefinnarimg srchttpsunherdcomwpcontentuploads202111kathleen4e1636027060258300x146jpgadiva hrefhttpsunherdcom202111kathleenstockiwontbesilencedrefinnarspansuggested readingspanaa hrefhttpsunherdcom202111kathleenstockiwontbesilencedrefinnarh5kathleen stock wont silencedh5apa hrefhttpsunherdcom202111kathleenstockiwontbesilencedrefinnarspanbyspan julie bindelapdivadiv pstarting new university doubt challenging truth beginning new educational institutions american parents country revolt increasingly divisive educational opportunities available children witness relnoopener hrefhttpsunherdcom202111didcriticalracetheorylosevirginia target_blankresultsa virginian gubernatorial elections coming decade inconceivable market deliver new gradeschool opportunities students new institutions higher educationp pthere fear political extremes left right day destroy republic way destroy america destroy market system long individuals choice market selfcorrects continue thrive demand result virginia prove emisem demand supply followp pthis university austin symbolises new choice disillusioned established institutions long looked universities disfigured blissfully unaware needed create lets hope beginning new renaissancep hrefhttpsunherdcom202111americaneducationneedsarevolutionappcommentsview 5 commentsa |
619582bff5d71aca4ac7eb1a | John McWhorter: How To Defeat 'Woke Racism' | div
picture
source sizesminwidth 600px 331px 100vw typeimagewebp srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202111mcwhorter20191jpgwebp 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202111mcwhorter20191jpgwebp 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202111mcwhorter20191800x450jpgwebp 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202111mcwhorter20191600x338jpgwebp 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202111mcwhorter20191331x186jpgwebp 331w
source sizesminwidth 600px 331px 100vw typeimagejpeg srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202111mcwhorter20191jpg 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202111mcwhorter20191jpg 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202111mcwhorter20191800x450jpg 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202111mcwhorter20191600x338jpg 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202111mcwhorter20191331x186jpg 331w
img width1200 altmcwhorter2019 srchttpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202111mcwhorter20191800x450jpg height675
picture
div
pspanin his bestselling new book spanispana hrefhttpswwwamazoncomexecobidosasin0593423062reasonmagazinea20woke racism how a new religion has betrayed black americaaspani ispannew york timesspanispan columnist and columbia university linguist john mcwhorter argues that the ideas of robin diangelo ibram x kendi and spanispanthe 1619 projectspanispan undermine blacks by sharpening racial divides and distracting from actual obstacles to real progressspanp
pspannick gillespie spoke with the 56yearold mcwhorter about what white people get out of cooperating with an ideological agenda that casts them as devils what black people gain by quotperformingquot victimhood and what needs to change so that all americans can get on with creating a more perfect unionspanp | div picture source sizesminwidth 600px 331px 100vw typeimagewebp srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202111mcwhorter20191jpgwebp 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202111mcwhorter20191jpgwebp 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202111mcwhorter20191800x450jpgwebp 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202111mcwhorter20191600x338jpgwebp 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202111mcwhorter20191331x186jpgwebp 331w source sizesminwidth 600px 331px 100vw typeimagejpeg srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202111mcwhorter20191jpg 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202111mcwhorter20191jpg 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202111mcwhorter20191800x450jpg 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202111mcwhorter20191600x338jpg 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202111mcwhorter20191331x186jpg 331w img width1200 altmcwhorter2019 srchttpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202111mcwhorter20191800x450jpg height675 picture div pspanin bestselling new book spanispana hrefhttpswwwamazoncomexecobidosasin0593423062reasonmagazinea20woke racism new religion betrayed black americaaspani ispannew york timesspanispan columnist columbia university linguist john mcwhorter argues ideas robin diangelo ibram x kendi spanispanthe 1619 projectspanispan undermine blacks sharpening racial divides distracting actual obstacles real progressspanp pspannick gillespie spoke 56yearold mcwhorter white people cooperating ideological agenda casts devils black people gain quotperformingquot victimhood needs change americans creating perfect unionspanp |
61958322f5d71aca4ac7eb28 | My Conversation with David Rubinstein | phere is a relnoopener hrefhttpsmediumcommercatusdavidrubensteintylercoweneconomicsmoneyarte2142f288258 target_blankthe audio video and transcripta david has a studio in his home here is part of the cwt summaryp
blockquotephe joined tyler to discuss what makes someone good at private equity why 20 percent performance fees have withstood the test of time why he passed on a young mark zuckerberg why spacs probably wont transform the ipo process gambling on cryptocurrency whether the brooklyn nets are overrated what wall street and washington get wrong about each other why he wasnt a good lawyer why the rise of china is the greatest threat to american prosperity how he would invest in baltimore his advice to aging philanthropists the four standards he uses to evaluate requests for money why we still need art museums the unusual habit he and tyler share why even now he wants more money why hes not worried about an imbalance of ideologies on college campuses how he prepares to interview someone what appealed to him about owning the magna carta the change hed make to the us constitution why you shouldnt obsess about finding a mentor and morepblockquote
phere is an excerpt from the dialoguep
blockquote
p dataselectableparagraphstrongcowen strongwhy do so many wealthy people have legal backgrounds but the emveryem wealthiest people typically do notp
p dataselectableparagraphstrongrubenstein stronglawyers tend to be very processoriented and very systematic and as a result they tend not to take big leaps of faith because youre taught in law school to worry about precedent precedent is not what makes entrepreneurs successful you have to ignore precedent and youll break through walls and say you cant be worried about what the precedent wasp
p dataselectableparagraphif youre worried about precedent youll never make a leap of faith to create a company like apple or a company like amazon lawyers tend to be more i would say traditionoriented more processoriented and more precedentoriented than great entrepreneurs arep
blockquote
p dataselectableparagraphandp
blockquote
p dataselectableparagraphstrongcowen strongyou seem to be in good health what if someone makes the argument to you you would do the world more good by not giving away money now but investing it through private equity earning whatever percent you could earn and when youre a bit older give emmuchem more away you can always give more to philanthropy five years down the roadp
p dataselectableparagraphstrongrubenstein strongof course you never know when youre going to die and covid we lost 700000 americans in covid i could have been one of them im 72 years old if you wait too long to give away your money you might find your executor giving it away secondly p
p dataselectableparagraphstrongcowen strongbut you could even write that into your will if you wanted youd have more to give away maybe 15 percent a yearp
p dataselectableparagraphstrongrubenstein strongyes but if you take the view that happy people live longer and if giving away money while youre alive and youre seeing it being given away makes you happier you might live longer grumpy people my theory is dont live as long happy people live longerp
p dataselectableparagraphif giving away money and having people say to me youre doing something good for the country makes me feel good it might make me live longer if i waited till the last moment to give away the money it might be too late to have that feelgood experiencep
blockquote
pand please note that david has a new book out a relnoopener ugc nofollow hrefhttpswwwsimonandschustercombookstheamericanexperimentdavidmrubenstein9781982165734 target_blankemthe american experiment dialogues on a dreamemap
pthe post a relnofollow hrefhttpmarginalrevolutioncommarginalrevolution202111myconversationwithdavidrubinsteinhtmlmy conversation with david rubinsteina appeared first on a relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap | phere relnoopener hrefhttpsmediumcommercatusdavidrubensteintylercoweneconomicsmoneyarte2142f288258 target_blankthe audio video transcripta david studio home cwt summaryp blockquotephe joined tyler discuss makes good private equity 20 percent performance fees withstood test time passed young mark zuckerberg spacs probably wont transform ipo process gambling cryptocurrency brooklyn nets overrated wall street washington wrong wasnt good lawyer rise china greatest threat american prosperity invest baltimore advice aging philanthropists standards uses evaluate requests money need art museums unusual habit tyler share wants money hes worried imbalance ideologies college campuses prepares interview appealed owning magna carta change hed constitution shouldnt obsess finding mentor morepblockquote phere excerpt dialoguep blockquote p dataselectableparagraphstrongcowenstrongwhy wealthy people legal backgrounds theemveryemwealthiest people typically notp p dataselectableparagraphstrongrubensteinstronglawyers tend processoriented systematic result tend big leaps faith youre taught law school worry precedent precedent makes entrepreneurs successful ignore precedent youll break walls cant worried precedent wasp p dataselectableparagraphif youre worried precedent youll leap faith create company like apple company like amazon lawyers tend traditionoriented processoriented precedentoriented great entrepreneurs arep blockquote p dataselectableparagraphandp blockquote p dataselectableparagraphstrongcowenstrongyou good health makes argument world good giving away money investing private equity earning percent earn youre bit older giveemmuchemmore away philanthropy years roadp p dataselectableparagraphstrongrubensteinstrongof course know youre going die covid lost 700000 americans covid im 72 years old wait long away money find executor giving away secondly p p dataselectableparagraphstrongcowenstrongbut write wanted youd away maybe 15 percent yearp p dataselectableparagraphstrongrubensteinstrongyes view happy people live longer giving away money youre alive youre seeing given away makes happier live longer grumpy people theory dont live long happy people live longerp p dataselectableparagraphif giving away money having people youre good country makes feel good live longer waited till moment away money late feelgood experiencep blockquote pand note david new book outa relnoopener ugc nofollow hrefhttpswwwsimonandschustercombookstheamericanexperimentdavidmrubenstein9781982165734 target_blankemthe american experiment dialogues dreamemap pthe post relnofollow hrefhttpmarginalrevolutioncommarginalrevolution202111myconversationwithdavidrubinsteinhtmlmy conversation david rubinsteina appeared relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap |
61958389f5d71aca4ac7eb2e | Looking back on the Space Race: My long-read Q&A with John Logsdon | pstrongby james pethokoukis and john logsdonstrongp
pin the summer of 1969 nasas apollo program succeeded in its mission to put a man on the moon but in the 49 years since apollo 17 neither nasa nor any other space agency has brought man beyond lowearth orbit how have american presidents and the public thought about manned space flight in the past half century and what does the future for space flight hold as private companies venture beyond the atmosphere to answer those questions and more im joined by john logsdonp
pjohn is the founder and professor emeritus of the space policy institute at george washington universitys elliott school of international affairs he is the author of several books on the space program his most recent is ema relnoreferrer noopener hrefhttpswwwamazoncomfrontierpalgravestudieshistorytechnologydp3319989618 target_blankronald reagan and the space frontieraemp
diviframe srchttpsplayercaptivatefmepisodee732588371a44a18ac3bcc706e9c237biframediv
pwhat follows is a lightly edited transcript of our conversation you can a relnoreferrer noopener hrefhttpswwwaeiorgpodcastjohnlogsdontheapolloprogramandthefutureofspaceexploration target_blankdownloada the episode here and dont forget to subscribe to my podcast on a relnoreferrer noopener hrefhttpspodcastsapplecomuspodcastpoliticaleconomypodcastid589914386mt2 target_blankitunesa or a relnoreferrer noopener hrefhttpswwwstitchercompodcastricochetmoneypoliticswithjimpethokoukis target_blankstitchera tell your friends leave a reviewp
pstrongpethokoukis what did you think about the william shatner ride into spacestrongp
plogsdon well its great pr for blue origin and his reaction is almost literally priceless he really captured the excitement of being in space that motivates a lot of us to continue to support space exploration not just exploitationp
pstrongone thing that i noticed about his response after landing was rather than thinking about earth in the classic carl saganema relnoreferrer noopener hrefhttpswwwamazoncompalebluedotvisionfutureebookdpb004w0i3lw target_blankpale blue dotaem way he instead seemed to focus on how precarious life seemed to be on how we have the earth with just a thin layer of blue and then surrounded by the black i dont know its maybe just a little bit of a different way of looking at it than how people often describe the earthstrongp
pwell i think a number of people that have had the experience of being in orbit and of course shatner didnt go into orbit have experienced what they call the overview effect of looking back at earth and indeed perceiving just how fragile this planet is and how thin our atmosphere sheltering us from the void of the cosmos is and how important it is to preserve this planet and it will take workp
figure classwpblockimageimg alt srchttpswwwaeiorgwpcontentuploads202111logsdonlongreadshatnerjpgx91208 classwpimage1008615343figcaptionstar trek actor william shatner 90 after his flight in a capsule powered by blue origins reusable rocket engine new shepard october 13 2021 reutersmike blakefigcaptionfigure
spanspan
pstrongafter his ride not unexpectedly there were some politicians criticizing it as billionaires taking joy rides i think after some of the previous flights bernie sanders said something similar their critiques are about billionaires and wealth but also probably about how resources are being spent this is not a new critique certainly during the apollo age there were a lot of critiques of apollo as a waste of valuable resources werent therestrongp
pwell yes and ill come back to that in a minute but i think its worth pointing out that this flight with shatner was totally private there was no public money no government money except on the very margins involved in the enterprise so private people can spend their money as they choose and be subject to criticism but its not the same as misplaced priorities in government spending that was the argument during apollo even during apollo amitai etzioni the social critic hes still with us published a book in 1963 called a hrefhttpswwwamazoncommoondoggledomesticinternationalimplicationsspacedpb000r0cfdiemmoondoggleema and it is a trenchant criticism of the priority being allocated to apollo and it was an entirely legitimate criticism i didnt agree with it then i dont agree with it now but there were choices made about how to spend public money not on education not on welfare but on competing with the soviet union for global space leadership and you could say that was or was not worth itp
pstrongif i recall correctly after it became clear that the apollo program was going to come to an end there was a new york times editorial which said something like weve been critical of the program all along that it was only merely about prestige now that the space race is won its over so any other reason that you may have given for going to space well obviously that was just a phony reason because now its over i think that sort of criticism still hurts efforts today that the apollo program and any new vision about manned space exploration are about little more than things of national pride or maybe some sort of softpower geopolitics but theres not a substantially good reason for people leaving the earthstrongp
pwell i think it is but i think theres more to it than that john kennedy when he decided to send americans to the moon was very clear that it was an element of national security strategy that it was a way of demonstrating leadership visavis the cold war competition with the soviet union that was something of crucial national interest and importance in the early 60s so he made a very calculated decision that the prize was worth the cost he revisited that whether he wouldve kept that had he lived all the way through is an interesting questionp
pthe problem since has been that theres no answer like how do you beat the soviets go to the moon whats the question to which the answer is go to mars or return to the moon there really is no compelling answer to that it becomes a matter of choice i think societal choice as long as its government money my own view is that space exploration is an element of human experience that is worth investing in i think less than half of one percent goes into the nasa budget given all the other things we spend money on spending money on exploring space and the human adventure of exploring space i think is worth the costp
figure classwpblockimageimg alt srchttpswwwaeiorgwpcontentuploads202111logsdonlongreadaldrinjpgx91208 classwpimage1008615346figcaptionastronaut edwin e aldrin jr poses beside the deployed flag of the united states during the apollo 11 moon landing on july 20 1969 via reutersfigcaptionfigure
pstrongyou mentioned president kennedy the apollo program ended under president nixon have american presidents thought fairly similarly about spacestrongp
poh i think they have differed pretty dramatically from president to president ive been working on a study of the presidents since nixon and their attitudes towards a space program and you see theyre highly variable jimmy carter wasnt interested in human space flight at all and gave it very low priority ronald reagan saw human space flight and space in general as kind of a a relnoreferrer noopener hrefhttpswwwamazoncomfrontierpalgravestudieshistorytechnologydp3319989618 target_blanknew frontiera he had a frontier attitude towards life he wanted to push new frontiers and he saw space that way but he didnt put money behind that thought the nasa budget was basically the same percentage of the federal budget as reagan came in and when he leftp
pgeorge hw bush was convinced to set a return to the moon and then on to mars as a goal but that didnt take congress was opposed and there wasnt any strong public support but he proposed on the 20th anniversary of apollo going back to the moon then bill clinton didnt have high interest in space exploration he was focused on the space station using it as an instrument of postcold war diplomacy george w bush had to react after the columbia accident in 2003 and the criticism of which i had a hand from the columbia accident investigation board that the program lacked a vision w bush set out again a vision of longterm sustained exploration with people as well as spacecraftp
pthose starts and stops have persisted since 2004 certainly mr trump saw the dramatic potential of space and set us on a sustained course of exploration president biden has said hes going to stay that course so well see were on a path now to return to the moon with humans strong strongthe first woman and the next man is the cliche some time in the next five to seven yearsp
pstrongof my favorite television shows im not sure if youre familiar with it is a show called ema relnoreferrer noopener hrefhttpswwwaeiorgeconomicswhatifamericahadlosttheracetothemoonmylongreadqawithronalddmoore target_blankfor all mankindaemstrongp
pyeah ive seen some of the episodesp
pstrongits kind of an alternate history show and the premise is the soviets get to the moon first and that sets into motion a variety of events in which the space race never really ends the soviets keep going to the moon we keep going to the moon technology keeps advancing was there a scenario where apollo doesnt end and a new manned space program ends up being the successor program to apollo was there a conceivable scenario where that happenedstrongp
pwell was it a scenario im not sure it was proposed president nixon knew he had to define what happened after apollo he chartered a thing called the space task group chaired by a wellknown space expert named spiro agnew his vice president to come up with definitive recommendations of what to do after apollo they recommended going to mars in the mid1980s if that recommendation had been accepted it would have been a very different program nixon had no interest in spending money on doing that he liked the astronauts but he didnt see continued exploration as an important element he said its just another program funded in competition with all the other things that are important in that competition space went from 4 percent of the budget to one half or 1 percent of the budget it has stayed there or around there now for the past 25 or 30 years maybe even morep
pstrongwith nixon was it purely just that he didnt grasp that idea of human adventure ive read that the near disaster of apollo 13 also may have played a role that really shook him upstrongp
pyeah it really did he got very emotionally engaged with the fate of the apollo crew even before then he was skeptical of continued lunar exploration but after apollo 13 he tried very hard to cancel what turned out to be apollo 16 and 17 it was nasa that canceled the final two planned missions and told nixon theyd rather spend the money on new programs than on repeating trips to the moon nasa at least some of the people in nasa also got cold feet after apollo 13 realizing just how risky this was so nasa has really not embraced exploration as much as it has embraced building and operating the space shuttle building and operating the space station and only then turning to what do we do next the answer is resume explorationp
figure classwpblockimageimg alt srchttpswwwaeiorgwpcontentuploads202111logsdonlongreadapollo17jpgx91208 classwpimage1008615354figcaptionapollo 17 commander gene cernan pictured on the moon december 14 1972brvia reutersfigcaptionfigure
pstrongto what extent have the changes in the program been driven by a fickle public we all love the notion of apollo and politicians love putting scenes of the moon landing in their ads but americas interest in space might not be as great as one might think given our love of apollo not to mention our love of sciencefiction films if the american public was more enthusiastic about the notion would the politicians follow and am i characterizing the public opinion correctlystrongp
pwell james i dont know how old you are i know how old i am and i was at the launch of apollo 11 so im very much of the apollo generation but 60 percent of the people alive today have been born since apollo and thats not part of their memory so for those of us that it is its kind of sad that there isnt continued enthusiasmp
pbut look at all the interest in sending shatner even just on this little suborbital jaunt the people followed the inspiration4 private orbital mission i think instead of the apollo astronauts we now have elon musk jeff bezos and richard branson and the things that theyre trying to do certainly are capturing a fair amount of public attention its been my view that government space programs of the character of apollo and similar are really presidential issues where a president sees the link between space exploration and some important national priority national image national intervention national morale some of the presidents have seen that others have notp
pstrongthe fact that we have not left lowearth orbit in a half century does that mean apollo was a failure in what ways do you think apollo was a failure in what ways looking back was it a success beyond the goal of actually getting on the moonstrongp
pwell for john kennedy the point of apollo was a demonstration of american technological implicitly military and organizational potency it was an act of national power and national prestige in those terms i think it was totally successful the rest of the world was more impressed by apollo at the time than the people in the united states but it was also by defining it as a race once you won the race there was no reason to keep racing as i said earlier the race rationale has not been replaced by any other compelling rationale strong enough to rally political support for the funds that are necessary to do things like thisp
pstrongeven beyond the space station and the space shuttle we still have an active space program just not a manned space program i think we sometimes forget that we continue to send probes to planets to asteroids i mean thats not an inconsiderable achievementstrongp
pyeah theres a mission going to the asteroids called lucy weve explored the solar system on december the 18th were going to launch the successor to the hubble telescope called james webb that will look back in time and out in space to the origins of the universe its been an extremely exciting robotic space exploration programp
figure classwpblockimageimg alt srchttpswwwaeiorgwpcontentuploads202111logsdonlongreadlucyjpgx91208 classwpimage1008615344figcaptionnasas lucy spacecraft atop a united launch alliance atlas 5 rocket for a mission to study the trojan asteroids in the outer solar system october 15 2021 reuterssteve nesiusfigcaptionfigure
pin addition space has become a place for business theres a 400 billion space economy in existence mainly doing useful things communications earth observation positioning and navigation space capabilities become central to everyday life at least in the advanced world then theres the whole other use of space for national security and military power which is very real in the last year and a half or so the united states created a space force to symbolize the importance of national security in spacep
pstrongi think if we wouldve had our conversation a decade ago it mightve purely been about space probes and us reminiscing about the apollo program but clearly that has changed that has changed partially at least if not primarily due to the dramatic decline in launch costs what has been going on in space the last 10 years and how excited are you that space seems to have been opened up in a way that we havent really considered for quite some timestrongp
pwell i think what has been going on is a paradigm shift to use a kind of jargony phrase space is a place to do business and the lowering of launch costs is key to that one has to give credit to spacex and elon musk and the introduction of reusability as a key element in the lowering of launch costs which means theres the possibility of trying and failing without great cost and trying and succeeding in various lines of business so space has become an area for profitmaking for applications that benefit humanity in a sense its become dull its just another place to do useful things i still am captured by space exploration by going places seeing new things but thats been kind of overcome except on occasion by space exploitation by finding all the useful things you can do from the orbital perspective and eventually beyondp
pstrongi think some people find it untoward that nasa does not seem to be leading america in space that it is the private sector doing so instead are you fine with the private sector taking the lead in space for the united statesstrongp
pwell taking the lead is kind of a slippery concept weve gotten to the point where theres not one thing called space or space activity the government still has the lead in exploration both robotic and human because nobody has figured out how to monetize it you do have people like musk who are visionaries with a personal preference for exploration elon still talks about a millionperson city on mars and never justifies that on economic terms but the maturing of space means that people who are there not because of the excitement of exploration but because of the possibility of creating new businesses new wealth new jobs see it as an area with a lot of potential so theres more than one track in space activity and im certainly fine with thatp
figure classwpblockimageimg alt srchttpswwwaeiorgwpcontentuploads202111logsdonlongreadissjpgx91208 classwpimage1008615352figcaptionthe international space station photographed by expedition 56 crew members from a soyuz spacecraft after undocking october 4 2018 nasaroscosmoshandout via reutersfigcaptionfigure
pstrongthe space race began as a geopolitical rivalry now there seems to be a rivalry between the us and china do you think that will be helpful in keeping americans interested in spacestrongp
pi do its very different than the cold war and the space race in the sense that there are so many more capable space actors its not just as it was in the 60s with the united states and the soviet union but clearly china is an ambitious space power the united states has maintained its commitment to a leading position in space i think the competition between those two is very different in character than the ussoviet cold war competition and its probably good for both sides to stimulate activity you can compete without racing after all competition is the american way of life so what china is doing in civil space i think is in a sense good for everybody it is a separate issue that china is developing military space capabilities that are threatening to the us ability to fight and win wars that is very much a matter of concern but chinas lunar exploration program our artemis exploration program private ventures and return to the moon i think are all good for everybodyp
pstrongwhat would you like america to be doing at a governmental level is there anything that the government should stop doing what would be your policy advicestrongp
pright now the policy advice i would give is to stay the course the trump administration left a space heritage for president biden president biden embraced that heritage and said were going to keep moving forward so staying the course of consistency of purpose i guess is the jargon phrase lets continue to prepare for human exploration in the end of this decade and beyond its time to go back its time to go somewhere again not just in circles around the earthp
pstrongfinal question would you accept an invite from jeff bezos on blue originstrongp
pwell shatner was 90 by the time this airs i will have turned 84 hes in better shape than i am so probably yes i dont want to downgrade what has happened but its a joy ride going up and down in 10 minutes if i were going to take the risk id want to go to orbit and im not sure im ready to do thatp
pstrongi like that answer my guest today has been john logsdon john thanks for coming on the podcaststrongp
pgood to be with youp
pemjames pethokoukis is the dewitt wallace fellow at the american enterprise institute where he writes and edits the aeideas blog and hosts a weekly podcast a relnoreferrer noopener hrefhttpswwwaeiorgtagpoliticaleconomypodcast target_blankpolitical economy with james pethokoukisa john logsdon is the founder and professor emeritus of the space policy institute at george washington universitys elliott school of international affairsemp
pdivpstronglearn more stronga hrefhttpswwwaeiorgeconomicsthetechnooptimismofworldsfairsmylongreadqawithcharlespappasthe technooptimism of worlds fairs my longread qampa with charles pappasa a hrefhttpswwwaeiorgeconomicswilltaxingbillionaireshelpdemocratsbuildbackbettermylongreadqawithkylepomerleauwill taxing billionaires help democrats build back better my longread qampa with kyle pomerleaua a hrefhttpswwwaeiorgeconomicsamericaslaborshortageandthegreatresignationmylongreadqawithmichaelstrainamericas labor shortage and the great resignation my longread qampa with michael strainapdivbr
pthe post a relnofollow hrefhttpswwwaeiorgeconomicslookingbackonthespaceracemylongreadqawithjohnlogsdonlooking back on the space race my longread qampa with john logsdona appeared first on a relnofollow hrefhttpswwwaeiorgamerican enterprise institute aeiap | pstrongby james pethokoukis john logsdonstrongp pin summer 1969 nasas apollo program succeeded mission man moon 49 years apollo 17 nasa space agency brought man lowearth orbit american presidents public thought manned space flight past half century future space flight hold private companies venture atmosphere answer questions im joined john logsdonp pjohn founder professor emeritus space policy institute george washington universitys elliott school international affairs author books space program recent ema relnoreferrer noopener hrefhttpswwwamazoncomfrontierpalgravestudieshistorytechnologydp3319989618 target_blankronald reagan space frontieraemp diviframe srchttpsplayercaptivatefmepisodee732588371a44a18ac3bcc706e9c237biframediv pwhat follows lightly edited transcript conversation relnoreferrer noopener hrefhttpswwwaeiorgpodcastjohnlogsdontheapolloprogramandthefutureofspaceexploration target_blankdownloada episode dont forget subscribe podcast relnoreferrer noopener hrefhttpspodcastsapplecomuspodcastpoliticaleconomypodcastid589914386mt2 target_blankitunesa relnoreferrer noopener hrefhttpswwwstitchercompodcastricochetmoneypoliticswithjimpethokoukis target_blankstitchera tell friends leave reviewp pstrongpethokoukis think william shatner ride spacestrongp plogsdon great pr blue origin reaction literally priceless captured excitement space motivates lot continue support space exploration exploitationp pstrongone thing noticed response landing thinking earth classic carl saganema relnoreferrer noopener hrefhttpswwwamazoncompalebluedotvisionfutureebookdpb004w0i3lw target_blankpale blue dotaem way instead focus precarious life earth thin layer blue surrounded black dont know maybe little bit different way looking people describe earthstrongp pwell think number people experience orbit course shatner didnt orbit experienced overview effect looking earth perceiving fragile planet thin atmosphere sheltering void cosmos important preserve planet workp figure classwpblockimageimg alt srchttpswwwaeiorgwpcontentuploads202111logsdonlongreadshatnerjpgx91208 classwpimage1008615343figcaptionstar trek actor william shatner 90 flight capsule powered blue origins reusable rocket engine new shepard october 13 2021 reutersmike blakefigcaptionfigure spanspan pstrongafter ride unexpectedly politicians criticizing billionaires taking joy rides think previous flights bernie sanders said similar critiques billionaires wealth probably resources spent new critique certainly apollo age lot critiques apollo waste valuable resources werent therestrongp pwell yes ill come minute think worth pointing flight shatner totally private public money government money margins involved enterprise private people spend money choose subject criticism misplaced priorities government spending argument apollo apollo amitai etzioni social critic hes published book 1963 called hrefhttpswwwamazoncommoondoggledomesticinternationalimplicationsspacedpb000r0cfdiemmoondoggleema trenchant criticism priority allocated apollo entirely legitimate criticism didnt agree dont agree choices spend public money education welfare competing soviet union global space leadership worth itp pstrongif recall correctly clear apollo program going come end new york times editorial said like weve critical program merely prestige space race won reason given going space obviously phony reason think sort criticism hurts efforts today apollo program new vision manned space exploration little things national pride maybe sort softpower geopolitics theres substantially good reason people leaving earthstrongp pwell think think theres john kennedy decided send americans moon clear element national security strategy way demonstrating leadership visavis cold war competition soviet union crucial national interest importance early 60s calculated decision prize worth cost revisited wouldve kept lived way interesting questionp pthe problem theres answer like beat soviets moon whats question answer mars return moon compelling answer matter choice think societal choice long government money view space exploration element human experience worth investing think half percent goes nasa budget given things spend money spending money exploring space human adventure exploring space think worth costp figure classwpblockimageimg alt srchttpswwwaeiorgwpcontentuploads202111logsdonlongreadaldrinjpgx91208 classwpimage1008615346figcaptionastronaut edwin e aldrin jr poses deployed flag united states apollo 11 moon landing july 20 1969 reutersfigcaptionfigure pstrongyou mentioned president kennedy apollo program ended president nixon american presidents thought fairly similarly spacestrongp poh think differed pretty dramatically president president ive working study presidents nixon attitudes space program theyre highly variable jimmy carter wasnt interested human space flight gave low priority ronald reagan saw human space flight space general kind relnoreferrer noopener hrefhttpswwwamazoncomfrontierpalgravestudieshistorytechnologydp3319989618 target_blanknew frontiera frontier attitude life wanted push new frontiers saw space way didnt money thought nasa budget basically percentage federal budget reagan came leftp pgeorge hw bush convinced set return moon mars goal didnt congress opposed wasnt strong public support proposed 20th anniversary apollo going moon bill clinton didnt high interest space exploration focused space station instrument postcold war diplomacy george w bush react columbia accident 2003 criticism hand columbia accident investigation board program lacked vision w bush set vision longterm sustained exploration people spacecraftp pthose starts stops persisted 2004 certainly mr trump saw dramatic potential space set sustained course exploration president biden said hes going stay course path return moon humans strong strongthe woman man cliche time seven yearsp pstrongof favorite television shows im sure youre familiar called ema relnoreferrer noopener hrefhttpswwwaeiorgeconomicswhatifamericahadlosttheracetothemoonmylongreadqawithronalddmoore target_blankfor mankindaemstrongp pyeah ive seen episodesp pstrongits kind alternate history premise soviets moon sets motion variety events space race ends soviets going moon going moon technology keeps advancing scenario apollo doesnt end new manned space program ends successor program apollo conceivable scenario happenedstrongp pwell scenario im sure proposed president nixon knew define happened apollo chartered thing called space task group chaired wellknown space expert named spiro agnew vice president come definitive recommendations apollo recommended going mars mid1980s recommendation accepted different program nixon interest spending money liked astronauts didnt continued exploration important element said program funded competition things important competition space went 4 percent budget half 1 percent budget stayed past 25 30 years maybe morep pstrongwith nixon purely didnt grasp idea human adventure ive read near disaster apollo 13 played role shook upstrongp pyeah got emotionally engaged fate apollo crew skeptical continued lunar exploration apollo 13 tried hard cancel turned apollo 16 17 nasa canceled final planned missions told nixon theyd spend money new programs repeating trips moon nasa people nasa got cold feet apollo 13 realizing risky nasa embraced exploration embraced building operating space shuttle building operating space station turning answer resume explorationp figure classwpblockimageimg alt srchttpswwwaeiorgwpcontentuploads202111logsdonlongreadapollo17jpgx91208 classwpimage1008615354figcaptionapollo 17 commander gene cernan pictured moon december 14 1972brvia reutersfigcaptionfigure pstrongto extent changes program driven fickle public love notion apollo politicians love putting scenes moon landing ads americas interest space great think given love apollo mention love sciencefiction films american public enthusiastic notion politicians follow characterizing public opinion correctlystrongp pwell james dont know old know old launch apollo 11 im apollo generation 60 percent people alive today born apollo thats memory kind sad isnt continued enthusiasmp pbut look interest sending shatner little suborbital jaunt people followed inspiration4 private orbital mission think instead apollo astronauts elon musk jeff bezos richard branson things theyre trying certainly capturing fair public attention view government space programs character apollo similar presidential issues president sees link space exploration important national priority national image national intervention national morale presidents seen notp pstrongthe fact left lowearth orbit half century mean apollo failure ways think apollo failure ways looking success goal actually getting moonstrongp pwell john kennedy point apollo demonstration american technological implicitly military organizational potency act national power national prestige terms think totally successful rest world impressed apollo time people united states defining race won race reason racing said earlier race rationale replaced compelling rationale strong rally political support funds necessary things like thisp pstrongeven space station space shuttle active space program manned space program think forget continue send probes planets asteroids mean thats inconsiderable achievementstrongp pyeah theres mission going asteroids called lucy weve explored solar system december 18th going launch successor hubble telescope called james webb look time space origins universe extremely exciting robotic space exploration programp figure classwpblockimageimg alt srchttpswwwaeiorgwpcontentuploads202111logsdonlongreadlucyjpgx91208 classwpimage1008615344figcaptionnasas lucy spacecraft atop united launch alliance atlas 5 rocket mission study trojan asteroids outer solar system october 15 2021 reuterssteve nesiusfigcaptionfigure pin addition space place business theres 400 billion space economy existence mainly useful things communications earth observation positioning navigation space capabilities central everyday life advanced world theres use space national security military power real year half united states created space force symbolize importance national security spacep pstrongi think wouldve conversation decade ago mightve purely space probes reminiscing apollo program clearly changed changed partially primarily dramatic decline launch costs going space 10 years excited space opened way havent considered timestrongp pwell think going paradigm shift use kind jargony phrase space place business lowering launch costs key credit spacex elon musk introduction reusability key element lowering launch costs means theres possibility trying failing great cost trying succeeding lines business space area profitmaking applications benefit humanity sense dull place useful things captured space exploration going places seeing new things thats kind overcome occasion space exploitation finding useful things orbital perspective eventually beyondp pstrongi think people find untoward nasa leading america space private sector instead fine private sector taking lead space united statesstrongp pwell taking lead kind slippery concept weve gotten point theres thing called space space activity government lead exploration robotic human figured monetize people like musk visionaries personal preference exploration elon talks millionperson city mars justifies economic terms maturing space means people excitement exploration possibility creating new businesses new wealth new jobs area lot potential theres track space activity im certainly fine thatp figure classwpblockimageimg alt srchttpswwwaeiorgwpcontentuploads202111logsdonlongreadissjpgx91208 classwpimage1008615352figcaptionthe international space station photographed expedition 56 crew members soyuz spacecraft undocking october 4 2018 nasaroscosmoshandout reutersfigcaptionfigure pstrongthe space race began geopolitical rivalry rivalry china think helpful keeping americans interested spacestrongp pi different cold war space race sense capable space actors 60s united states soviet union clearly china ambitious space power united states maintained commitment leading position space think competition different character ussoviet cold war competition probably good sides stimulate activity compete racing competition american way life china civil space think sense good everybody separate issue china developing military space capabilities threatening ability fight win wars matter concern chinas lunar exploration program artemis exploration program private ventures return moon think good everybodyp pstrongwhat like america governmental level government stop policy advicestrongp pright policy advice stay course trump administration left space heritage president biden president biden embraced heritage said going moving forward staying course consistency purpose guess jargon phrase lets continue prepare human exploration end decade time time circles earthp pstrongfinal question accept invite jeff bezos blue originstrongp pwell shatner 90 time airs turned 84 hes better shape probably yes dont want downgrade happened joy ride going 10 minutes going risk id want orbit im sure im ready thatp pstrongi like answer guest today john logsdon john thanks coming podcaststrongp pgood youp pemjames pethokoukis dewitt wallace fellow american enterprise institute writes edits aeideas blog hosts weekly podcast relnoreferrer noopener hrefhttpswwwaeiorgtagpoliticaleconomypodcast target_blankpolitical economy james pethokoukisa john logsdon founder professor emeritus space policy institute george washington universitys elliott school international affairsemp pdivpstronglearn stronga hrefhttpswwwaeiorgeconomicsthetechnooptimismofworldsfairsmylongreadqawithcharlespappasthe technooptimism worlds fairs longread qampa charles pappasa hrefhttpswwwaeiorgeconomicswilltaxingbillionaireshelpdemocratsbuildbackbettermylongreadqawithkylepomerleauwill taxing billionaires help democrats build better longread qampa kyle pomerleaua hrefhttpswwwaeiorgeconomicsamericaslaborshortageandthegreatresignationmylongreadqawithmichaelstrainamericas labor shortage great resignation longread qampa michael strainapdivbr pthe post relnofollow hrefhttpswwwaeiorgeconomicslookingbackonthespaceracemylongreadqawithjohnlogsdonlooking space race longread qampa john logsdona appeared relnofollow hrefhttpswwwaeiorgamerican enterprise institute aeiap |
619583a0f5d71aca4ac7eb30 | Books of the year | pstronghilary mantelstrongp
pin the 1990s a hrefhttpswwwnewstatesmancominternationalpolitics202104stephenbushmusaokwongaoneofthemmusa okwonga was a ugandan scholarship boy at etona the school that turned out scores of politicians as well as bertie wooster and captain hook his memoir emone of themem unbound sheds light on the present disconnect between those who govern and those who suffer the consequencesp
pclaire keegans novel emsmall things like theseem faber amp faber wastes not a word in its depiction of a small irish town guilty of collective blindness about the nuns who run a training school for young women keegan is an exquisite writer who can enclose volumes of social history in one luminous phrasep
pstronga hrefhttpswwwnewstatesmancomthecultureinterview202110thedoublelifeofianrankinian rankinastrongp
pemhydeem by craig russell constable is set in 19thcentury edinburgh where a detective called hyde must hunt a ghoulish possibly occult serial killer while wrestling with demons of his own including mood swings and blackouts its an ingenious slice of gothic that does something new with the jekyll and hyde trope emhydeem is the best scottish crime novel of 2021 according to the mcilvanney prize but i wont hold that against itp
pin emthe beresfordem by will carver orenda books a mazelike boardinghouse becomes a scene of carnage as the tenants are dispatched in grisly fashion one by one what is going on and who can bring an end to the bloodshed carver writes in the tradition of the theatre of the absurd but with added grue shocking compulsive and persuasive its one hell of a ride for those of a mind to jump aboardp
pstronga hrefhttpswwwnewstatesmancompolitics202106bernardineevaristobritishschoolssidelinewritersofcolourbernardine evaristoastrongp
pjoelle taylor has produced one of the most astonishing and original poetry collections of recent years emcnto amp othered poemsem westbourne press is a partly autobiographical exploration of the lives of butch lesbian counterculture it challenges imprisoning notions of womanhood by celebrating and foregrounding those who face a hostile society when they are only being true to themselvesp
palso taking us into new literary territory are two impressive debuts empoorem by a hrefhttpswwwnewstatesmancomcultureobservations202010calebfeminorthpeckhamestatepolicepoetryteachingcaleb femia penguin zooms in on the lives of young black men on the south london housing estate of his own childhood while caleb azumah nelsons first novel emopen waterem viking is a short poetic and intellectual meditation on art and a relationship between a young couple which also has peckham and south london as its primary backdropp
pstronged smithstrongp
pi read empowers and thrones a new history of the middle agesem by dan jones head of zeus and emthe world according to colourem by james fox allen lane in tandem it was like watching two great and complementary halfbacks in rugby jones drives his story upfield empires come and go religions form and break up ideas clash and mingle 1100 years 16 sweeping chapters 700 pacey pages and hes done it arms aloft hes scored under the posts masterly muscular and direct gareth edwards in full flowp
pin contrast fox glides into intellectual spaces colour becomes a philosophical feast astrophysics the origins of civilisation a palette of moral associations though dazzling everything has a point when fox shoots he scores you never see it coming then suddenly all the pieces fit together as though they were meant to be barry john running into spacep
pstrongphilip pullmanstrongp
pin 2009 iain mcgilchrist published emthe master and his emissaryem a densely researched and entirely thrilling examination of the difference between the two kinds of thinking typical of the right and left hemispheres of the brain now comes his new book emthe matter with thingsem yale university press which takes that basic idea much further and demonstrates with an immense range of learning and beautifully clear prose how important it is to be aware of the whole and not merely the parts how analysis should come after insight and not before it how righthemisphere thinking with its openness to experience is a better guide to reality than the narrowly focused rulebased way the left hemisphere regards the worldp
pi have spent a decade absorbing the vision of mcgilchrists previous book i shall be happy to spend the rest of my life with this one and still be learning things when i get to the endp
pstrongdamon galgutstrongp
pmost of my reading is retrospective which is to say i dont read a lot of stuff thats been recently published i like to wait for the dust to settle but claire keegans new novella emsmall things like theseem faber amp faber is absolutely exquisite her work is exceptionalp
pi really liked emburntcoatem by a hrefhttpswwwnewstatesmancomculture201707sarahhallsdarkshortstoriesarefragmentsliveswrenchedoutalignmentsarah halla faber amp faber i think shes a marvellous writer she usedbrthe scenario of an unnamed plague and the lockdown it sets up to create a psychological mystery were probably going to get a whole new genre of covid fiction opening up and hall is right at the vanguardp
pstrongmarina warnerstrongp
pas we lived isolated in lockdown i found a hrefhttpswwwnewstatesmancomculture202102howishigurorewrotehimselfkazuo ishiguros emklara and the sunemaem emfaber amp faber about an artificial friend destined for a slow fade uniquely poignant as well as prescient the pandemic cut short the run of emthe botanical mind art mysticism and the cosmic treeem camden arts centre london but the curators gina buenfeld and martin clark produced a feast of a book exploring the visionary tradition across continents and centuries in emswirl of wordsswirl of worlds poems from 94 languages spoken across london empeer the poet and editor stephen watts draws us into hear the citys magnificent hubbubp
pstrongdavid harestrongp
pemninth street women emback bayem emis 700 pages long so you need lots of time not just to read but also to think mary gabriel recreates that extraordinary moment in the 1950s in greenwich village when helen frankenthaler joan mitchell grace hartigan elaine de kooning and lee krasner were all young painters who came upon unforeseen fame and fortune the book is both entertaining and inspiringp
praven leilani in her debut novel ema hrefhttpswwwnewstatesmancomculturebooks202101nsrecommendsnewbooksbryanwashingtonjontyclaypoleravenleilaniandluster aempicador makes fun of supersmart people being perverse im not sure i wholly understood her intent but oh my goodness the writing is beautifulp
pstrongjohn graystrongp
pthe book that engrossed me the most this year was emcontinents of exileem penguin modern classics the 12volume memoir of the indianborn writer ved mehta 19342021 who lost his sight at the age of three after suffering from meningitis and went on to try to live as far as possible as a fully sighted person the series seems to me one of the supreme works of modern autobiography much of it has to do with a sense of homelessness but mehtas story is full of the joy of life i followed him through his early years with his family in india to a school for the blind in arkansas then to pomona college in california balliol college oxford harvard and his 33 years as a writer for william shawns emnew yorkerem mehtas turbulent romances and years of psychoanalysis his travails building a house on an island off the maine coast and the hidden side of his father that came to light at a new york party complete an absorbing account of an astonishing lifep
pstrongmark cockerstrongp
pgreat field guides are a rare species but at their best they are portals to a richer relationship with the rest of life it is exceptional that two such groundbreaking books have appeared in a single year emeuropes birds an identification guideem by rob hume robert still andy swash and hugh harrop and paul brocks embritains insects a field guide to the insects of great britain and irelandem both princeton university press are models of compression synthesising a mountain of fresh data in an easytouse format but they are also beautiful to hold and to ponder and each is a glorious piece of political advocacy for its chosen organismsp
pstronglucy hugheshallettstrongp
pi was proud of the shortlist we judges chose for the 2021 international booker prize but there were books i loved that didnt make the cut among them were ema perfect cemeteryem charco press a collection of haunting witty stories by the argentinian writer federico falco and philippe claudels emdog island emmaclehose press a parable about modern migration that is also the kind of detective story that mikhail bulgakov might have written visionary and darkly humorous p
pmy favourite novel of the year though is a reissue elspeth barkers emo caledonia emweidenfeld amp nicolsonemem a book as outrageous and clever as its teenaged heroine it is fiercely gothic constantly surprising and wildly funnyp
pstrongmark haddonstrongp
pive been unwell for the past year and reading has been often impossible consequently i am more than usually grateful to the few books that drew me in and held me emthe prophets emby robert jones juniorem emriverrun is a gripping luminous novel about the many tangled lives on a louisiana plantation centring on two enslaved teenage lovers samuel and isiah reviews invoking toni morrison were absolutely justifiedp
pemthe idea of the brainem by matthew cobb profile is a thrilling history of our rapidly expanding understanding of the brain made even better by having no theoretical axe to grind it also explores the fundamental role of metaphor in neuroscientific theory the brain is a system of hydraulics the brain is a telegraph network and the unique challenges faced when trying to understand an object that is like nothing else in the universep
pstrongjason cowleystrongp
pi admired the cool restrained style of katie kitamuras emintimacies emjonathan cape which probes the tangled emotional life of a young unnamed americanjapanese woman working as a translator at the international criminal court in the hague it is less a novel than an exercise in selferasure mysterious and compellingp
pi loved jonathan bates embright star green light emwilliam collins a deeply romantic exploration of the work and parallel lives of john keats and f scott fitzgerald both destined to die young and both enraptured by beauty and beautys inevitable lossp
pstrongali smithstrongp
pits quite hard to get hold of a copy of eileen agars memoir ema look at my life emmethuen it was published in 1988 and i read it this year when i couldnt get to london to see the whitechapel retrospective of her work but what a book spirited funny candid as irreverent textured and cornucopic as her art it begins head first i tumbled out of my mother in december 1899 it ends i hope to die in a sparkling moment agar makes a fleeting appearance too in jennifer higgies brilliant emthe mirror and the paletteem weidenfeld amp nicolson which reveals an untilnow hidden history of womens selfportraiture and is pretty cornucopic itself a gift that keeps on givingp
pbut my book of the year is a debut a slim collection of poetry called emforty names emcarcanet by the young afghani poet parwana fayyaz no one ever wanted to knowwhat the real story was as clear as unruined water as courageous as a poet can be in these times as haunting as the brutal history it records and as marvellously summoned as the lives it celebrates its a calm reclamation and a tour de forcep
pstrongnicola sturgeonstrongp
pspanning the globe and a century emgreat circle emby maggie shipstead doubleday is an epic tale of daring and adventure the character and determination of two fearless women living in different times but connected by fate is as inspiring as it is entertaining i hugely enjoyed this novelp
pi love everything colm tibn has written andem the magicianem viking is another masterpiece the rise of nazi germany and the horrors of the second world war are viewed through the eyes and experiences of the complicated and multilayered writer and nobel prize winner thomas mann historical fiction at its bestp
pstrongpreti tanejastrongp
pniven govindens emdiary of a filmem dialogue books a novel about cinema age gender fame and creativity infused with the spirit of federico fellini and luca guadagnino stole my heart this year set during an international film festival as a jaded director is about to launch his masterpiece and told in the first person as an extended conversation over a few nights it captures a sense of the fragility and intimacy of human endeavour but also the silence and resilience needed to survive as a woman a man as lovers and as artists in a marketdriven world lola olufemis emexperiments in imagining otherwiseem from the independent hajar press is also an extraordinary book written with compassion fearlessness and determination to imagine a more equal world into being a joy to read and to think withp
pstrongjim cracestrongp
pa hrefhttpswwwnewstatesmancomculture202107whenwritersdrinkwilliam palmers emin love with hellema robinson is a masterful insiders account of how alcohol ruined and sustained the careers of 11 writers including kingsley amis dylan thomas and jean rhys with whom i endured an intoxicating lunch in 1974 it is a both sad and joyful reminder of why the british pub is such a lure but also why once trapped inside it is mostly wise to stick to just a single pint it also led me to the works of the greatest of all celebrants of bars and booze patrick hamilton is there a kinder wittier sharper tipsier novel than his wartime masterpiece emthe slaves of solitudeemp
pstrongalan johnsonstrongp
pits amazing how eruditely robert douglasfairhurst manages to illuminate our history through a microscopic focus on one brief period emthe turning pointem jonathan cape transports us to 1851 the books principal subjects are charles dickens as he embarks on embleak houseem and the crystal palace first assembled in all its sparkling glory for that years great exhibitionp
psince the publication of emfailures of stateem mudark in march the governments maladroit handling of covid19 has been exposed bya hrefhttpswwwnewstatesmancompoliticsbrexit202110howdominiccummingshasgiventheeutheperfectexcuseforbrexitrage dominic cummingsa willingly and a hrefhttpswwwnewstatesmancompolitics202106victorianewtonsdiaryhowthesungotitsmatthancockscoopmatt hancock aless so no account can match this forensic analysis by jonathan calvert and george arbuthnot who have presented us with a disturbing first draft of historyp
figure classwpblockimageimg sizesmaxwidth 803px 100vw 803px srchttpswwwnewstatesmancomwpcontentuploadssites2202111202146greatexhibitionjpg width803 alt srcsethttpswwwnewstatesmancomwpcontentuploadssites2202111202146greatexhibitionjpg 803w httpswwwnewstatesmancomwpcontentuploadssites2202111202146greatexhibition300x220jpg 300w httpswwwnewstatesmancomwpcontentuploadssites2202111202146greatexhibition768x564jpg 768w httpswwwnewstatesmancomwpcontentuploadssites2202111202146greatexhibition397x292jpg 397w httpswwwnewstatesmancomwpcontentuploadssites2202111202146greatexhibition180x132jpg 180w classwpimage246126 height590figcaptionthe great exhibition of 1851 is the backdrop for the turning point a year that changed dickens and the world image by iandagnall computing alamy figcaptionfigure
pstrongdavid reynoldsstrongp
pin emdevilland england under siege 15881688 emallen lane clare jackson offers a bracingly revisionist view of our history in the century after the armada viewed from across the channel angelland during this century of succession crises religious turmoil civil wars regicide and republican government looks like a failed state teetering between comedy and tragedy you may not buy the whole argument but after reading emdevillandem this sceptered isle and demiparadise is unlikely to look quite the same ever againp
pstrongpaul collierstrongp
pthe book that members of the labour party most need to read isa hrefhttpswwwnewstatesmancomculture202104dignitylabourjoncruddasupswingrobertputnamreview emthe dignity of labour emby jon cruddasa polity he understands why labour has lost the trust of the working class why isnt he in the shadow cabinet turning from politics to ideas the new book that i have found most insightful for my current research is matthew cobbs emthe idea of the brain emprofile it recounts how analogies between the brain and the fashionable technology of the era ours being the brain as a computer have repeatedly sent neuroscience down rabbitholesp
pstrongmelissa harrisonstrongp
pliterature lovers like me are fond of saying that reading promotes empathy it feels true though you might struggle to prove it however emthe devil you know emfaber amp faber by the forensic psychiatrist gwen adshead with eileen horne has permanently recalibrated my empathy dial as she helps offenders understand and take responsibility for their actions in the wake of terrible crimes adshead quietly humanely shows us that people remain people despite their actionsp
pin its aftermath i read gordon burns unforgettable emhappy like murderersem faber amp faber about fred and rose west and thought about the professionals tasked with working with them i hope they were supported in turnp
pstronggeoff dyerstrongp
pharald jahners emaftermathem wh allen is a transfixing account and subtle analysis of germany after the second world war has ended a scrupulous investigation of the past it reads constantly like a prelude to what is still unfolding but the greatest joy this year has come from my belated discovery of the dark light unexceptional and exquisitely twisted world of elizabeth taylor starting with ema game of hide and seek emand emangelem and continuing apace a shame that the pretty and bland covers of the latest virago reissues of this perennially underrated writer do little to lure new readers into the skewed delights withinp
pstrongsue prideauxstrongp
plocked down i craved perilous adventure julian sanctons emthe madhouse at the end of the earthem wh allen delivered the embelgicaems 1897 south pole expedition is pure horror clueless captain ratinfested ship frozen into the ice scurvy darkness hunger insanity lastditch escape young crewmember roald amundsen assumes captaincy and dynamites a channel through the ice no wonder he stuffed scot terrific stuffp
pso is emlooking for trouble emfaber amp faber the memoir of the trailblazing war correspondent virginia cowles taking tea with hitler gossiping with winston churchill eating reindeer with finnish guerrilla skiing squads reporting on everything objectively her writing is sparkling her life seen from envious lockdown completely thrillingp
figure classwpblockimageimg sizesmaxwidth 703px 100vw 703px srchttpswwwnewstatesmancomwpcontentuploadssites2202111202146arctic703x1024jpg width703 alt srcsethttpswwwnewstatesmancomwpcontentuploadssites2202111202146arctic703x1024jpg 703w httpswwwnewstatesmancomwpcontentuploadssites2202111202146arctic206x300jpg 206w httpswwwnewstatesmancomwpcontentuploadssites2202111202146arctic363x529jpg 363w httpswwwnewstatesmancomwpcontentuploadssites2202111202146arctic124x180jpg 124w httpswwwnewstatesmancomwpcontentuploadssites2202111202146arcticjpg 730w classwpimage246131 height1024figcaptionroald amundsen the first mate of the belgica on its 1897 south pole expedition photo from everett collection inc alamyfigcaptionfigure
pstrongrowan williamsstrongp
pfor me the choice is already made in any year in which a new book by alan garner is published emtreacle walkerem fourth estate is very much in garners late style spare and allusive a wealth of folkloric hinterland luminous and understated its about seeing and healing any more by way of summary would be useless nigel tubbss emsocrates on trialem bloomsbury is also about these things and is also built mostly through dialogue its an impassioned challenge to the stupidities of current educational practice from the uks best educational philosopher and it nails the basic problem as lying in our obsession with property the myth of knowledge as something we own and trade human freedom is the liberty to learn and in the process to be dispossessed of this fiction tubbs argues this with astonishing subtlety and nimblenessp
pstrongcolm tibnstrongp
pderek mahons emthe poems 19612020 emgallery books published a year after his death displays a rich talent formalist and casual witty and melancholy minimalist and expansive claire keegans emsmall things like theseem faber amp faber written with precision and rhythmic care is a story about an ordinary life in a small place and slowly becomes a brave and piercing exploration of a most difficult public matter emthe works of guillaume dustan volume 1 emsemiotext contains three short engrossing novels that centre on sharp and accurate descriptions of gay sex the sensibility and inner world of the protagonist emerging richly by implication this is a great book for gay boys on winter nightsp
pstronggary youngestrongp
pa hrefhttpswwwnewstatesmancomculture202106reviewedshortnewbooksdanielkahnemanmitchelldeannadifamohamedandrorynadifa mohameds emthe fortune menema viking is an elegant portrayal of life in the racial cultural hub of cardiffs tiger bay in the early fifties eschewing a simple morality play for complex vivid characters it centres on the plight of mahmood mattan who finds himself in the shadow of the hangmans noose for a murder he didnt commit amelia gentlemans emthe windrush betrayalem guardian faber sat on my shelf for far too long because i thought i knew the story i didnt at least i had not sat with it beyond the news cycles for the length of time necessary to witness the full scale of the injustice unfold in a single narrative thread a book that keeps you informed and makes you angryp
pstrongjoan bakewellstrongp
pemthe gun the ship and the penem by linda colley profile is an account of how constitutions have come about through history and is written with colleys usual erudition insight and style she transforms what sounds like the dry matter of paper documents into an enthralling account of how warfare national identity and colonial exploitation follow each other in the emergence of constitutions across the world a work of thrilling scholarshipp
pemspike the virus vs the peopleem by jeremy farrar with anjana ahuja profile tells how the news of covid19 first reached the worlds scientists how the pandemic unfolded and how governments reacted and failed to cope it reads like a thrillerp
pstrongcolin kiddstrongp
phow many serious books on politics are pitchperfect comic classics until this year i could think of only two edward luttwaks emcoup detat a practical handbookem and christopher hoods analysis of buck passing emthe blame gameem but these are now joined by a hrefhttpswwwnewstatesmancomculturebooks202109landslidefinaldaystrumpmichaelwolffreviewmichael wolffs emlandslideem abridge street press an account of the last days of the trump presidency the humour in luttwak and hood derives from the authors wry subtlety of approach wolff by contrast is the vessel into which the trump white houses chaotic marxbrothers cast of panicked but competitively craven staff and hangerson copiously leaks amid the anarchic din however wolff demonstrates exquisite groucholike timingp
pstrongfrances wilsonstrongp
ptwo bespoke studies of literary prophets stand out this year alex christofi describes emdostoevsky inem emloveem bloomsbury as a reconstructed memoir in which he blends dostoevskys autobiographical fiction with his fantastical life crafted with novelistic skill it is a book to fit the vast complexity of the man and his work in emwilliam blake vs the worldem weidenfeld amp nicolson john higgs argues that we have absorbed blake into our national consciousness without having the faintest idea of who he was or what he believed in higgss mission to return to the cockney visionary and his essential strangeness is blakeian in its singularityp
pstrongian lesliestrongp
pema swim in a pond in the rainem by george saunders bloomsbury consists of close commentaries on short stories by anton chekhov leo tolstoy ivan turgenev and nikolai gogol based on a creative writing course he teaches saunders approaches the stories as a fiction writer not a critic gently illuminating their mechanics without diminishing their magic or mystery and crucially the stories themselves are included saunders is warm playful and acutely perceptive and even when i disagreed with him i was grateful to him for making me pay such close attention to these inexhaustible worksp
pthis year i reread emwhite noiseem by a hrefhttpswwwnewstatesmancominternationalpolitics202010dondelillosechochamberdon delilloa picador and marvelled at its uncanny blend of ironic commentary on our mediasaturated world with deeply felt lyricism about marriage and family above all it made me laugh few great novels are as funnyp
pstrongsandeep parmarstrongp
pthree books that redefine what life writing means this year are stephanie syquias emamnion emgranta fred daguiars emyear of plaguesem carcanet and preti tanejas emaftermath emtransit books to be published in the uk by and other stories in 2022 syquias bold emknstlerromanem mesmerisingly transports us across continents and through the longing of diasporas arriving in england a deep boneknowing countryalbion daguiars electric prose vividly recounts a cancer diagnosis and treatment in the covid year a private suffering amid a collective one tanejas brave and haunting retelling of the terror attack at londons fishmongers hall in 2019 intermingles a cleareyed understanding of the roots of terror with personal stories of those involvedp
pim also deep in polina barskovas emair raid emugly duckling press translated by belarussianamerican poet valzhyna mort which retells the siege of leningrad with breathtaking interventions into history silence and the violence betweenp
pstrongpeter wilbystrongp
pdavid kynastons emon the cuspem bloomsbury the latest volume in his marvellous series on post1945 britain recalls the state of the nation in 1962 when the country was outside the eu but aspired to join he skilfully captures the sense of new horizons being glimpsed as britons struggled to escape the long shadow of the second world war and the state of the nation now for that i turned belatedly to a hrefhttpswwwnewstatesmancomculturebooks201911jonathancoemiddleenglandreviewjonathan coes novel emmiddle england emapenguin published in 2018 nothing has yet surpassed coes evocation of the sour restless resentful mood that in contrast to the spirit of the 1960s led britain to turn inwardsp
pstrongelif shafakstrongp
phassan akkads emhope not fear embluebird is an extraordinary story that deals with the urgent issues of our era including the syrian war systemic torture and dehumanisation ongoing in countries where authoritarianism has taken hold akkad also takes on the tragedy of the refugee crisis the pandemic and its social repercussions and the layers of xenophobia racism and inequality in societies but it is also a story about resilience renewal and humanismp
pi also recommend emburningem emthe booksem by richard ovenden john murray the director of the bodleian library this fascinating and moving book should be read at schools and translated into languages all around the world in a digital age that abounds with snippets of information this is a glorious celebration of physical libraries and nuanced knowledge p
pstrongalexander mccallsmithstrongp
pa scientific meal this year richard dawkins writes with admirable clarity and jana lenzov illustrates in much the same way their collaboration bears fruit in emflights of fancyem head of zeus a masterly investigation of all aspects of flight human and animal this is a beautifully produced book that will appeal across age groups and as a second course madelaine bhmes emancient bonesem greystone is a gripping account of how early hominids may have evolved in europe a controversial thesis but one that could change our ideas of where we came fromp
pstrongstuart maconiestrongp
pi began listening to susanna clarkes empiranesiem bloomsbury on audiobook at bedtime but soon found that it was simply too mesmerising funny and strange to ever lull me to sleep what begins as fantasy becomes in a series of hints and echoes and rugpulling revelations a detective story a satire and a witty take on male egoism daring and dazzling stuffp
ppaul morleys writing has been delighting and exasperating me since his emnmeem work in the late 1970s his biography of anthony h wilson tv presenter music entrepreneur and evangelist provocateur emfrom manchester with loveem faber amp faber is by far his best book the narrative of the mans life keeps morleys wildly digressive style tautish it is not just a biog but the story of a citys history and culture and a unique and disappearing figure the engaged workingclass intellectual challenging the dominance of entitlement and privilege with wit and aestheticsp
pstrongjohanna thomascorrstrongp
pit was a wonderful year for novels about ugly motherdaughter relationships gwendoline riley specialises in savage emotional reckonings and in emmy phantomsem granta we hear the story of bridget who has been keeping her perpetually disappointed mother hen at arms length ever since she left home the dialogue is superb theres always a tragicomic gap between what is being said and whats really going on i love rileys merciless wit jeremy coopers embolt from the blue emfitzcarraldo breathes new life into the epistolary novel with postcards charting 30 years of fraught relations between an earnest artist and her estranged mother who is miles more interested in sex than art very little actually happens in either book and yet i was gripped by the way each depicts the psychological battlefield of motherdaughter relationshipsp
pstrongdaisy johnsonstrongp
pemburntcoatem by sarah hall faber amp faber is a slim and beautiful masterpiece exploring art and relationships in a pandemic i felt it surging over my head lingering in my dreams troubling me even when i wasnt holding it hall has always had my heart when it comes to writing about sex and isolation but here she surpasses even herselfp
pemopen waterem by caleb azumah nelson viking is another slight book which wrestles with relationships and art the voice of the narrator feels almost mrs dallowayesque as it moves around london fluid and swift nelson has with this novella put down a new exciting marker for what fiction can achievep
pstrongwilliam dalrymplestrongp
palex rentons emblood legacy emcanongate is a moving timely wellwritten and strikingly thoughtful book that makes an important contribution to the growing debate about the horrors that accompanied britains empirebuilding rentons remarkably honest analysis of his own familys slave plantation papers and the darkness they contain highlights our continuing failure to acknowledge the extreme toxicity of so much of our imperial history it makes a good counterpart toa hrefhttpswwwnewstatesmancominternationalpolitics202102empirelandsathnamsangheranewageempirekehindeandrewsreview sathnam sangheras brilliant emempirelandema viking and like it reminds us how deeply impregnated the british present still is with our halfforgotten imperial pastp
pembetter to have goneem by akash kapur scribner is a forensic reconstruction of two deaths set against the background of the flawed tropical utopia of auroville it is beautifully written and structured deeply moving and realised in wise thoughtful chiselled prose in emriver kingsem william collins the scandinavian archaeologist cat jarman writes about the vikings with great skill clarity and narrative drive rather unfashionably jarman likes her vikings violent and her tale replete with witches human sacrifice greek fire and funeral orgies is at least as lively as any netflix viking romp and a great deal more intellectually satisfyingp
pstrongphilippe sandsstrongp
pin emspeak silenceem bloomsbury carole angiers extraordinary detective work on the life of wg sebald and her strikingly restrained prose combined to have me utterly gripped i had not fully appreciated the extent to which sebalds novels drew on his own life and experiences and those of others causing me to wonder even more than i usually do as a courtroom lawyer about the fabulous interplay between fact and fiction who knows what is real and what isnt utterly brilliantp
pstrongmelvyn braggstrongp
pcolm tibn has written magnificent fiction and equally magnificent books about writers of fiction his latest emthe magicianem viking recreates as biographical fiction the life thoughts and achievements of thomas mann it is dark beautifully constructed and i think as near as one author can get to entering the mind of anotherp
pin emklara and the sun emfaber amp faber kazuo ishiguro boldly sets out to create an artificial friend she is a robot with brilliantly realised human observations and convincingly emotions its wonderfulp
pstronggerry brakusstrongp
pive been eagerly awaiting emammaem the seventh and final chapter of the photographer vasantha yogananthans stunning longterm body of work inspired by the indian legend of the ramayana ema myth of two souls 20132021em published by chose commune yogananthan draws inspiration from the imagery associated with the myth and successfully brings this fascinating 2000yearold tale into modern life in emammaem mixed media photographs layered with brightly coloured paint bring spectacular colour and life to what is already moving and evocative imagery ive also really enjoyed anna ostoya and chantal mouffes empolitics and passions the stakes of democracyem mack a charming booklet with textual collages using an essay by mouffe a political theorist in which the writer critiques the politics of neoliberalism and warns of its dangersp
figure classwpblockimageimg sizesmaxwidth 1024px 100vw 1024px srchttpswwwnewstatesmancomwpcontentuploadssites2202111202146vasanthayogananthan1024x819jpg width1024 alt srcsethttpswwwnewstatesmancomwpcontentuploadssites2202111202146vasanthayogananthan1024x819jpg 1024w httpswwwnewstatesmancomwpcontentuploadssites2202111202146vasanthayogananthan300x240jpg 300w httpswwwnewstatesmancomwpcontentuploadssites2202111202146vasanthayogananthan768x614jpg 768w httpswwwnewstatesmancomwpcontentuploadssites2202111202146vasanthayogananthan397x317jpg 397w httpswwwnewstatesmancomwpcontentuploadssites2202111202146vasanthayogananthan180x144jpg 180w httpswwwnewstatesmancomwpcontentuploadssites2202111202146vasanthayogananthanjpg 1403w classwpimage246135 height819figcaptionindian myth and modernity from amma by the photographer vasantha yogananthanfigcaptionfigure
pstrongbrendan simmsstrongp
pthis year marks the centenary of the partition of what were then generally called the british isles with borders eastwest and northsouth this makes charles townshends emthe partition ireland divided 1885 1925em allen lane very topical paradoxically as this engrossing book makes clear the government of ireland act of 1920 which established home rule parliaments in the south and the north was intended by london not to divide the island but to keep it together the british government planned a home rule all round solution that would enable the 26 counties to remain linked to the rest of ireland as dominions within the empire it didnt turn out that wayp
pstrongjohn burnsidestrongp
pjonathan meadess empedro and ricky come again selected writing 19882020 emunbound is a feast of a book running to more than 900 pages of meades on everything from politics to mediocrity culture to lysergic acid utterly unmissable wonderfully incisive and funny as hell in complete contrast michael bracewells emsouvenirem white rabbit offers an impressionistic lyrical and haunting elegy for a predigital london full of fleeting visions and nearhallucinations of lost time just as the last echoes of modernism faded and the city slid into a present age made of the future and the past not the immediatep
pstrongrose tremainstrongp
pa hrefhttpswwwnewstatesmancomculturebooks202111bookerprizewinnerdamongalgutsouthafricaisnotacountrythatspeakswithonevoicedamon galguta is the most worthy winner of the booker prize weve seen for many years his novelem the promiseem chatto amp windus turns around the pledge made by the swarts a white south african farming family to grant ownership of a small house on their land to their longsuffering black maid salome the pledge is never kept and the lives of the neglectful quarrelsome swarts fall into ruin the book trembles in the hand with its political relevance for a gripping reread buy arnold weskers emthe birth of shylock and the death of zero mostelem quartet the story of how a production of weskers play emthe merchantem masterpiece or dud was assassinated on the new york stagep
pstrongrachel reevesstrongp
pbaroness hales autobiography emspider woman a life embodley head is a reminder of the huge but incomplete progress made by women in public life over the past 60 years the book tells some wonderful stories of her childhood as a swotty geek in north yorkshire of a fleet street wine bar that banned women from ordering drinks and of the origins of her spider brooch up close i have been struck by hales humility and intelligence her practical feminism and commitment to the rule of law her intelligence comes from a family that valued scholarship her feminism comes from the experience of women being paid less barred from some jobs and overlooked for others and her commitment to the law from a deep sense of public service the willingness to talk truth to power that she has shown is needed now more than everp
pstrongjonathan coestrongp
psometimes the most necessary books turn out to be the ones you didnt realise you needed before reading patrick wrights emthe sea view has me again emrepeater i had no idea that there was a hole in my life waiting to be filled by a 750page book about an east german writer and his tenyear selfimposed exile on the isle of sheppey during the 1970s but i was entirely captivated by this microscopic discursive study of uwe johnson a pioneering novelist who crossed the iron curtain but declined to fall at the feet of the capitalist west opting finally to settle himself and his family in sheerness apparently on the basis that it was the closest thing he could find to east germany without the stasi it is also a great book about the relationship between britain and the rest of europe and not a page too longp
pstrongkevin barrystrongp
pphilip ceallaigh is an irish writer long based in bucharest who writes short stories steeped in the russian tradition emtroubleem stinging fly press is his first collection in 12 years and it is thrillingly good every sentence bears tension and weight and in each story the narrative line feels so natural inevitable as if found rather than crafted rachel kushners dynamic incisive and glamorous prose style gives perfect expression to her reportage essays and criticism and emthe hard crowdem jonathan cape her first nonfiction collection is an exciting book she is a brilliant scenester she embeds she writes from the inside out and gives us the true story the real dealp
figure classwpblockimageimg sizesmaxwidth 1024px 100vw 1024px srchttpswwwnewstatesmancomwpcontentuploadssites2202111202146rachelkushner1024x684jpg width1024 alt srcsethttpswwwnewstatesmancomwpcontentuploadssites2202111202146rachelkushner1024x684jpg 1024w httpswwwnewstatesmancomwpcontentuploadssites2202111202146rachelkushner300x200jpg 300w httpswwwnewstatesmancomwpcontentuploadssites2202111202146rachelkushner768x513jpg 768w httpswwwnewstatesmancomwpcontentuploadssites2202111202146rachelkushner397x265jpg 397w httpswwwnewstatesmancomwpcontentuploadssites2202111202146rachelkushner180x120jpg 180w httpswwwnewstatesmancomwpcontentuploadssites2202111202146rachelkushnerjpg 1327w classwpimage246138 height684figcaptionscenester rachel kushner writes from the inside out inem the hard crowdem photo by ann summanew york timesreduxeyevinefigcaptionfigure
pstrongmichael brooksstrongp
pit would be easy to pick an important science book on climate change or the pandemic but were miserable enough already arent we my favourite escape from the news cycle this year was emmustnt grumbleem by graham lawton headline home it has a simple but ingenious premise were all a bit ill most of the time so what exactly is going on with our bodies lawton covers the science behind 100 mild ailments such as sore throats dead legs dark circles under the eyes and a cricked neck its not important but it is witty compelling and deeply informed the perfect guilty pleasurep
pstrongmelissa bennstrongp
pwhile never attracting a mass following vivian gornick has acquired a kind of cult status among sections of the independent literaryminded feminist left emtaking a long look essays on culture literature and feminism in our time emverso a collection of pieces published over the past 40 years ranges from essays on herman melville and hannah arendt to a consideration of the selfabsorption and emotional stupidity of that famous trio norman mailer saul bellow and philip roth when it comes to the representation of women gornick never deals the simplistic polemical blow instead she mines her own hardwon experience and profound and honest ambivalence about great writers with great flaws to illuminate their significance as well as our collective life and timesp
pstrongphilip hoarestrongp
pi find it hard to recommend michael bracewells emsouvenirem white rabbit because i wish id written it myself he perfectly encapsulates the transition of pop and art from the mid1970s to the early eighties when shops became clubs and clubs became utopias and the notion of modernity itself [was] reaching critical mass looking back to deserted london streets the now shocking notion of there being empty property in the city centre bracewell wraps his audenesque overcoat about him and asks could pop stop his answer is this deeply elegant essay of revolt and style there are no empty spaces to be filled with art or resistance now and we are left with our dreamsp
pstrongroger robinsonstrongp
phanif abdurraquibs ema little devil in americaem essays allen lane are so engrossing and at times moving that ive already read some of the essays more than a dozen times i have been a fan of his work since his last book of essays about the band a tribe called quest called emgo ahead in the rainem in his newest book the essays seem to bleed into the poetic abdurraqib also writes poetry so the informative blends easily with ideas moments and stories that move you a new poetic take on essays that i think changes the game in many waysp
pstrongdavid kynastonstrongp
pthe astonishingly welldocumented piece of autobiography emoxford undergraduate 19603 emprivately published available through amazon by the cambridge anthropologist alan macfarlane is not only a compelling slice of social history but also a fascinating portrait of an intellectually and spiritually restless young man starting to make sense of the world it is just one part of a remarkable multivolume project which i suspect will in time come to be seen as cumulatively a seminal work of autobiography occupying a different autobiographical terrain is michael chaplins enjoyable and sympathetic emnewcastle united stole my heart emhurst 60 years of supporting a club whose troubles may be only just beginningp
pstrongjohny pittsstrongp
pi read a lot of highminded literary fiction in 2021 but then right at the end of it along came emswan songsem repeater by the runcorn hiphop artist lee scott a bizarre bmovie of a book that feels fresher than anything ive read all year it is a surrealist story written in raw prose with flashes of moods and textures that call to mind andrea dunbar you either know these workingclass spaces the precarity or you dont for nonfiction i was impressed by tharik husseins emminarets in the mountainsem bradt a tour through the balkans unearthing islamic european history i appreciated the depth of his research and the lightness of touch in his many fascinating encountersp
pstrongmarina benjaminstrongp
pive picked books that stayed with me long after reading deborah levys emreal estateem hamish hamilton the final instalment of her lyrical autobiography struck me as the best of the three tender funny and exacting it circles around the idea of what makes a home as its itinerant author hops from place to place josh cohens emlosersem the latest essay from the zeitgeistnailing peninsula press offers a sparkling analysis of trump that manages to skewer its target using the most mellifluous prose and i loved emhigh as the waters rise emcatapult the debut novel by the german poet anja kampmann translated by anne posten an inner story of tenderness and delicacy it concerns an oil rig workers need to come to terms with the loss of his bunkmate and partner and so emerge from an inarticulate grief p
pi admired the way her simple sensual language builds complex compound meaning not unlike levy but here everything is layered and deeply submerged the sea a metaphor as ever for all we cannot knowp
pstrongrichard j evansstrongp
pthe history book ive enjoyed most this year has been emfallen idols twelve statues that made historyem by alex von tunzelmann headline its a timely well written and often entertaining look at statues that were pulled down not only in 2020s wave of iconoclasm but in other places and at other times too setting our inflamed culture wars in a broader context and injecting a muchneeded dose of common sense into the debate my other book of the year is emskyboundbra journey in flightem by rebecca loncraine picadorp
pi vividly remember teaching her as an undergraduate in london in the early 1990s and was horrified recently to discover she had died so young in 2016 in emskyboundem she reacts to her diagnosis of cancer by taking up gliding soaring ever higher over the welsh hills and eventually the himalayas transcending her illness in a text that is as poetic as it is inspirational p
pstrongkit de waalstrongp
pemempirelandem by sathnam sanghera viking is an important book and thats not a phrase to use lightly its an expos and a reminder of how conveniently the british have rewritten the past and buried the bones of their shame the bones are of course still poking through the soil dangerous stinking tripping us up and many of us live today with the legacy of slavery and empire emempirelandem is a necessary uncomfortable and illuminating read i loveda hrefhttpswwwnewstatesmancominternationalpolitics202010rainfallsandgloomincreasesireadslowlynotwantingmybookend emmayfliesem by andrew ohagana faber amp faber it is funny clever and desperately sad with a very serious message running through it about our right to die with dignity and how that affects those around us its also about male friendship leaving and coming home and unbreakable childhood bondsp
pstrongwilliam boydstrongp
ptwo superb biographies appeared this year one new one a valuable new edition richard zeniths monumental and exhaustive empessoa an experimental life emallen lane is the last word on this enigmatic modern figure the ts eliot of portuguese 20thcentury literature no one is better equipped than zenith to peel away the onionskins of personality from this astonishing poet and no one is better equipped than donald rayfield to write about chekhov his unsurpassable 1997 biography emanton chekhov a lifeem garnett press has been republished this year with a mass of new revelatory material you finish rayfields biography feeling that you knew chekhov as a close friend an astonishing achievementp
pstrongmichael moorcockstrongp
pmarshalling his exceptional skills of social observation and narrative britains finest modern essayist iain sinclair strikes south in emthe gold machineem oneworld travelling with his daughter farne he conducts an elegiac dialogue between generations and sinks into the deep past travelling back and forth in time through a rapidly changing peru on the trail of the mysterious arthur sinclair in fiction also doing some timetravelling alan warners emkitchenly 434em white rabbit is a profoundly complex comic elegy for the lost illusions of the 1960s and an entertaining read contemptuously impatient with the clichs of the rock and roll novelp
figure classwpblockimageimg sizesmaxwidth 1024px 100vw 1024px srchttpswwwnewstatesmancomwpcontentuploadssites2202111202146iansinclair1024x679jpg width1024 alt srcsethttpswwwnewstatesmancomwpcontentuploadssites2202111202146iansinclair1024x679jpg 1024w httpswwwnewstatesmancomwpcontentuploadssites2202111202146iansinclair300x199jpg 300w httpswwwnewstatesmancomwpcontentuploadssites2202111202146iansinclair768x509jpg 768w httpswwwnewstatesmancomwpcontentuploadssites2202111202146iansinclair397x263jpg 397w httpswwwnewstatesmancomwpcontentuploadssites2202111202146iansinclair180x119jpg 180w httpswwwnewstatesmancomwpcontentuploadssites2202111202146iansinclairjpg 1336w classwpimage246140 height679figcaptionculture clash ian sinclairs emthe gold machineem is a journey into colonial historyfigcaptionfigure
pstronganjana ahujastrongp
pdeservedly shortlisted for multiple prizes emempire of pain emby patrick radden keefe picador chronicles the us opioid crisis through the rise and fall of the sackler dynasty who grew rich on it the story begins with arthur sackler a physician with a gift for selling who roped his two younger doctor brothers into businessp
pin the 1950s they bought what would become purdue pharma it later sold oxycontin a blockbuster painkiller with a slowrelease formulation vulnerable to tampering the sacklers better known for philanthropy reaped billions as americans succumbed to an epidemic of addiction and overdosing keefe turns a mountain of material some delivered to him anonymously into an addictive tale of greed regulatory failings expensive lawsuits and a cold lack of remorsep
pstrongwilliam daviesstrongp
pno doubt there will be plenty more books written about both britains horrifying covid experiences and the appalling track record of the johnson administration but emfailures of stateem by jonathan calvert and george arbuthnott mudlark an early audit produced by members of the emsunday times eminvestigative journalism team will surely go down as one of the most devastating and harrowing when a prime minister specialises in distraction and avoidance of responsibility books such as this tracking the serial policy failures and tens of thousands of avoidable deaths are an invaluable contribution to whats left of britains public sphere if were to avoid becoming blas in the face of epic failures we must retain the capacity to be shocked and this is a shocking bookp
pstronglyndsey stonebridgestrongp
pin a year that has been so much about unfreedom especially for women a hrefhttpswwwnewstatesmancomculturebooks202105deborahlevyanddomesticdeborah levys emreal estateem ahamish hamilton and lea ypis emfree coming of age at the end of history emallen lane two books about new kinds of freedom were especially welcome emreal estateem published two months after the murder of sarah everard is a wise lyrical and wickedly nourishing affirmation of womens rights to a home in the world that is not gated by the rules of men ypis deliciously smart memoir of her albanian girlhood at the end of the cold war is a brilliant disquisition on the meanings of freedom its lures false hopes disappointments and possibilities in our timep
pstrongbruno maesstrongp
pamitav ghosh begins emthe nutmegs curseem john murray with the story of the nutmeg the spice from the banda islands in eastern indonesia around whose production and trade the networks of modern capitalism may be said to have originated starting from the surface of todays climate and geopolitical crises ghosh takes us back in time to the birth of a set of extreme ideas we take for granted but which now threaten the very continuity of the speciesp
pemthe nutmegs curse emis the creation of a literary mind linking historical and philosophical themes through the small details and analogies that are the fabric of every good storyp
pstrongsimon winderstrongp
pin our current state so many major cultural events went unnoticed one of these was oxford university presss achievement in completing new translations of all 20 of mile zolas emles rougonmacquartem novels here at last is the entire frenzied family saga not just emgerminalem and the other great jeremiads but also wonderful satires such as empot luck emand emthe conquest of plassans emand bananas erotic oddities like emthe sin of abb mouretem the fatalism can become unintentionally comic but have any other novels been quite so crammed with prurience grotesquery and crazed ambition with such a sense of landscape the sea the fields the city as the malevolent crusher of human hopep
pstrongkatrina forresterstrongp
pits been a hard year for workers but a good one for books about work and capitalism three stand out amelia horgans emlost in work empluto press gives a perceptive philosophical account of what work is what it does to us and how we can reorganise it destin jenkins emthe bonds of inequality emuniversity of chicago press tells the story of how debt finance and racial capitalism are intertwined in americas cities in an amazing history of bankers bond markets and racial inequalities in san francisco and in emtheory of the gimmickem belknap press sianne ngai exposes capitalisms tricks in her mindblowing study of the time and laboursaving devices we call gimmicksp
pstrongjonathan powellstrongp
pone book looking back and one looking forwarda hrefhttpswwwnewstatesmancominternationalpolitics202102empirelandsathnamsangheranewageempirekehindeandrewsreview emempirelandem by sathnam sanghera aviking is a salutary reminder of the dark side of our past i spend my time trying to help resolve armed conflicts from myanmar to nigeria that are largely caused by the crass errors of our ancestors it helps to understand how those came abouta hrefhttpswwwnewstatesmancomculture202102howishigurorewrotehimself emklara and the sunem by the nobel laureate kazuo ishiguro afaber amp faber tackles the key question of our future how are we going to live with ai and how will it transform our lives in the most unexpected ways sometimes novels bring these challenges to life much better than non fictionp
pstronglea ypistrongp
pmark mazowers emthe greek revolution 1821 and the making of modern europe emallen lane is a gripping story of the complicated and unlikely creation of the modern greek state but it is also so much more with vivid detail impeccable scholarship and great nuance mazower shows how the modern idea of the nation emerges out of the complex sometimes random and often messy interactions between a plurality of agents local regional and imperial each acting for different motives and in pursuit of contrasting purposes an illuminating account of both the unifying power of myths about the past and the dangers inherent when such myths are connected to political realityp
pstrongmusa okwongastrongp
pthe most compelling book i have read this year is emmadgermanesem a graphic novel by birgit weyhe translated by katy derbyshire vampq books its the story of people who arrived in east germany from mozambique in the 1980s to find work and maybe love and who were instead confronted with racism in their new home and then heartbreaking indifference when many of them returned told from three perspectives its a tale of grief resilience loss and hope i loved itp
pstrongolivia laingstrongp
peverything that philip hoare writes is bewitching and i fell hook line and sinker for emalbert and the whale emfourth estate a kind of treasure hunt in search of the german renaissance painter albrecht drer and the wonders that he saw as for fiction nothing beat emsecond place emfaber amp faber a hrefhttpswwwnewstatesmancomculturebooks202105rachelcusksecondplacereviewrachel cusksa tautly composed tale of creativity and power i loved the debut novel emthree roomsem by jo hamya jonathan cape too a beautiful furious encapsulation of generation rent and i lost a good week to the penguin reissue of len deightons spy novels top of the pile emssgbem his brilliantly grim counterfactual of britain under nazi rulep
figure classwpblockimageimg sizesmaxwidth 674px 100vw 674px srchttpswwwnewstatesmancomwpcontentuploadssites2202111202146albrechtdurerjpg width674 alt srcsethttpswwwnewstatesmancomwpcontentuploadssites2202111202146albrechtdurerjpg 674w httpswwwnewstatesmancomwpcontentuploadssites2202111202146albrechtdurer228x300jpg 228w httpswwwnewstatesmancomwpcontentuploadssites2202111202146albrechtdurer397x522jpg 397w httpswwwnewstatesmancomwpcontentuploadssites2202111202146albrechtdurer137x180jpg 137w classwpimage246143 height886figcaptionin search of the artist a self portrait by drer the subject of philip hoares emalbert and the whaleemfigcaptionfigure
pstrongthomas meaneystrongp
pjoshua cohens emthe netanyahusem fitzcarraldo editions plunges the american campus novel to an ecstatic extreme fiction outfoxes history and leaves little doubt that cohen is philip roths more original heir pierre charbonnier has helped map the future of intellectual history with emaffluence and freedomem polity in which he presents not a history of environmental ideas but an environmental history of ideas the result is an extensive invigilation of modern political thought with the material world in the unavoidable foregroundp
pstrongerica wagnerstrongp
pmy book of the year is alan garners emtreacle walker emfourth estate this seemingly brief tale is a hypnotic wonder blurring the boundaries of time and spirit garner is 87 now his latest book sparks against his earlier masterpieces and is a glorious wonder in its own right here is real magic between hard coversp
pstrongmichael rosenstrongp
pi like it when people do the job for me of gathering together examples of languageuse that i had noticed were absurd excessive or extraordinary but didnt bother to jot down some of the stuff in amanda montells emcultish the language of fanaticismem harperwave is about the linguistic lengths pr outfits will go to lure you into keeping fit or buying tupperware more seriously and tragically there is thoughtful commentary on the lethal selfdestructive cults that led to notorious massacres the book teases away at that old conundrum of whether its the language thats doing the luring or our minds offering up fertile ground in which the cults can sow their seedsp
pstrongjeremy cliffestrongp
pthe book that has stuck with me most is the novel emoccupationem by the brazilian writer julin fuks published by charco press in daniel hahns vivid translation fuks won fame with his 2015 hit emresistanceem melding wg sebalds sense of a notquitedead past with ben lerners metafictional blurring of author and narrator now his alter ego sebastian a fellow son of argentinian psychiatrists who fled to brazil returns to braid the stories of refugees in an abandoned so paulo hotel with those of his wifes pregnancy and his fathers illness this meditation on life at its start and its end on trauma and resilience appeared in its portuguese original in 2019 but is uncannily apt in a time of pandemic and new social and political fractures in brazil and globallyp
pstrongfintan otoolestrongp
pclaire keegans emsmall things like theseem faber amp faber could be called a novella but it feels much more like an epic distilled down to a single potent essence within the story of an ordinary man a coal merchant in a provincial town in 1980s ireland there is a deep family history a finely etched portrait of a society a glimpse into the heart of darkness that was the magdalene laundry system a moving reflection on moral choice and a quietly brilliant artistry colm tibns emthe magicianem viking uses the life of thomas mann to explore the complex relationships between intimacy and history public and private lives and the slippery nature of creativity itself i found it mesmerisingp
pstrongvince cablestrongp
pas a a hrefhttpswwwnewstatesmancomculturebooks202101prosestylejohnlecarrjohn le carra addict i rushed to the bookshop to buy a hrefhttpswwwnewstatesmancomculturebooks202110silverviewjohnlecarrereviewemsilverviewem aviking his latest and last book nothing will ever match the cold war spy novels written in his prime but his later work illuminates themes of loyalty betrayal and conflicting values in a modern contextp
pema room made of leavesem by kate granville canongate is a beautifully written piece of faction about the hidden history of women whose achievements were overshadowed by domineering men and the ugly history of early colonial settlement in australia and the crooked men who became its heroes granville tackles her dual subjects without being preachy or worthyp
pstrongrichard lloyd parrystrongp
pa hrefhttpswwwnewstatesmancomculture202106reviewedshortnewtitlesjamesdaviestraviselboroughdavidpeaceanddavidemtokyo reduxem by david peacea faber amp faber the third novel in his extraordinary tokyo trilogy has the qualities familiar to his admirers formal boldness and complexity a powerful sense of place tenderness and humanity and a gift for character but it is also straightforwardly enjoyable a murky crime mystery emerging from the slimy entrails of us occupationera japan emspeak silence in search of wg sebaldem by carole angier bloomsbury is a biography hobbled by the noncooperation of the subjects widow and daughter whose names dont even appear in its index it manages nonetheless to be a gripping account of the life and lies of one of the 21st centurys greatest authorsp
pstrongleo robsonstrongp
pin a memorable year two extraordinary books stood above the rest both are accounts of being the watchful highly literate daughter of differently imperfect parents both are written by authors surely close to the peak of their abilities with honesty humour and ravishing phrasemaking talent one is a memoir with elements of invention the other a novel that may or may not have an autobiographical basis but for all these similarities they are utterly different in tone milieu and approach a hrefhttpswwwnewstatesmancomculture202107marinawarnerivealwaysfounditveryhardknowwhatimmarina warnersem inventory of a life mislaidem william collins aand gwendoline rileys emmy phantoms emgrantap
pstrongmegan nolanstrongp
puntil i read ema calling for charlie barnesem viking joshua ferriss virtuosic third novel i couldnt recall the last time a book caused me to both laugh and gasp aloud madly funny and bristling with intelligence this is the story of a man in later life wallowing in the detritus of the american dream and of the children witnessing his decline i rarely enjoy adult novels told from the perspective of children for similar reasons that i struggle to watch child actors there is an inevitable sense of artifice emheavenem picador the first novel by mieko kawakami translated by sam bett and david boyd is a brilliant rejoinder to my reticence this captivating quietly devastating book is about the relationship between two school misfits the same vulnerabilities that expose them to their tormentors allow them to see one another with a pure sort of attention p
pstrongrose georgestrongp
pfor pleasure reading i want warmth and pace and narrative and a steady hand not sentences that have their eyes on prizes will dean a man with impossibly luxurious hair who lives in a swedish forest is known for his tuva moodyson crime fiction series tuva a deaf journalist is a great character but her adventures can get repetitive there is nothing repetitive about emthe last thing to burnem hodder amp stoughton an astonishing standalone from dean in which a young vietnamese woman lives an appallingly coerced life with a brute called lenn dean gets the voices chillingly right the tension rises as inevitably as the claustrophobic pressure draws in and jane is a woman who you want to triumph at whatever cost this novel will make your skin crawl with fury at the insidious violence of menp
pstrongmichael prodgerstrongp
pcynthia saltzmans emnapoleons plunderem thames amp hudson is a thrilling and chilling account of cultural despoliation with veroneses huge purloined painting of emthe wedding feast at canaem at the centre of her varied narratives she describes how bonaparte looted italys art to buff up his own glory pilfering aside our current leaders are missing a trick in emthe kings painter the life and times of hans holbein emhead of zeus franny moyle has gathered the relatively few facts known about the portraitist and combined them adroitly with the wealth of material about henrician england to show how a basel native became our great national painterp
pstrongrichard seymourstrongp
phannah zeavins remarkable emthe distance cure a history of teletherapyem mit press disinters the history of longdistance psychoanalysis from freuds selfanalysis in correspondence with physician wilhelm fliess to the mass communication of psychoanalysis through radio to suicide hotlines and the use of videocalling to treat patients during the pandemic psychoanalysis has rarely reflected on this history because from its foundations when freud was fascinated with telepathy it was gripped by a fantasy of mediumless communication but zeavin shows the analytic relationship always needs mediation ritual appointments money all create the distanced intimacy across which the undercurrents of fantasy and transference flow and what is true of the analytic relationship is also true differently of all relationshipsp
pstrongsimon winchesterstrongp
ptwo discoveries this past year to charm and delight richard zeniths magisterial account of the life of the deliciously mad fernando pessoa allen lane who wrote books and stories under some 60 pseudonyms and left more than 25000 essays in a locked cabin trunk to be discovered in lisbon and turned into pessoa one of the great literary biographies of the century so far and while all america waits for the 86yearold robert caro to complete the fifth and final volume of his stupendous life of lyndon b johnson can he possibly manage after 40 years at it we learn from a chat the name of his favourite novelist no less than the almost forgotten masterstoryteller nevil shute i used to borrow his books from boots now they are nearimpossible to find maybe bob caros unanticipated endorsement from across the atlantic will help hasten them back truly great yarns every onep
pstrongsamuel moynstrongp
pa civilisation scrubbed to be shiny requires sweeping the moral filth under the rug as eyal press shows though brilliant reporting and exquisite writing in in emdirty work emfarrar straus and giroux published in the uk by head of zeus in 2022 i was initially drawn in because the passages on armed drone operators pursue the obverse of my own argument in my new book emhumaneem that the new forms of american war are increasingly clean hiding our unseemly requirements by foisting essential labour a hrefhttpswwwnewstatesmancomculture202105loveanimalshumanshapedworldhenrymancereviewanimal slaughtera and prison work in presss other examples on those who are often looked down upon for doing it does not mean we are morally uninvolved in tasks done in our name and for our sakesp
pemfor more choices visit a hrefhttpnewstatesmancombooksnewstatesmancoukbooksaemp
pemthe new statesmans 20 best books of 2021 will appear in the 10 december issueemp | pstronghilary mantelstrongp pin 1990s hrefhttpswwwnewstatesmancominternationalpolitics202104stephenbushmusaokwongaoneofthemmusa okwonga ugandan scholarship boy etona school turned scores politicians bertie wooster captain hook memoir emone themem unbound sheds light present disconnect govern suffer consequencesp pclaire keegans novel emsmall things like theseem faber amp faber wastes word depiction small irish town guilty collective blindness nuns run training school young women keegan exquisite writer enclose volumes social history luminous phrasep pstronga hrefhttpswwwnewstatesmancomthecultureinterview202110thedoublelifeofianrankinian rankinastrongp pemhydeem craig russell constable set 19thcentury edinburgh detective called hyde hunt ghoulish possibly occult serial killer wrestling demons including mood swings blackouts ingenious slice gothic newwith jekyll hyde trope emhydeem bestscottish crime novel 2021 according mcilvanney prize wont hold itp pin emthe beresfordem carver orenda books mazelike boardinghouse scene carnage tenants dispatched grisly fashion going bring end bloodshed carver writes tradition theatre absurd added grue shocking compulsive persuasive hell ride mind jump aboardp pstronga hrefhttpswwwnewstatesmancompolitics202106bernardineevaristobritishschoolssidelinewritersofcolourbernardine evaristoastrongp pjoelle taylor produced astonishing original poetry collections recent years emcnto amp othered poemsem westbourne press partly autobiographical exploration lives butch lesbian counterculture challenges imprisoning notions womanhood celebrating foregrounding face hostile society true themselvesp palso taking new literary territory impressive debuts empoorem hrefhttpswwwnewstatesmancomcultureobservations202010calebfeminorthpeckhamestatepolicepoetryteachingcaleb femia penguin zooms lives young black men south london housing estate childhood caleb azumah nelsons novel emopen waterem viking short poetic intellectual meditation art relationship young couple peckham south london primary backdropp pstronged smithstrongp pi read empowers thrones new history middle agesem dan jones head zeus emthe world according colourem james fox allen lane tandem like watching great complementary halfbacks rugby jones drives story upfield empires come religions form break ideas clash mingle 1100 years 16 sweeping chapters 700 pacey pages hes arms aloft hes scored posts masterly muscular direct gareth edwards flowp pin contrast fox glides intellectual spaces colour philosophical feast astrophysics origins civilisation palette moral associations dazzling point fox shoots scores coming suddenly pieces fit meant barry john running spacep pstrongphilip pullmanstrongp pin 2009 iain mcgilchrist published emthe master emissaryem densely researched entirely thrilling examination difference kinds thinking typical right left hemispheres brain comes new book emthe matter thingsem yale university press takes basic idea demonstrates immense range learning beautifully clear prose important aware merely parts analysis come insight righthemisphere thinking openness experience better guide reality narrowly focused rulebased way left hemisphere regards worldp pi spent decade absorbing vision mcgilchrists previous book shall happy spend rest life learning things endp pstrongdamon galgutstrongp pmost reading retrospective dont read lot stuff thats recently published like wait dust settle claire keegans new novella emsmall things like theseem faber amp faber absolutely exquisite work exceptionalp pi liked emburntcoatem hrefhttpswwwnewstatesmancomculture201707sarahhallsdarkshortstoriesarefragmentsliveswrenchedoutalignmentsarah halla faber amp faber think shes marvellous writer usedbrthe scenario unnamed plague lockdown sets create psychological mystery probably going new genre covid fiction opening hall right vanguardp pstrongmarina warnerstrongp pas lived isolated lockdown found hrefhttpswwwnewstatesmancomculture202102howishigurorewrotehimselfkazuo ishiguros emklara sunemaem emfaber amp faber artificial friend destined slow fade uniquely poignant prescient pandemic cut short run emthe botanical mind art mysticism cosmic treeem camden arts centre london curators gina buenfeld martin clark produced feast book exploring visionary tradition continents centuries emswirl wordsswirl worlds poems 94 languages spoken london empeer poet editor stephen watts draws hear citys magnificent hubbubp pstrongdavid harestrongp pemninth street women emback bayem emis 700 pages long need lots time read think mary gabriel recreates extraordinary moment 1950s greenwich village helen frankenthaler joan mitchell grace hartigan elaine de kooning lee krasner young painters came unforeseen fame fortune book entertaining inspiringp praven leilani debut novel ema hrefhttpswwwnewstatesmancomculturebooks202101nsrecommendsnewbooksbryanwashingtonjontyclaypoleravenleilaniandluster aempicador makes fun supersmart people perverse im sure wholly understood intent oh goodness writing beautifulp pstrongjohn graystrongp pthe book engrossed year emcontinents exileem penguin modern classics 12volume memoir indianborn writer ved mehta 19342021 lost sight age suffering meningitis went try live far possible fully sighted person series supreme works modern autobiography sense homelessness mehtas story joy life followed early years family india school blind arkansas pomona college california balliol college oxford harvard 33 years writer william shawns emnew yorkerem mehtas turbulent romances years psychoanalysis travails building house island maine coast hidden father came light new york party complete absorbing account astonishing lifep pstrongmark cockerstrongp pgreat field guides rare species best portals richer relationship rest life exceptional groundbreaking books appeared single year emeuropes birds identification guideem rob hume robert andy swash hugh harrop paul brocks embritains insects field guide insects great britain irelandem princeton university press models compression synthesising mountain fresh data easytouse format beautiful hold ponder glorious piece political advocacy chosen organismsp pstronglucy hugheshallettstrongp pi proud shortlist judges chose 2021 international booker prize books loved didnt cut ema perfect cemeteryem charco press collection haunting witty stories argentinian writer federico falco philippe claudels emdog island emmaclehose press parable modern migration kind detective story mikhail bulgakov written visionary darkly humorous p pmy favourite novel year reissue elspeth barkers emo caledonia emweidenfeld amp nicolsonemem book outrageous clever teenaged heroine fiercely gothic constantly surprising wildly funnyp pstrongmark haddonstrongp pive unwell past year reading impossible consequently usually grateful books drew held emthe prophets emby robert jones juniorem emriverrun gripping luminous novel tangled lives louisiana plantation centring enslaved teenage lovers samuel isiah reviews invoking toni morrison absolutely justifiedp pemthe idea brainem matthew cobb profile thrilling history rapidly expanding understanding brain better having theoretical axe grind explores fundamental role metaphor neuroscientific theory brain system hydraulics brain telegraph network unique challenges faced trying understand object like universep pstrongjason cowleystrongp pi admired cool restrained style katie kitamuras emintimacies emjonathan cape probes tangled emotional life young unnamed americanjapanese woman working translator international criminal court hague novel exercise selferasure mysterious compellingp pi loved jonathan bates embright star green light emwilliam collins deeply romantic exploration work parallel lives john keats f scott fitzgerald destined die young enraptured beauty beautys inevitable lossp pstrongali smithstrongp pits hard hold copy eileen agars memoir ema look life emmethuen published 1988 read year couldnt london whitechapel retrospective work book spirited funny candid irreverent textured cornucopic art begins head tumbled mother december 1899 ends hope die sparkling moment agar makes fleeting appearance jennifer higgies brilliant emthe mirror paletteem weidenfeld amp nicolson reveals untilnow hidden history womens selfportraiture pretty cornucopic gift keeps givingp pbut book year debut slim collection poetry called emforty names emcarcanet young afghani poet parwana fayyaz wanted knowwhat real story clear unruined water courageous poet times haunting brutal history records marvellously summoned lives celebrates calm reclamation tour de forcep pstrongnicola sturgeonstrongp pspanning globe century emgreat circle emby maggie shipstead doubleday epic tale daring adventure character determination fearless women living different times connected fate inspiring entertaining hugely enjoyed novelp pi love colm tibn written andem magicianem viking masterpiece rise nazi germany horrors second world war viewed eyes experiences complicated multilayered writer nobel prize winner thomas mann historical fiction bestp pstrongpreti tanejastrongp pniven govindens emdiary filmem dialogue books novel cinema age gender fame creativity infused spirit federico fellini luca guadagnino stole heart year set international film festival jaded director launch masterpiece told person extended conversation nights captures sense fragility intimacy human endeavour silence resilience needed survive woman man lovers artists marketdriven world lola olufemis emexperiments imagining otherwiseem independent hajar press extraordinary book written compassion fearlessness determination imagine equal world joy read think withp pstrongjim cracestrongp pa hrefhttpswwwnewstatesmancomculture202107whenwritersdrinkwilliam palmers emin love hellema robinson masterful insiders account alcohol ruined sustained careers 11 writers including kingsley amis dylan thomas jean rhys endured intoxicating lunch 1974 sad joyful reminder british pub lure trapped inside wise stick single pint led works greatest celebrants bars booze patrick hamilton kinder wittier sharper tipsier novel wartime masterpiece emthe slaves solitudeemp pstrongalan johnsonstrongp pits amazing eruditely robert douglasfairhurst manages illuminate history microscopic focus brief period emthe turning pointem jonathan cape transports 1851 books principal subjects charles dickens embarks embleak houseem crystal palace assembled sparkling glory years great exhibitionp psince publication emfailures stateem mudark march governments maladroit handling covid19 exposed bya hrefhttpswwwnewstatesmancompoliticsbrexit202110howdominiccummingshasgiventheeutheperfectexcuseforbrexitrage dominic cummingsa willingly hrefhttpswwwnewstatesmancompolitics202106victorianewtonsdiaryhowthesungotitsmatthancockscoopmatt hancock aless account match forensic analysis jonathan calvert george arbuthnot presented disturbing draft historyp figure classwpblockimageimg sizesmaxwidth 803px 100vw 803px srchttpswwwnewstatesmancomwpcontentuploadssites2202111202146greatexhibitionjpg width803 alt srcsethttpswwwnewstatesmancomwpcontentuploadssites2202111202146greatexhibitionjpg 803w httpswwwnewstatesmancomwpcontentuploadssites2202111202146greatexhibition300x220jpg 300w httpswwwnewstatesmancomwpcontentuploadssites2202111202146greatexhibition768x564jpg 768w httpswwwnewstatesmancomwpcontentuploadssites2202111202146greatexhibition397x292jpg 397w httpswwwnewstatesmancomwpcontentuploadssites2202111202146greatexhibition180x132jpg 180w classwpimage246126 height590figcaptionthe great exhibition 1851 backdrop turning point year changed dickens world image iandagnall computing alamy figcaptionfigure pstrongdavid reynoldsstrongp pin emdevilland england siege 15881688 emallen lane clare jackson offers bracingly revisionist view history century armada viewed channel angelland century succession crises religious turmoil civil wars regicide republican government looks like failed state teetering comedy tragedy buy argument reading emdevillandem sceptered isle demiparadise unlikely look againp pstrongpaul collierstrongp pthe book members labour party need read isa hrefhttpswwwnewstatesmancomculture202104dignitylabourjoncruddasupswingrobertputnamreview emthe dignity labour emby jon cruddasa polity understands labour lost trust working class isnt shadow cabinet turning politics ideas new book found insightful current research matthew cobbs emthe idea brain emprofile recounts analogies brain fashionable technology era brain computer repeatedly sent neuroscience rabbitholesp pstrongmelissa harrisonstrongp pliterature lovers like fond saying reading promotes empathy feels true struggle prove emthe devil know emfaber amp faber forensic psychiatrist gwen adshead eileen horne permanently recalibrated empathy dial helps offenders understand responsibility actions wake terrible crimes adshead quietly humanely shows people remain people despite actionsp pin aftermath read gordon burns unforgettable emhappy like murderersem faber amp faber fred rose west thought professionals tasked working hope supported turnp pstronggeoff dyerstrongp pharald jahners emaftermathem wh allen transfixing account subtle analysis germany second world war ended scrupulous investigation past reads constantly like prelude unfolding greatest joy year come belated discovery dark light unexceptional exquisitely twisted world elizabeth taylor starting ema game hide seek emand emangelem continuing apace shame pretty bland covers latest virago reissues perennially underrated writer little lure new readers skewed delights withinp pstrongsue prideauxstrongp plocked craved perilous adventure julian sanctons emthe madhouse end earthem wh allen delivered embelgicaems 1897 south pole expedition pure horror clueless captain ratinfested ship frozen ice scurvy darkness hunger insanity lastditch escape young crewmember roald amundsen assumes captaincy dynamites channel ice wonder stuffed scot terrific stuffp pso emlooking trouble emfaber amp faber memoir trailblazing war correspondent virginia cowles taking tea hitler gossiping winston churchill eating reindeer finnish guerrilla skiing squads reporting objectively writing sparkling life seen envious lockdown completely thrillingp figure classwpblockimageimg sizesmaxwidth 703px 100vw 703px srchttpswwwnewstatesmancomwpcontentuploadssites2202111202146arctic703x1024jpg width703 alt srcsethttpswwwnewstatesmancomwpcontentuploadssites2202111202146arctic703x1024jpg 703w httpswwwnewstatesmancomwpcontentuploadssites2202111202146arctic206x300jpg 206w httpswwwnewstatesmancomwpcontentuploadssites2202111202146arctic363x529jpg 363w httpswwwnewstatesmancomwpcontentuploadssites2202111202146arctic124x180jpg 124w httpswwwnewstatesmancomwpcontentuploadssites2202111202146arcticjpg 730w classwpimage246131 height1024figcaptionroald amundsen mate belgica 1897 south pole expedition photo everett collection inc alamyfigcaptionfigure pstrongrowan williamsstrongp pfor choice year new book alan garner published emtreacle walkerem fourth estate garners late style spare allusive wealth folkloric hinterland luminous understated seeing healing way summary useless nigel tubbss emsocrates trialem bloomsbury things built dialogue impassioned challenge stupidities current educational practice uks best educational philosopher nails basic problem lying obsession property myth knowledge trade human freedom liberty learn process dispossessed fiction tubbs argues astonishing subtlety nimblenessp pstrongcolm tibnstrongp pderek mahons emthe poems 19612020 emgallery books published year death displays rich talent formalist casual witty melancholy minimalist expansive claire keegans emsmall things like theseem faber amp faber written precision rhythmic care story ordinary life small place slowly brave piercing exploration difficult public matter emthe works guillaume dustan volume 1 emsemiotext contains short engrossing novels centre sharp accurate descriptions gay sex sensibility inner world protagonist emerging richly implication great book gay boys winter nightsp pstronggary youngestrongp pa hrefhttpswwwnewstatesmancomculture202106reviewedshortnewbooksdanielkahnemanmitchelldeannadifamohamedandrorynadifa mohameds emthe fortune menema viking elegant portrayal life racial cultural hub cardiffs tiger bay early fifties eschewing simple morality play complex vivid characters centres plight mahmood mattan finds shadow hangmans noose murder didnt commit amelia gentlemans emthe windrush betrayalem guardian faber sat shelf far long thought knew story didnt sat news cycles length time necessary witness scale injustice unfold single narrative thread book keeps informed makes angryp pstrongjoan bakewellstrongp pemthe gun ship penem linda colley profile account constitutions come history written colleys usual erudition insight style transforms sounds like dry matter paper documents enthralling account warfare national identity colonial exploitation follow emergence constitutions world work thrilling scholarshipp pemspike virus vs peopleem jeremy farrar anjana ahuja profile tells news covid19 reached worlds scientists pandemic unfolded governments reacted failed cope reads like thrillerp pstrongcolin kiddstrongp phow books politics pitchperfect comic classics year think edward luttwaks emcoup detat practical handbookem christopher hoods analysis buck passing emthe blame gameem joined hrefhttpswwwnewstatesmancomculturebooks202109landslidefinaldaystrumpmichaelwolffreviewmichael wolffs emlandslideem abridge street press account days trump presidency humour luttwak hood derives authors wry subtlety approach wolff contrast vessel trump white houses chaotic marxbrothers cast panicked competitively craven staff hangerson copiously leaks amid anarchic din wolff demonstrates exquisite groucholike timingp pstrongfrances wilsonstrongp ptwo bespoke studies literary prophets stand year alex christofi describes emdostoevsky inem emloveem bloomsbury reconstructed memoir blends dostoevskys autobiographical fiction fantastical life crafted novelistic skill book fit vast complexity man work emwilliam blake vs worldem weidenfeld amp nicolson john higgs argues absorbed blake national consciousness having faintest idea believed higgss mission return cockney visionary essential strangeness blakeian singularityp pstrongian lesliestrongp pema swim pond rainem george saunders bloomsbury consists close commentaries short stories anton chekhov leo tolstoy ivan turgenev nikolai gogol based creative writing course teaches saunders approaches stories fiction writer critic gently illuminating mechanics diminishing magic mystery crucially stories included saunders warm playful acutely perceptive disagreed grateful making pay close attention inexhaustible worksp pthis year reread emwhite noiseem hrefhttpswwwnewstatesmancominternationalpolitics202010dondelillosechochamberdon delilloa picador marvelled uncanny blend ironic commentary mediasaturated world deeply felt lyricism marriage family laugh great novels funnyp pstrongsandeep parmarstrongp pthree books redefine life writing means year stephanie syquias emamnion emgranta fred daguiars emyear plaguesem carcanet preti tanejas emaftermath emtransit books published uk stories 2022 syquias bold emknstlerromanem mesmerisingly transports continents longing diasporas arriving england deep boneknowing countryalbion daguiars electric prose vividly recounts cancer diagnosis treatment covid year private suffering amid collective tanejas brave haunting retelling terror attack londons fishmongers hall 2019 intermingles cleareyed understanding roots terror personal stories involvedp pim deep polina barskovas emair raid emugly duckling press translated belarussianamerican poet valzhyna mort retells siege leningrad breathtaking interventions history silence violence betweenp pstrongpeter wilbystrongp pdavid kynastons emon cuspem bloomsbury latest volume marvellous series post1945 britain recalls state nation 1962 country outside eu aspired join skilfully captures sense new horizons glimpsed britons struggled escape long shadow second world war state nation turned belatedly hrefhttpswwwnewstatesmancomculturebooks201911jonathancoemiddleenglandreviewjonathan coes novel emmiddle england emapenguin published 2018 surpassed coes evocation sour restless resentful mood contrast spirit 1960s led britain turn inwardsp pstrongelif shafakstrongp phassan akkads emhope fear embluebird extraordinary story deals urgent issues era including syrian war systemic torture dehumanisation ongoing countries authoritarianism taken hold akkad takes tragedy refugee crisis pandemic social repercussions layers xenophobia racism inequality societies story resilience renewal humanismp pi recommend emburningem emthe booksem richard ovenden john murray director bodleian library fascinating moving book read schools translated languages world digital age abounds snippets information glorious celebration physical libraries nuanced knowledge p pstrongalexander mccallsmithstrongp pa scientific meal year richard dawkins writes admirable clarity jana lenzov illustrates way collaboration bears fruit emflights fancyem head zeus masterly investigation aspects flight human animal beautifully produced book appeal age groups second course madelaine bhmes emancient bonesem greystone gripping account early hominids evolved europe controversial thesis change ideas came fromp pstrongstuart maconiestrongp pi began listening susanna clarkes empiranesiem bloomsbury audiobook bedtime soon found simply mesmerising funny strange lull sleep begins fantasy series hints echoes rugpulling revelations detective story satire witty male egoism daring dazzling stuffp ppaul morleys writing delighting exasperating emnmeem work late 1970s biography anthony h wilson tv presenter music entrepreneur evangelist provocateur emfrom manchester loveem faber amp faber far best book narrative mans life keeps morleys wildly digressive style tautish biog story citys history culture unique disappearing figure engaged workingclass intellectual challenging dominance entitlement privilege wit aestheticsp pstrongjohanna thomascorrstrongp pit wonderful year novels ugly motherdaughter relationships gwendoline riley specialises savage emotional reckonings emmy phantomsem granta hear story bridget keeping perpetually disappointed mother hen arms length left home dialogue superb theres tragicomic gap said whats going love rileys merciless wit jeremy coopers embolt blue emfitzcarraldo breathes new life epistolary novel postcards charting 30 years fraught relations earnest artist estranged mother miles interested sex art little actually happens book gripped way depicts psychological battlefield motherdaughter relationshipsp pstrongdaisy johnsonstrongp pemburntcoatem sarah hall faber amp faber slim beautiful masterpiece exploring art relationships pandemic felt surging head lingering dreams troubling wasnt holding hall heart comes writing sex isolation surpasses herselfp pemopen waterem caleb azumah nelson viking slight book wrestles relationships art voice narrator feels mrs dallowayesque moves london fluid swift nelson novella new exciting marker fiction achievep pstrongwilliam dalrymplestrongp palex rentons emblood legacy emcanongate moving timely wellwritten strikingly thoughtful book makes important contribution growing debate horrors accompanied britains empirebuilding rentons remarkably honest analysis familys slave plantation papers darkness contain highlights continuing failure acknowledge extreme toxicity imperial history makes good counterpart toa hrefhttpswwwnewstatesmancominternationalpolitics202102empirelandsathnamsangheranewageempirekehindeandrewsreview sathnam sangheras brilliant emempirelandema viking like reminds deeply impregnated british present halfforgotten imperial pastp pembetter goneem akash kapur scribner forensic reconstruction deaths set background flawed tropical utopia auroville beautifully written structured deeply moving realised wise thoughtful chiselled prose emriver kingsem william collins scandinavian archaeologist cat jarman writes vikings great skill clarity narrative drive unfashionably jarman likes vikings violent tale replete witches human sacrifice greek fire funeral orgies lively netflix viking romp great deal intellectually satisfyingp pstrongphilippe sandsstrongp pin emspeak silenceem bloomsbury carole angiers extraordinary detective work life wg sebald strikingly restrained prose combined utterly gripped fully appreciated extent sebalds novels drew life experiences causing wonder usually courtroom lawyer fabulous interplay fact fiction knows real isnt utterly brilliantp pstrongmelvyn braggstrongp pcolm tibn written magnificent fiction equally magnificent books writers fiction latest emthe magicianem viking recreates biographical fiction life thoughts achievements thomas mann dark beautifully constructed think near author entering mind anotherp pin emklara sun emfaber amp faber kazuo ishiguro boldly sets create artificial friend robot brilliantly realised human observations convincingly emotions wonderfulp pstronggerry brakusstrongp pive eagerly awaiting emammaem seventh final chapter photographer vasantha yogananthans stunning longterm body work inspired indian legend ramayana ema myth souls 20132021em published chose commune yogananthan draws inspiration imagery associated myth successfully brings fascinating 2000yearold tale modern life emammaem mixed media photographs layered brightly coloured paint bring spectacular colour life moving evocative imagery ive enjoyed anna ostoya chantal mouffes empolitics passions stakes democracyem mack charming booklet textual collages essay mouffe political theorist writer critiques politics neoliberalism warns dangersp figure classwpblockimageimg sizesmaxwidth 1024px 100vw 1024px srchttpswwwnewstatesmancomwpcontentuploadssites2202111202146vasanthayogananthan1024x819jpg width1024 alt srcsethttpswwwnewstatesmancomwpcontentuploadssites2202111202146vasanthayogananthan1024x819jpg 1024w httpswwwnewstatesmancomwpcontentuploadssites2202111202146vasanthayogananthan300x240jpg 300w httpswwwnewstatesmancomwpcontentuploadssites2202111202146vasanthayogananthan768x614jpg 768w httpswwwnewstatesmancomwpcontentuploadssites2202111202146vasanthayogananthan397x317jpg 397w httpswwwnewstatesmancomwpcontentuploadssites2202111202146vasanthayogananthan180x144jpg 180w httpswwwnewstatesmancomwpcontentuploadssites2202111202146vasanthayogananthanjpg 1403w classwpimage246135 height819figcaptionindian myth modernity amma photographer vasantha yogananthanfigcaptionfigure pstrongbrendan simmsstrongp pthis year marks centenary partition generally called british isles borders eastwest northsouth makes charles townshends emthe partition ireland divided 1885 1925em allen lane topical paradoxically engrossing book makes clear government ireland act 1920 established home rule parliaments south north intended london divide island british government planned home rule round solution enable 26 counties remain linked rest ireland dominions empire didnt turn wayp pstrongjohn burnsidestrongp pjonathan meadess empedro ricky come selected writing 19882020 emunbound feast book running 900 pages meades politics mediocrity culture lysergic acid utterly unmissable wonderfully incisive funny hell complete contrast michael bracewells emsouvenirem white rabbit offers impressionistic lyrical haunting elegy predigital london fleeting visions nearhallucinations lost time echoes modernism faded city slid present age future past immediatep pstrongrose tremainstrongp pa hrefhttpswwwnewstatesmancomculturebooks202111bookerprizewinnerdamongalgutsouthafricaisnotacountrythatspeakswithonevoicedamon galguta worthy winner booker prize weve seen years novelem promiseem chatto amp windus turns pledge swarts white south african farming family grant ownership small house land longsuffering black maid salome pledge kept lives neglectful quarrelsome swarts fall ruin book trembles hand political relevance gripping reread buy arnold weskers emthe birth shylock death zero mostelem quartet story production weskers play emthe merchantem masterpiece dud assassinated new york stagep pstrongrachel reevesstrongp pbaroness hales autobiography emspider woman life embodley head reminder huge incomplete progress women public life past 60 years book tells wonderful stories childhood swotty geek north yorkshire fleet street wine bar banned women ordering drinks origins spider brooch close struck hales humility intelligence practical feminism commitment rule law intelligence comes family valued scholarship feminism comes experience women paid barred jobs overlooked commitment law deep sense public service willingness talk truth power shown needed everp pstrongjonathan coestrongp psometimes necessary books turn ones didnt realise needed reading patrick wrights emthe sea view emrepeater idea hole life waiting filled 750page book east german writer tenyear selfimposed exile isle sheppey 1970s entirely captivated microscopic discursive study uwe johnson pioneering novelist crossed iron curtain declined fall feet capitalist west opting finally settle family sheerness apparently basis closest thing find east germany stasi great book relationship britain rest europe page longp pstrongkevin barrystrongp pphilip ceallaigh irish writer long based bucharest writes short stories steeped russian tradition emtroubleem stinging fly press collection 12 years thrillingly good sentence bears tension weight story narrative line feels natural inevitable found crafted rachel kushners dynamic incisive glamorous prose style gives perfect expression reportage essays criticism emthe hard crowdem jonathan cape nonfiction collection exciting book brilliant scenester embeds writes inside gives true story real dealp figure classwpblockimageimg sizesmaxwidth 1024px 100vw 1024px srchttpswwwnewstatesmancomwpcontentuploadssites2202111202146rachelkushner1024x684jpg width1024 alt srcsethttpswwwnewstatesmancomwpcontentuploadssites2202111202146rachelkushner1024x684jpg 1024w httpswwwnewstatesmancomwpcontentuploadssites2202111202146rachelkushner300x200jpg 300w httpswwwnewstatesmancomwpcontentuploadssites2202111202146rachelkushner768x513jpg 768w httpswwwnewstatesmancomwpcontentuploadssites2202111202146rachelkushner397x265jpg 397w httpswwwnewstatesmancomwpcontentuploadssites2202111202146rachelkushner180x120jpg 180w httpswwwnewstatesmancomwpcontentuploadssites2202111202146rachelkushnerjpg 1327w classwpimage246138 height684figcaptionscenester rachel kushner writes inside inem hard crowdem photo ann summanew york timesreduxeyevinefigcaptionfigure pstrongmichael brooksstrongp pit easy pick important science book climate change pandemic miserable arent favourite escape news cycle year emmustnt grumbleem graham lawton headline home simple ingenious premise bit ill time exactly going bodies lawton covers science 100 mild ailments sore throats dead legs dark circles eyes cricked neck important witty compelling deeply informed perfect guilty pleasurep pstrongmelissa bennstrongp pwhile attracting mass following vivian gornick acquired kind cult status sections independent literaryminded feminist left emtaking long look essays culture literature feminism time emverso collection pieces published past 40 years ranges essays herman melville hannah arendt consideration selfabsorption emotional stupidity famous trio norman mailer saul bellow philip roth comes representation women gornick deals simplistic polemical blow instead mines hardwon experience profound honest ambivalence great writers great flaws illuminate significance collective life timesp pstrongphilip hoarestrongp pi find hard recommend michael bracewells emsouvenirem white rabbit wish id written perfectly encapsulates transition pop art mid1970s early eighties shops clubs clubs utopias notion modernity [was] reaching critical mass looking deserted london streets shocking notion property city centre bracewell wraps audenesque overcoat asks pop stop answer deeply elegant essay revolt style spaces filled art resistance left dreamsp pstrongroger robinsonstrongp phanif abdurraquibs ema little devil americaem essays allen lane engrossing times moving ive read essays dozen times fan work book essays band tribe called quest called emgo ahead rainem newest book essays bleed poetic abdurraqib writes poetry informative blends easily ideas moments stories new poetic essays think changes game waysp pstrongdavid kynastonstrongp pthe astonishingly welldocumented piece autobiography emoxford undergraduate 19603 emprivately published available amazon cambridge anthropologist alan macfarlane compelling slice social history fascinating portrait intellectually spiritually restless young man starting sense world remarkable multivolume project suspect time come seen cumulatively seminal work autobiography occupying different autobiographical terrain michael chaplins enjoyable sympathetic emnewcastle united stole heart emhurst 60 years supporting club troubles beginningp pstrongjohny pittsstrongp pi read lot highminded literary fiction 2021 right end came emswan songsem repeater runcorn hiphop artist lee scott bizarre bmovie book feels fresher ive read year surrealist story written raw prose flashes moods textures mind andrea dunbar know workingclass spaces precarity dont nonfiction impressed tharik husseins emminarets mountainsem bradt tour balkans unearthing islamic european history appreciated depth research lightness touch fascinating encountersp pstrongmarina benjaminstrongp pive picked books stayed long reading deborah levys emreal estateem hamish hamilton final instalment lyrical autobiography struck best tender funny exacting circles idea makes home itinerant author hops place place josh cohens emlosersem latest essay zeitgeistnailing peninsula press offers sparkling analysis trump manages skewer target mellifluous prose loved emhigh waters rise emcatapult debut novel german poet anja kampmann translated anne posten inner story tenderness delicacy concerns oil rig workers need come terms loss bunkmate partner emerge inarticulate grief p pi admired way simple sensual language builds complex compound meaning unlike levy layered deeply submerged sea metaphor knowp pstrongrichard j evansstrongp pthe history book ive enjoyed year emfallen idols statues historyem alex von tunzelmann headline timely written entertaining look statues pulled 2020s wave iconoclasm places times setting inflamed culture wars broader context injecting muchneeded dose common sense debate book year emskyboundbra journey flightem rebecca loncraine picadorp pi vividly remember teaching undergraduate london early 1990s horrified recently discover died young 2016 emskyboundem reacts diagnosis cancer taking gliding soaring higher welsh hills eventually himalayas transcending illness text poetic inspirational p pstrongkit de waalstrongp pemempirelandem sathnam sanghera viking important book thats phrase use lightly expos reminder conveniently british rewritten past buried bones shame bones course poking soil dangerous stinking tripping live today legacy slavery empire emempirelandem necessary uncomfortable illuminating read loveda hrefhttpswwwnewstatesmancominternationalpolitics202010rainfallsandgloomincreasesireadslowlynotwantingmybookend emmayfliesem andrew ohagana faber amp faber funny clever desperately sad message running right die dignity affects male friendship leaving coming home unbreakable childhoodbondsp pstrongwilliam boydstrongp ptwo superb biographies appeared year new valuable new edition richard zeniths monumental exhaustive empessoa experimental life emallen lane word enigmatic modern figure ts eliot portuguese 20thcentury literature better equipped zenith peel away onionskins personality astonishing poet better equipped donald rayfield write chekhov unsurpassable 1997 biography emanton chekhov lifeem garnett press republished year mass new revelatory material finish rayfields biography feeling knew chekhov close friend astonishing achievementp pstrongmichael moorcockstrongp pmarshalling exceptional skills social observation narrative britains finest modern essayist iain sinclair strikes south emthe gold machineem oneworld travelling daughter farne conducts elegiac dialogue generations sinks deep past travelling forth time rapidly changing peru trail mysterious arthur sinclair fiction timetravelling alan warners emkitchenly 434em white rabbit profoundly complex comic elegy lost illusions 1960s entertaining read contemptuously impatient clichs rock roll novelp figure classwpblockimageimg sizesmaxwidth 1024px 100vw 1024px srchttpswwwnewstatesmancomwpcontentuploadssites2202111202146iansinclair1024x679jpg width1024 alt srcsethttpswwwnewstatesmancomwpcontentuploadssites2202111202146iansinclair1024x679jpg 1024w httpswwwnewstatesmancomwpcontentuploadssites2202111202146iansinclair300x199jpg 300w httpswwwnewstatesmancomwpcontentuploadssites2202111202146iansinclair768x509jpg 768w httpswwwnewstatesmancomwpcontentuploadssites2202111202146iansinclair397x263jpg 397w httpswwwnewstatesmancomwpcontentuploadssites2202111202146iansinclair180x119jpg 180w httpswwwnewstatesmancomwpcontentuploadssites2202111202146iansinclairjpg 1336w classwpimage246140 height679figcaptionculture clash ian sinclairs emthe gold machineem journey colonial historyfigcaptionfigure pstronganjana ahujastrongp pdeservedly shortlisted multiple prizes emempire pain emby patrick radden keefe picador chronicles opioid crisis rise fall sackler dynasty grew rich story begins arthur sackler physician gift selling roped younger doctor brothers businessp pin 1950s bought purdue pharma later sold oxycontin blockbuster painkiller slowrelease formulation vulnerable tampering sacklers better known philanthropy reaped billions americans succumbed epidemic addiction overdosing keefe turns mountain material delivered anonymously addictive tale greed regulatory failings expensive lawsuits cold lack remorsep pstrongwilliam daviesstrongp pno doubt plenty books written britains horrifying covid experiences appalling track record johnson administration emfailures stateem jonathan calvert george arbuthnott mudlark early audit produced members emsunday times eminvestigative journalism team surely devastating harrowing prime minister specialises distraction avoidance responsibility books tracking serial policy failures tens thousands avoidable deaths invaluable contribution whats left britains public sphere avoid blas face epic failures retain capacity shocked shocking bookp pstronglyndsey stonebridgestrongp pin year unfreedom especially women hrefhttpswwwnewstatesmancomculturebooks202105deborahlevyanddomesticdeborah levys emreal estateem ahamish hamilton lea ypis emfree coming age end history emallen lane books new kinds freedom especially welcome emreal estateem published months murder sarah everard wise lyrical wickedly nourishing affirmation womens rights home world gated rules men ypis deliciously smart memoir albanian girlhood end cold war brilliant disquisition meanings freedom lures false hopes disappointments possibilities timep pstrongbruno maesstrongp pamitav ghosh begins emthe nutmegs curseem john murray story nutmeg spice banda islands eastern indonesia production trade networks modern capitalism said originated starting surface todays climate geopolitical crises ghosh takes time birth set extreme ideas granted threaten continuity speciesp pemthe nutmegs curse emis creation literary mind linking historical philosophical themes small details analogies fabric good storyp pstrongsimon winderstrongp pin current state major cultural events went unnoticed oxford university presss achievement completing new translations 20 mile zolas emles rougonmacquartem novels entire frenzied family saga emgerminalem great jeremiads wonderful satires empot luck emand emthe conquest plassans emand bananas erotic oddities like emthe sin abb mouretem fatalism unintentionally comic novels crammed prurience grotesquery crazed ambition sense landscape sea fields city malevolent crusher human hopep pstrongkatrina forresterstrongp pits hard year workers good books work capitalism stand amelia horgans emlost work empluto press gives perceptive philosophical account work reorganise destin jenkins emthe bonds inequality emuniversity chicago press tells story debt finance racial capitalism intertwined americas cities amazing history bankers bond markets racial inequalities san francisco emtheory gimmickem belknap press sianne ngai exposes capitalisms tricks mindblowing study time laboursaving devices gimmicksp pstrongjonathan powellstrongp pone book looking looking forwarda hrefhttpswwwnewstatesmancominternationalpolitics202102empirelandsathnamsangheranewageempirekehindeandrewsreview emempirelandem sathnam sanghera aviking salutary reminder dark past spend time trying help resolve armed conflicts myanmar nigeria largely caused crass errors ancestors helps understand came abouta hrefhttpswwwnewstatesmancomculture202102howishigurorewrotehimself emklara sunem nobel laureate kazuo ishiguro afaber amp faber tackles key question future going live ai transform lives unexpected ways novels bring challenges life better non fictionp pstronglea ypistrongp pmark mazowers emthe greek revolution 1821 making modern europe emallen lane gripping story complicated unlikely creation modern greek state vivid detail impeccable scholarship great nuance mazower shows modern idea nation emerges complex random messy interactions plurality agents local regional imperial acting different motives pursuit contrasting purposes illuminating account unifying power myths past dangers inherent myths connected political realityp pstrongmusa okwongastrongp pthe compelling book read year emmadgermanesem graphic novel birgit weyhe translated katy derbyshire vampq books story people arrived east germany mozambique 1980s find work maybe love instead confronted racism new home heartbreaking indifference returned told perspectives tale grief resilience loss hope loved itp pstrongolivia laingstrongp peverything philip hoare writes bewitching fell hook line sinker emalbert whale emfourth estate kind treasure hunt search german renaissance painter albrecht drer wonders saw fiction beat emsecond place emfaber amp faber hrefhttpswwwnewstatesmancomculturebooks202105rachelcusksecondplacereviewrachel cusksa tautly composed tale creativity power loved debut novel emthree roomsem jo hamya jonathan cape beautiful furious encapsulation generation rent lost good week penguin reissue len deightons spy novels pile emssgbem brilliantly grim counterfactual britain nazi rulep figure classwpblockimageimg sizesmaxwidth 674px 100vw 674px srchttpswwwnewstatesmancomwpcontentuploadssites2202111202146albrechtdurerjpg width674 alt srcsethttpswwwnewstatesmancomwpcontentuploadssites2202111202146albrechtdurerjpg 674w httpswwwnewstatesmancomwpcontentuploadssites2202111202146albrechtdurer228x300jpg 228w httpswwwnewstatesmancomwpcontentuploadssites2202111202146albrechtdurer397x522jpg 397w httpswwwnewstatesmancomwpcontentuploadssites2202111202146albrechtdurer137x180jpg 137w classwpimage246143 height886figcaptionin search artist self portrait drer subject philip hoares emalbert whaleemfigcaptionfigure pstrongthomas meaneystrongp pjoshua cohens emthe netanyahusem fitzcarraldo editions plunges american campus novel ecstatic extreme fiction outfoxes history leaves little doubt cohen philip roths original heir pierre charbonnier helped map future intellectual history emaffluence freedomem polity presents history environmental ideas environmental history ideas result extensive invigilation modern political thought material world unavoidable foregroundp pstrongerica wagnerstrongp pmy book year alan garners emtreacle walker emfourth estate seemingly brief tale hypnotic wonder blurring boundaries time spirit garner 87 latest book sparks earlier masterpieces glorious wonder right real magic hard coversp pstrongmichael rosenstrongp pi like people job gathering examples languageuse noticed absurd excessive extraordinary didnt bother jot stuff amanda montells emcultish language fanaticismem harperwave linguistic lengths pr outfits lure keeping fit buying tupperware seriously tragically thoughtful commentary lethal selfdestructive cults led notorious massacres book teases away old conundrum language thats luring minds offering fertile ground cults sow seedsp pstrongjeremy cliffestrongp pthe book stuck novel emoccupationem brazilian writer julin fuks published charco press daniel hahns vivid translation fuks won fame 2015 hit emresistanceem melding wg sebalds sense notquitedead past ben lerners metafictional blurring author narrator alter ego sebastian fellow son argentinian psychiatrists fled brazil returns braid stories refugees abandoned paulo hotel wifes pregnancy fathers illness meditation life start end trauma resilience appeared portuguese original 2019 uncannily apt time pandemic new social political fractures brazil globallyp pstrongfintan otoolestrongp pclaire keegans emsmall things like theseem faber amp faber called novella feels like epic distilled single potent essence story ordinary man coal merchant provincial town 1980s ireland deep family history finely etched portrait society glimpse heart darkness magdalene laundry system moving reflection moral choice quietly brilliant artistry colm tibns emthe magicianem viking uses life thomas mann explore complex relationships intimacy history public private lives slippery nature creativity found mesmerisingp pstrongvince cablestrongp pas hrefhttpswwwnewstatesmancomculturebooks202101prosestylejohnlecarrjohn le carra addict rushed bookshop buy hrefhttpswwwnewstatesmancomculturebooks202110silverviewjohnlecarrereviewemsilverviewem aviking latest book match cold war spy novels written prime later work illuminates themes loyalty betrayal conflicting values modern contextp pema room leavesem kate granville canongate beautifully written piece faction hidden history women achievements overshadowed domineering men ugly history early colonial settlement australia crooked men heroes granville tackles dual subjects preachy worthyp pstrongrichard lloyd parrystrongp pa hrefhttpswwwnewstatesmancomculture202106reviewedshortnewtitlesjamesdaviestraviselboroughdavidpeaceanddavidemtokyo reduxem david peacea faber amp faber novel extraordinary tokyo trilogy qualities familiar admirers formal boldness complexity powerful sense place tenderness humanity gift character straightforwardly enjoyable murky crime mystery emerging slimy entrails occupationera japan emspeak silence search wg sebaldem carole angier bloomsbury biography hobbled noncooperation subjects widow daughter names dont appear index manages nonetheless gripping account life lies 21st centurys greatest authorsp pstrongleo robsonstrongp pin memorable year extraordinary books stood rest accounts watchful highly literate daughter differently imperfect parents written authors surely close peak abilities honesty humour ravishing phrasemaking talent memoir elements invention novel autobiographical basis similarities utterly different tone milieu approach hrefhttpswwwnewstatesmancomculture202107marinawarnerivealwaysfounditveryhardknowwhatimmarina warnersem inventory life mislaidem william collins aand gwendoline rileys emmy phantoms emgrantap pstrongmegan nolanstrongp puntil read ema calling charlie barnesem viking joshua ferriss virtuosic novel couldnt recall time book caused laugh gasp aloud madly funny bristling intelligence story man later life wallowing detritus american dream children witnessing decline rarely enjoy adult novels told perspective children similar reasons struggle watch child actors inevitable sense artifice emheavenem picador novel mieko kawakami translated sam bett david boyd brilliant rejoinder reticence captivating quietly devastating book relationship school misfits vulnerabilities expose tormentors allow pure sort attention p pstrongrose georgestrongp pfor pleasure reading want warmth pace narrative steady hand sentences eyes prizes dean man impossibly luxurious hair lives swedish forest known tuva moodyson crime fiction series tuva deaf journalist great character adventures repetitive repetitive emthe thing burnem hodder amp stoughton astonishing standalone dean young vietnamese woman lives appallingly coerced life brute called lenn dean gets voices chillingly right tension rises inevitably claustrophobic pressure draws jane woman want triumph cost novel skin crawl fury insidious violence menp pstrongmichael prodgerstrongp pcynthia saltzmans emnapoleons plunderem thames amp hudson thrilling chilling account cultural despoliation veroneses huge purloined painting emthe wedding feast canaem centre varied narratives describes bonaparte looted italys art buff glory pilfering aside current leaders missing trick emthe kings painter life times hans holbein emhead zeus franny moyle gathered relatively facts known portraitist combined adroitly wealth material henrician england basel native great national painterp pstrongrichard seymourstrongp phannah zeavins remarkable emthe distance cure history teletherapyem mit press disinters history longdistance psychoanalysis freuds selfanalysis correspondence physician wilhelm fliess mass communication psychoanalysis radio suicide hotlines use videocalling treat patients pandemic psychoanalysis rarely reflected history foundations freud fascinated telepathy gripped fantasy mediumless communication zeavin shows analytic relationship needs mediation ritual appointments money create distanced intimacy undercurrents fantasy transference flow true analytic relationship true differently relationshipsp pstrongsimon winchesterstrongp ptwo discoveries past year charm delight richard zeniths magisterial account life deliciously mad fernando pessoa allen lane wrote books stories 60 pseudonyms left 25000 essays locked cabin trunk discovered lisbon turned pessoa great literary biographies century far america waits 86yearold robert caro complete fifth final volume stupendous life lyndon b johnson possibly manage 40 years learn chat favourite novelist forgotten masterstoryteller nevil shute borrow books boots nearimpossible find maybe bob caros unanticipated endorsement atlantic help hasten truly great yarns onep pstrongsamuel moynstrongp pa civilisation scrubbed shiny requires sweeping moral filth rug eyal press shows brilliant reporting exquisite writing emdirty work emfarrar straus giroux published uk head zeus 2022 initially drawn passages armed drone operators pursue obverse argument new book emhumaneem new forms american war increasingly clean hiding unseemly requirements foisting essential labour hrefhttpswwwnewstatesmancomculture202105loveanimalshumanshapedworldhenrymancereviewanimal slaughtera prison work presss examples looked mean morally uninvolved tasks sakesp pemfor choices visit hrefhttpnewstatesmancombooksnewstatesmancoukbooksaemp pemthe new statesmans 20 best books 2021 appearinthe 10 december issueemp |
619583bef5d71aca4ac7eb32 | Malala Yousafzai is right to find feminism and integrity in the institution of marriage | figure classwpblocktabletabletbodytrtdtdtrtbodytablefigure
pmalala yousafzai the 24yearold nobel peace prize laureate and activist for female education recently revealed in an essay for embritish vogueem that she used to be opposed to marriage on feminist grounds telling anyone who asked i do not want to get married or at least not until im 35 this was partly in response to her experiences growing up in northern pakistan where child marriage is common and where a friend gave birth at the age of 14p
pbut yousafzai has had a change of heart as demonstrated by her marriage to asser malik a 31yearold manager with the pakistan cricket board who she met while she was studying at oxford university on9 november the two were married in birmingham and yousafzai writes that her new husband has helped her realise that i could have a relationship a marriage and remain true to my values of equality fairness and integrityp
pnot everyone supports yousafzais optimism taslima nasreen a writer and feminist activist expressed dismay not only at yousafzais choice of partner but also her decision to marry at the age of 24 she tweeted i thought she went to oxford university for study she would fall in love with a handsome progressive english man at oxford and then think of marrying not before the age of 30p
pimplicit in nasreens criticism is the suggestion that yousafzais youthful marriage is a sign that she is insufficiently westernised nasreen is right that 24 is a bit on the young side in the uk as the average age for british women getting married for the first time is now 31 i also raised a few eyebrows when i got married at 25 with one feminist friend even telling me bluntly that she thought i should be sowing my wild oats not committing so early to my university boyfriend happily she came to the wedding anyway p
pa hrefhttpswwwnewstatesmancomthecultureinterview202111emilyratajkowskiinterviewiusedtothinkfeminismwaswomenhustlingfeminist aqueasiness around marriage is longstanding presenting a common theme in much of the writing of second wave feminism the institution of marriage is the chief vehicle for the perpetuation of the oppression of women insisted the us sociologist marlene dixon in 1969 dixon outlined the dominant feminist critique of the time it is through the role of wife that the subjugation of women is maintainedp
pthis feminist analysis views marriage as a way of controlling female sexuality but that has never been its sole function marriage continues to offer a form of protection when women have children p
pfor most westerners the link between childbearing and marriage has been weakened the old adage first comes love then comes marriage then comes a baby in a baby carriage is no longer an intuitive sequence as more than 40 per cent of british babies are now born out of wedlock it is fashionable for couples to ban children from weddings now an idea that would have bemused people of the past who believed that the whole point of getting married was to have more children around p
pbut then the institution of marriage has been altered the psychologist eli finkel has charted the historical development of marriage in the western world and attributes its changes to shifting economic conditions before the mid19th century the challenge of daytoday survival particularly for rural people meant that assistance with food production shelter and protection from violence were what most people prioritised in a spouse p
plater urbanisation and industrialisation led to greater prosperity and couples had the luxury of placing more emphasis on love in their marriages then in the affluent 1960s we entered what finkel refers to as the era of selfexpressive marriage in which selfdiscovery selfesteem and personal growth became the key markers of a marriages success if you dont have kids that model works just fine getting married can function as the cherry on the top of lifes other achievements or else can be disregarded as an anachronism but a hrefhttpswwwnewstatesmancompolitics202110trustmewomendontneedtoberemindedtothinkabouthavingchildrenwe encounter problems when we confront the inherent asymmetries of childbearinga p
pin any relationship the person who carries and nurses the children typically ends up earning less than the person who doesnt since little children and the labour market do not make happy bedfellows the gender pay gap in western countries is actually almost entirely aa hrefhttpswwwnewstatesmancombusinesseconomics201701stopboringaboutbabiesgenderpaygapisntaboutchoice maternal pay gapa p
pcontrary to popular misconception commonlaw marriages are not recognised in the uk which means that a mother who isnt married to her partner is incredibly vulnerable financially if the partner dies intestate or the couple split up she has no right to his or her assets p
pits not uncommon on online forums such as mumsnet to come across a woman in pieces because her partner has said for years that marriage is just a piece of paper and she has now discovered upon their separation that its actually an extremely important piece of paper that would have protected her as well as her children p
pthinking about marriage in those terms isnt very romantic and id be lying if i said it was something i considered as a 25yearold bride but its also a problem that the second wave opponents of marriage never managed to solve despite attempts at experimental forms of communal childrearing that rarely lasted long p
punless we reject motherhood altogether as some feminists suggest we should we need practical ways of managing its asymmetrical joys and burdens whatever her critics say therefore malala yousafzais embrace of marriage has a wisdom to it for mothers and wouldbe mothers the old institution is a feminist proposition p | figure classwpblocktabletabletbodytrtdtdtrtbodytablefigure pmalala yousafzai 24yearold nobel peace prize laureate activist female education recently revealed essay embritish vogueem opposed marriage feminist grounds telling asked want married im 35 partly response experiences growing northern pakistan child marriage common friend gave birth age 14p pbut yousafzai change heart demonstrated marriage asser malik 31yearold manager pakistan cricket board met studying oxford university on9 november married birmingham yousafzai writes new husband helped realise relationship marriage remain true values equality fairness integrityp pnot supports yousafzais optimism taslima nasreen writer feminist activist expressed dismay yousafzais choice partner decision marry age 24 tweeted thought went oxford university study fall love handsome progressive english man oxford think marrying age 30p pimplicit nasreens criticism suggestion yousafzais youthful marriage sign insufficiently westernised nasreen right 24 bit young uk average age british women getting married time 31 raised eyebrows got married 25 feminist friend telling bluntly thought sowing wild oats committing early university boyfriend happily came wedding anywayp pa hrefhttpswwwnewstatesmancomthecultureinterview202111emilyratajkowskiinterviewiusedtothinkfeminismwaswomenhustlingfeminist aqueasiness marriage longstanding presenting common theme writing second wave feminism institution marriage chief vehicle perpetuation oppression women insisted sociologist marlene dixon 1969 dixon outlined dominant feminist critique time role wife subjugation women maintainedp pthis feminist analysis views marriage way controlling female sexuality sole function marriage continues offer form protection women childrenp pfor westerners link childbearing marriage weakened old adage comes love comes marriage comes baby baby carriage longer intuitive sequence 40 cent british babies born wedlock fashionable couples ban children weddings idea bemused people past believed point getting married children aroundp pbut institution marriage altered psychologist eli finkel charted historical development marriage western world attributes changes shifting economic conditions mid19th century challenge daytoday survival particularly rural people meant assistance food production shelter protection violence people prioritised spousep plater urbanisation industrialisation led greater prosperity couples luxury placing emphasis love marriages affluent 1960s entered finkel refers era selfexpressive marriage selfdiscovery selfesteem personal growth key markers marriages success dont kids model works fine getting married function cherry lifes achievements disregarded anachronism hrefhttpswwwnewstatesmancompolitics202110trustmewomendontneedtoberemindedtothinkabouthavingchildrenwe encounter problems confront inherent asymmetries childbearingap pin relationship person carries nurses children typically ends earning person doesnt little children labour market happy bedfellows gender pay gap western countries actually entirely aa hrefhttpswwwnewstatesmancombusinesseconomics201701stopboringaboutbabiesgenderpaygapisntaboutchoice maternal pay gapap pcontrary popular misconception commonlaw marriages recognised uk means mother isnt married partner incredibly vulnerable financially partner dies intestate couple split right assetsp pits uncommon online forums mumsnet come woman pieces partner said years marriage piece paper discovered separation actually extremely important piece paper protected childrenp pthinking marriage terms isnt romantic id lying said considered 25yearold bride problem second wave opponents marriage managed solve despite attempts experimental forms communal childrearing rarely lasted longp punless reject motherhood altogether feminists suggest need practical ways managing asymmetrical joys burdens critics malala yousafzais embrace marriage wisdom mothers wouldbe mothers old institution feminist proposition p |
619583e1f5d71aca4ac7eb38 | The return of Thomas Pynchon? | pthe question of whether the novel is dead is one that often occupies those in the business of writing or commenting on novels much as the question of selfdriving cars doubtless occupies truckers ones attitude towards the question largely depends on ones attitude towards genre fiction and sally rooneyp
pstill whatever its truth it is inarguable that as joseph bottum wrote in his 2019 book emthe decline of the novelem art forms are not immortal or incapable of collapse when their social foundations shift to that end authors have been attempting to innovate the altlit community have been using social media for years both as a source of thematic material and as a means of publication and even grizzled vets are learning new tricks salman rushdie has been publishing his latest novel emthe seventh waveem in a serialized form on substackp
pand thomas pynchonp
pwell here lies a mystery a user of the rthomaspynchon board on reddit has noticed something unusual paul thomas anderson who adapted pynchons book eminherent viceem has a new film emlicorice pizzaem a character in emlicorice pizzaem is an old guy in the movie business named sam harpoonp
pharpoon appears to have his own twitter account where he posts fictional movie anecdotes in what feels like a tribute to the rambling facebook posts of emtaxi driverem and emraging bullem screenwriter paul schrader sample brilliance this boggles my mind not my imagination nothing boggles that despite having fewer than 2000 followers harpoon is followed by hollywood big hitters like emlooperem and emknives outem director rian johnson some of harpoons anecdotes appear to drop sly references to pynchons work for example he writesp
p2022 marks 50 years since i began the journey of crafting rainbow my studio debut and the film which has defined my career for better or worse arguably both pynchons gravitys rainbow while not his first book was published in 1973 and has defined his career for better or worse another reddit wag pointed out that a harpoon is a missile the plot of gravitys rainbow concerned missiles and pynchon worked as a technical writer of boeingp
pcould pynchon be tweeting as a minor character from a paul thomas anderson film there are similarities between their thoughts and style harpoon writesp
pgurdjieff once wrote essence is the truth in man this was the guiding philosophy at the heart of juju and the caper crew which i made for fox in 1974 however due to a financing snafu with westinghouse it was only shown at the nato training base in szczecin great film shp
pvarious pynchonian elements are there tricksy humor esoteric philosophy and strange military machinations could it be could it bep
pwell none of this is direct evidence for the furtive novelists involvement as fun as all this speculation is the cold hands of probability have to rest themselves upon our shoulders pynchon is 84 he famously avoids the limelight he has never had a verifiable social media presence is it realistic to imagine that he is spending his golden years posting away online to a small audience of amused movie bigwigs and curious redditorsp
pthen again it is certainly someone and someone wellconnected trying to sound pynchonesque it would not surprise me if it was paul thomas anderson himself who shares harpoons enthusiasm for lost subcultures and obviously filmmaking but perhaps it is nothing more than a stunt an attempt to gain publicity from bozos like your humble commentator through manufacturing speculation that directs people towards the filmp
pif it is a stunt it is a clever one no other authors name invites such conspiratorialism he produces pynchon novels but he also inspires a universe of pynchonalia he has been alleged almost certainly falsely to have published a novel under a different name when he published his novel embleeding edgeem there were suggestions again almost certainly false that he was posting on the strange and lurid messageboard 4chan when paul thomas anderson directed eminherent viceem there were claims which led to feverish theorizing that the famously camerashy novelist had made an appearance emusa todayem even asked various authors to submit their own thomas pynchon conspiracy theories with teddy wayne author of emlonerem suggesting thomas pynchon is really jd salingerp
ppynchons enigmatic public image has created a pychonesque drama in itself a seething mass of speculation aimed towardswhat trying to see an old mans face trying to find out whether he wrote some humorous tweets well damn it i want to know as well if knowledge is hard to acquire then curiosity inflates its value out of all proportion the internet has made that even truer because we know so much about so many different people and events the unknown becomes especially tantalizingp
psam harpoon whoever he is is writing a chapter in a sort of abstract novel a collection of texts that illustrate the stranger reaches of human inquisitiveness will it have an endingp
pthe post a relnofollow hrefhttpsspectatorworldcombookandartthereturnofthomaspynchonthe return of thomas pynchona appeared first on a relnofollow hrefhttpsspectatorworldcomthe spectator worldap | pthe question novel dead occupies business writing commenting novels question selfdriving cars doubtless occupies truckers ones attitude question largely depends ones attitude genre fiction sally rooneyp pstill truth inarguable joseph bottum wrote 2019 book emthe decline novelem art forms immortal incapable collapse social foundations shift end authors attempting innovate altlit community social media years source thematic material means publication grizzled vets learning new tricks salman rushdie publishing latest novel emthe seventh waveem serialized form substackp pand thomas pynchonp pwell lies mystery user rthomaspynchon board reddit noticed unusual paul thomas anderson adapted pynchons book eminherent viceem new film emlicorice pizzaem character emlicorice pizzaem old guy movie business named sam harpoonp pharpoon appears twitter account posts fictional movie anecdotes feels like tribute rambling facebook posts emtaxi driverem emraging bullem screenwriter paul schrader sample brilliance boggles mind imagination boggles despite having fewer 2000 followers harpoon followed hollywood big hitters like emlooperem emknives outem director rian johnson harpoons anecdotes appear drop sly references pynchons work example writesp p2022 marks 50 years began journey crafting rainbow studio debut film defined career better worse arguably pynchons gravitys rainbow book published 1973 defined career better worse reddit wag pointed harpoon missile plot gravitys rainbow concerned missiles pynchon worked technical writer boeingp pcould pynchon tweeting minor character paul thomas anderson film similarities thoughts style harpoon writesp pgurdjieff wrote essence truth man guiding philosophy heart juju caper crew fox 1974 financing snafu westinghouse shown nato training base szczecin great film shp pvarious pynchonian elements tricksy humor esoteric philosophy strange military machinations bep pwell direct evidence furtive novelists involvement fun speculation cold hands probability rest shoulders pynchon 84 famously avoids limelight verifiable social media presence realistic imagine spending golden years posting away online small audience amused movie bigwigs curious redditorsp pthen certainly wellconnected trying sound pynchonesque surprise paul thomas anderson shares harpoons enthusiasm lost subcultures obviously filmmaking stunt attempt gain publicity bozos like humble commentator manufacturing speculation directs people filmp pif stunt clever authors invites conspiratorialism produces pynchon novels inspires universe pynchonalia alleged certainly falsely published novel different published novel embleeding edgeem suggestions certainly false posting strange lurid messageboard 4chan paul thomas anderson directed eminherent viceem claims led feverish theorizing famously camerashy novelist appearance emusa todayem asked authors submit thomas pynchon conspiracy theories teddy wayne author emlonerem suggesting thomas pynchon jd salingerp ppynchons enigmatic public image created pychonesque drama seething mass speculation aimed towardswhat trying old mans face trying find wrote humorous tweets damn want know knowledge hard acquire curiosity inflates value proportion internet truer know different people events unknown especially tantalizingp psam harpoon writing chapter sort abstract novel collection texts illustrate stranger reaches human inquisitiveness endingp pthe post relnofollow hrefhttpsspectatorworldcombookandartthereturnofthomaspynchonthe return thomas pynchona appeared relnofollow hrefhttpsspectatorworldcomthe spectator worldap |
61958422f5d71aca4ac7eb40 | Administration Trying to Bully a Professor at Indiana? | pindiana university recently a hrefhttpsindianapublicmediaorgnewslawschoolprofquestionspresidentialsearchprocesspaymenttomcrobbiephpgot a new presidenta a a hrefhttpswwwinsidehigheredcomquicktakes20211018professorquestionsindianauniversitypresidentialsearchlaw professora there wound up trying to a hrefhttpsmediumcomstevesanyouhavenoideahowstrangethisprocesshasbeenthedifficultsearchforius19thpresidentf61b473014d4sourceuser_profile0peer into the processa of how the old president was departing and how the new president was selected the university preferred that such information remain a hrefhttpswwwchroniclecomezproxyprincetoneduarticlethisprofessorinvestigatedapresidentialsearchathisuniversityitsaidhewasoutoflinebehind closed doorsap
pnext thing you know the professor was getting public record requests from a local law firm for his emails on his university account the law firm would not reveal who was behind the requests but there is reason to think that university officials are the ones doing the snoopingp
pthe a hrefhttpsacademicfreedomorgacademic freedom alliancea a hrefhttpsacademicfreedomorgafasendstwolettersregardingacademicfreedomcaseshas objecteda to this apparent attempt to harass and intimidate a member of the faculty by the university administrationp
blockquotepas a public employee at a state university the university email of professor sanders is legally subject to public records requests nonetheless such procedures can be abused and have been used as a means to intimidate and silence university professors and chill speech it would be a particularly troubling attack on academic freedom if faculty emails are accessed at the request of university officialsp
p p
pthe announced purpose of the indianas open records law is to facilitate giving quotthe people a hrefhttpscodesfindlawcomintitle5stateandlocaladministrationincodesect51431htmlfull and complete informationa regarding the affairs of government and the official acts of those who represent them as public officials and employeesquot it would fly in the face of this policy if a public university were to use the open records law to harass one of its own professors for bringing to light important matters of public concern about the conduct of that universitys officials even worse would be a university covering its tracks by hiring a law firm to carry out a public records request to achieve this endpblockquote
pthe university should firmly disavow any involvement with or continuation of this effort to discourage faculty inquiries into how the university managed its presidential transition a hrefhttpacademicfreedomorgwpcontentuploads202111afalettertoindianauniversityonstevesanderspdfthe full letter from the afa to indiana university is hereap
p p | pindiana university recently hrefhttpsindianapublicmediaorgnewslawschoolprofquestionspresidentialsearchprocesspaymenttomcrobbiephpgot new presidenta hrefhttpswwwinsidehigheredcomquicktakes20211018professorquestionsindianauniversitypresidentialsearchlaw professora wound trying hrefhttpsmediumcomstevesanyouhavenoideahowstrangethisprocesshasbeenthedifficultsearchforius19thpresidentf61b473014d4sourceuser_profile0peer processa old president departing new president selected university preferred information remain hrefhttpswwwchroniclecomezproxyprincetoneduarticlethisprofessorinvestigatedapresidentialsearchathisuniversityitsaidhewasoutoflinebehind closed doorsap pnext thing know professor getting public record requests local law firm emails university account law firm reveal requests reason think university officials ones snoopingp pthe hrefhttpsacademicfreedomorgacademic freedom alliancea hrefhttpsacademicfreedomorgafasendstwolettersregardingacademicfreedomcaseshas objecteda apparent attempt harass intimidate member faculty university administrationp blockquotepas public employee state university university email professor sanders legally subject public records requests nonetheless procedures abused means intimidate silence university professors chill speech particularly troubling attack academic freedom faculty emails accessed request university officialsp p p pthe announced purpose indianas open records law facilitate giving quotthe people hrefhttpscodesfindlawcomintitle5stateandlocaladministrationincodesect51431htmlfull complete informationa affairs government official acts represent public officials employeesquot fly face policy public university use open records law harass professors bringing light important matters public concern conduct universitys officials worse university covering tracks hiring law firm carry public records request achieve endpblockquote pthe university firmly disavow involvement continuation effort discourage faculty inquiries university managed presidential transition hrefhttpacademicfreedomorgwpcontentuploads202111afalettertoindianauniversityonstevesanderspdfthe letter afa indiana university hereap pp |
6195843cf5d71aca4ac7eb44 | What should I ask Ana Vidović? | pa relnoopener hrefhttpsenwikipediaorgwikiana_vidovic487 target_blankfrom wikipediaap
blockquotepbana vidovibis a a titleclassical guitar hrefhttpsenwikipediaorgwikiclassical_guitarclassical guitarista originally from a titlecroatia hrefhttpsenwikipediaorgwikicroatiacroatiaa a a titlechild prodigy hrefhttpsenwikipediaorgwikichild_prodigychild prodigya she has won a number of prizes and international competitions all over the worldpblockquote
phere is a relnoopener hrefhttpswwwyoutubecomresultssearch_queryanavidovic target_blankana on youtube recommendeda here is a relnoopener hrefhttpswwwanavidoviccom target_blankher home pageap
pi am doing a conversation with her so what should i askp
pthe post a relnofollow hrefhttpmarginalrevolutioncommarginalrevolution202111whatshouldiaskanavidovichtmlwhat should i ask ana vidovia appeared first on a relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap | pa relnoopener hrefhttpsenwikipediaorgwikiana_vidovic487 target_blankfrom wikipediaap blockquotepbana vidovibis titleclassical guitar hrefhttpsenwikipediaorgwikiclassical_guitarclassical guitarista originally titlecroatia hrefhttpsenwikipediaorgwikicroatiacroatiaa titlechild prodigy hrefhttpsenwikipediaorgwikichild_prodigychild prodigya won number prizes international competitions worldpblockquote phere relnoopener hrefhttpswwwyoutubecomresultssearch_queryanavidovic target_blankana youtube recommendeda relnoopener hrefhttpswwwanavidoviccom target_blankher home pageap pi conversation askp pthe post relnofollow hrefhttpmarginalrevolutioncommarginalrevolution202111whatshouldiaskanavidovichtmlwhat ask ana vidovia appeared relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap |
61958464f5d71aca4ac7eb4a | Ask Angrist! | pteam mru will be filming josh angrists nobel prize lecture and we will also be filming a qampa with the metrics master himself have you ever wanted to ask josh a question nows your chance simply a hrefhttpsmarginalrevolutionuniversitytypeformcomtoejaso6rr__sruvcfwcyj3dq29qbjiyfsubmit your questionap
pheres joshs class on a hrefhttpsmruorgmasteringeconometricsjoshuaangristmastering metricsa at mrup
pthe post a relnofollow hrefhttpmarginalrevolutioncommarginalrevolution202111askangristhtmlask angrista appeared first on a relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap | pteam mru filming josh angrists nobel prize lecture filming qampa metrics master wanted ask josh question nows chance simply hrefhttpsmarginalrevolutionuniversitytypeformcomtoejaso6rr__sruvcfwcyj3dq29qbjiyfsubmit questionap pheres joshs class hrefhttpsmruorgmasteringeconometricsjoshuaangristmastering metricsa mrup pthe post relnofollow hrefhttpmarginalrevolutioncommarginalrevolution202111askangristhtmlask angrista appeared relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap |
619584a6f5d71aca4ac7eb52 | The Cuban crackdown proves protests are working | plast week marked 32 years since the berlin wall dividing communist east germany from west germany was pulled down by the summer of 1990 all of the communist governments of eastern europe had collapsed and been replaced by democratically elected governmentsp
pcuba was expected to follow suit yet there would be no mass uprising of cubans against fidel castros communist government at least not on a scale large enough to threaten the regime there was a day of riots the a relnoreferrer noopener hrefhttpswwwcubacenterorgarchives201986cubabriefthemaleconazothecastrodictatorshipandtheirwilltopower target_blankmaleconazoa in the summer of 1994 in havana not until this yearp
pon 13 july 2021 something unprecedented happened cubans took to the streets in large numbers for the first time in 62 years to protest against the government images and videos of crowds chanting emlibertadem freedom and emabajo la dictaduraem down with the dictatorship appeared on social media frustrations at severe food shortages electricity blackouts covid restrictions and political repression had created a febrile atmosphere on the island that finally boiled over the tightening of sanctions by the donald trump administration as well as the shuttering of cubas economy to international tourism had made an already bleak situation even worsep
pthe cuban economy has been mired in economic stagnation for many decades much like in the vanished centrally planned economies of eastern europe daytoday economic policy in cuba consists of the centralised control of systematically induced shortages the us economic embargo introduced in 1960 after cuba nationalised usowned cuban oil refineries inflicts additional economic hardship on cubas economyp
pjulys protests the first mass uprising since the overthrow of the usbacked dictator fulgencio batista by fidel castros rebel army in 1959 spooked the cuban government as events unfolded it cut off the internet and in the aftermath rounded up thousands of opposition activists as well as ordinary cubans who had decided to protest a relnoreferrer noopener hrefhttpsrsforgennewscubaurgedfreereportersunderhousearrestorjailedwaveprotestsmonthago target_blankaccording to reporters without bordersa 15 journalists were threatened attacked arrested or placed under house arrest by state security during or shortly after the antigovernment protests as of october many who took to the streets that day a relnoreferrer noopener hrefhttpswwwhrworgnews20211019cubapeacefulprotesterssystematicallydetainedabused target_blankstill languisha in cuban jailsp
pwhile the cuban government was shaken opposition activists those who hadnt been rounded up were emboldened in the ensuing weeks a group calling itself archipilago announced a civic march for change for 3pm on 15 november 2021 by announcing the date of the planned protest an unusual step in the oneparty state where citizens can be preemptively arrested for the crime of social dangerousness the group set the authorities on red alert but the activists hoped the announcement of a publicly planned protest would build on the momentum generated by julys protests and ignite a similar uprisingp
pthe archipilago facebook group has around 38000 members and is a loose coalition of activists with no particular political line organisers of the rallies scheduled to take place on the 15 november coalesced around calls for democracy the release of political prisoners and opposition to violence members of the group requested permission from the government to protest on that day a relnoreferrer noopener hrefhttpswwwreuterscomworldamericascubadeniespermissionoppositionmarches20211012 target_blankbut the request was rejectedap
pas november approached cuban state television declared the protest destined to fail and denounced the organisers accusing them of being in the pay of the us an accusation the government levels at almost all of its critics cuba has never allowed and will never allow actions of a foreign government in our territory trying to destabilise the country foreign minister bruno rodrguez a relnoreferrer noopener hrefhttpswwwmiamiheraldcomnewsnationworldworldamericascubaarticle255711511html target_blanktolda diplomats in havana last weekp
ptogether with strong words the government mobilised the states repressive apparatus in the days leading up to the protests a heavy police and state security presence was reported in the streets of cubas major cities entire blocks were militarised and cordoned off by cuban a relnoreferrer noopener hrefhttpstwittercomyoanisanchezstatus1459968251895681025 target_blankspecial forcesa known as boinas negras black berets at least 40 opposition activists were detainedp
pothers who planned to protest were placed under house arrest a tactic long used by the cuban government to suppress dissenting voices daniela rojo one of archipilagos coordinators was a relnoreferrer noopener hrefhttpstwittercommambisa5status1459629805800931338 target_blankarresteda on friday according to members of the opposition activist group her whereabouts remain unknown vctor ruiz an activist in santa clara who signed a letter notifying the authorities of his intention to peacefully march on 15 november was a relnoreferrer noopener hrefhttpswwwgooglecomurlsatrctjqesrcssourcenewssearchcdcadrjauact8ved2ahukewj4_onv2zz0ahuqa8akhvkadksqxfqbkab6bagveaiurlhttps3a2f2fwwwmiamiheraldcom2fnews2fnationworld2fworld2famericas2fcuba2farticle255811301htmlusgaovvaw0oacut_qr1hotzwpyono3a target_blankpreventeda from leaving his home by state security agents independent cuban journalist luz escobar who has been subjected to a relnoreferrer noopener hrefhttpscpjorg202012cubanjournalistluzescobarbarredfromleavinghomesincedecember4 target_blankrepeated harassmenta by cuban authorities in the past was also a relnoreferrer noopener hrefhttpstwittercomluz_cubastatus1460275458017271811 target_blankblockeda from leaving her homep
pacross cuba there were many similar a relnoreferrer noopener hrefhttpstwittercomreuterssarahstatus1460216501634572290 target_blankreportsa of activists being detained at home or arrested leinier cruz salfrn a march planner in guantnamo was a relnoreferrer noopener hrefhttpstwittercomfelixllerenacubstatus1459004344221773852 target_blankdetaineda after speaking at an online event organised by emcnn en espaolem yunior garca a 39yearold playwright and leading organiser of 15 novembers demonstration had announced a plan to march white rose in hand down a central street in havana he was prevented from leaving his house by state security officials on the day of the protest who subsequently a relnoreferrer noopener hrefhttpstwittercomj_bloodworthstatus1460366750692872195 target_blanklowereda a cuban flag over garcas front window to cover a sign he had put there saying mi casa est bloqueada my house is blocked the entire street where the playwright lives was a relnoreferrer noopener hrefhttpstwittercommjorgec1994status1460045001363116032 target_blankblockeda by a stationary bus manned by state security agentsp
pon the day of the protest itself organised flash mobs of government supporters picketed the houses of opposition activists from early in the morning the crowds were recorded a relnoreferrer noopener hrefhttpstwittercomalex_glezleonstatus1460291361601642498 target_blankchantinga progovernment slogans along with insults and a relnoreferrer noopener hrefhttpstwittercomngameztorresstatus1460337648028073984 target_blankobscenitiesa saily de amarillo a prodemocracy activist and member of the archipilago group awoke at 530am on monday to a relnoreferrer noopener hrefhttpstwittercomsailydeamarillostatus1460220981029609480 target_blankfinda a crowd of government supporters outside her house holding placards and preventing her from leavingp
pthe president miguel dazcanel had announced that 15 november the day of the demonstration would mark a return to a new normality for cuba as it reopened its borders to international tourists after months of pandemic restrictions children were also scheduled to return to schoolp
pas the day unfolded the presidents version of cuba the tranquillity a relnoreferrer noopener hrefhttpsnewspaxeditionscomnewstourismboardcubatouristsenjoytotalsecurityandtranquillitynewsletter target_blankalludeda to by the government in its appeal for tourists to return to the island looked to have prevailed the protests were more subdued than the events of july with few videos emerging on social media of the sorts of crowds that frightened the government during the summer yet this was as much a product of the states heavyhandedness than proof that cubans wish to return to the normalcy alluded to by the president a normalcy that is synonymous for many islanders with poverty scarcity and political repression p
pmembers of the cuban exile community will undoubtedly be disappointed that the streets of cuba did not erupt on 15 november meanwhile supporters of the cuban government both at home and abroad will point to it as evidence that the cuban opposition lacks support on the islandp
pyet it would be a mistake to read too much into the numbers who did or did not turn out to protest as juan pappier of human rights watch a relnoreferrer noopener hrefhttpswwwnytimescom20211115worldamericascubaprotestshtml target_blanktolda the emnew york times emyesterday the cuban government resorted to a strategy of total suppression to prevent a repeat of the events of july anyone caught participating would have faced at least a year in one of cubas spartan prisons a relnoreferrer noopener hrefhttpswwwhrworglegacyreports1999cubacuba99605htmtextmost20prisoners20suffer20malnourishment20fromlong20periods20in20isolation20cells target_blanknotoriousa for poor conditions and the physical mistreatment of inmatesp
pthe stakes are high in cuba when it comes to challenging the government an atmosphere of fear prevails something that is difficult to comprehend for outsiders who have never lived under a systematically repressive regime as the late gay cuban writer reinaldo arenas a relnoreferrer noopener hrefhttpswwwamazoncoukbeforenightfallsreinaldoarenasdp1852428082 target_blankphrased ita in embefore night fallsem his memoir of persecution and exile at the hands of the communist dictatorship the difference between the communist and [liberal democratic] capitalist systems is that although both give you a kick in the ass in the communist system you have to applaud while in the capitalist system you can screamp | plast week marked 32 years berlin wall dividing communist east germany west germany pulled summer 1990 communist governments eastern europe collapsed replaced democratically elected governmentsp pcuba expected follow suit mass uprising cubans fidel castros communist government scale large threaten regime day riots relnoreferrer noopener hrefhttpswwwcubacenterorgarchives201986cubabriefthemaleconazothecastrodictatorshipandtheirwilltopower target_blankmaleconazoa summer 1994 havana yearp pon 13 july 2021 unprecedented happened cubans took streets large numbers time 62 years protest government images videos crowds chanting emlibertadem freedom emabajo la dictaduraem dictatorship appeared social media frustrations severe food shortages electricity blackouts covid restrictions political repression created febrile atmosphere island finally boiled tightening sanctions donald trump administration shuttering cubas economy international tourism bleak situation worsep pthe cuban economy mired economic stagnation decades like vanished centrally planned economies eastern europe daytoday economic policy cuba consists centralised control systematically induced shortages economic embargo introduced 1960 cuba nationalised usowned cuban oil refineries inflicts additional economic hardship cubas economyp pjulys protests mass uprising overthrow usbacked dictator fulgencio batista fidel castros rebel army 1959 spooked cuban government events unfolded cut internet aftermath rounded thousands opposition activists ordinary cubans decided protest relnoreferrer noopener hrefhttpsrsforgennewscubaurgedfreereportersunderhousearrestorjailedwaveprotestsmonthago target_blankaccording reporters bordersa 15 journalists threatened attacked arrested placed house arrest state security shortly antigovernment protests october took streets day relnoreferrer noopener hrefhttpswwwhrworgnews20211019cubapeacefulprotesterssystematicallydetainedabused target_blankstill languisha cuban jailsp pwhile cuban government shaken opposition activists hadnt rounded emboldened ensuing weeks group calling archipilago announced civic march change 3pm 15 november 2021 announcing date planned protest unusual step oneparty state citizens preemptively arrested crime social dangerousness group set authorities red alert activists hoped announcement publicly planned protest build momentum generated julys protests ignite similar uprisingp pthe archipilago facebook group 38000 members loose coalition activists particular political line organisers rallies scheduled place 15 november coalesced calls democracy release political prisoners opposition violence members group requested permission government protest day relnoreferrer noopener hrefhttpswwwreuterscomworldamericascubadeniespermissionoppositionmarches20211012 target_blankbut request rejectedap pas november approached cuban state television declared protest destined fail denounced organisers accusing pay accusation government levels critics cuba allowed allow actions foreign government territory trying destabilise country foreign minister bruno rodrguez relnoreferrer noopener hrefhttpswwwmiamiheraldcomnewsnationworldworldamericascubaarticle255711511html target_blanktolda diplomats havana weekp ptogether strong words government mobilised states repressive apparatus days leading protests heavy police state security presence reported streets cubas major cities entire blocks militarised cordoned cuban relnoreferrer noopener hrefhttpstwittercomyoanisanchezstatus1459968251895681025 target_blankspecial forcesa known boinas negras black berets 40 opposition activists detainedp pothers planned protest placed house arrest tactic long cuban government suppress dissenting voices daniela rojo archipilagos coordinators relnoreferrer noopener hrefhttpstwittercommambisa5status1459629805800931338 target_blankarresteda friday according members opposition activist group whereabouts remain unknown vctor ruiz activist santa clara signed letter notifying authorities intention peacefully march 15 november relnoreferrer noopener hrefhttpswwwgooglecomurlsatrctjqesrcssourcenewssearchcdcadrjauact8ved2ahukewj4_onv2zz0ahuqa8akhvkadksqxfqbkab6bagveaiurlhttps3a2f2fwwwmiamiheraldcom2fnews2fnationworld2fworld2famericas2fcuba2farticle255811301htmlusgaovvaw0oacut_qr1hotzwpyono3a target_blankpreventeda leaving home state security agents independent cuban journalist luz escobar subjected relnoreferrer noopener hrefhttpscpjorg202012cubanjournalistluzescobarbarredfromleavinghomesincedecember4 target_blankrepeated harassmenta cuban authorities past relnoreferrer noopener hrefhttpstwittercomluz_cubastatus1460275458017271811 target_blankblockeda leaving homep pacross cuba similar relnoreferrer noopener hrefhttpstwittercomreuterssarahstatus1460216501634572290 target_blankreportsa activists detained home arrested leinier cruz salfrn march planner guantnamo relnoreferrer noopener hrefhttpstwittercomfelixllerenacubstatus1459004344221773852 target_blankdetaineda speaking online event organised emcnn en espaolem yunior garca 39yearold playwright leading organiser 15 novembers demonstration announced plan march white rose hand central street havana prevented leaving house state security officials day protest subsequently relnoreferrer noopener hrefhttpstwittercomj_bloodworthstatus1460366750692872195 target_blanklowereda cuban flag garcas window cover sign saying mi casa est bloqueada house blocked entire street playwright lives relnoreferrer noopener hrefhttpstwittercommjorgec1994status1460045001363116032 target_blankblockeda stationary bus manned state security agentsp pon day protest organised flash mobs government supporters picketed houses opposition activists early morning crowds recorded relnoreferrer noopener hrefhttpstwittercomalex_glezleonstatus1460291361601642498 target_blankchantinga progovernment slogans insults relnoreferrer noopener hrefhttpstwittercomngameztorresstatus1460337648028073984 target_blankobscenitiesa saily de amarillo prodemocracy activist member archipilago group awoke 530am monday relnoreferrer noopener hrefhttpstwittercomsailydeamarillostatus1460220981029609480 target_blankfinda crowd government supporters outside house holding placards preventing leavingp pthe president miguel dazcanel announced 15 november day demonstration mark return new normality cuba reopened borders international tourists months pandemic restrictions children scheduled return schoolp pas day unfolded presidents version cuba tranquillity relnoreferrer noopener hrefhttpsnewspaxeditionscomnewstourismboardcubatouristsenjoytotalsecurityandtranquillitynewsletter target_blankalludeda government appeal tourists return island looked prevailed protests subdued events july videos emerging social media sorts crowds frightened government summer product states heavyhandedness proof cubans wish return normalcy alluded president normalcy synonymous islanders poverty scarcity political repression p pmembers cuban exile community undoubtedly disappointed streets cuba erupt 15 november supporters cuban government home abroad point evidence cuban opposition lacks support islandp pyet mistake read numbers turn protest juan pappier human rights watch relnoreferrer noopener hrefhttpswwwnytimescom20211115worldamericascubaprotestshtml target_blanktolda emnew york times emyesterday cuban government resorted strategy total suppression prevent repeat events july caught participating faced year cubas spartan prisons relnoreferrer noopener hrefhttpswwwhrworglegacyreports1999cubacuba99605htmtextmost20prisoners20suffer20malnourishment20fromlong20periods20in20isolation20cells target_blanknotoriousa poor conditions physical mistreatment inmatesp pthe stakes high cuba comes challenging government atmosphere fear prevails difficult comprehend outsiders lived systematically repressive regime late gay cuban writer reinaldo arenas relnoreferrer noopener hrefhttpswwwamazoncoukbeforenightfallsreinaldoarenasdp1852428082 target_blankphrased ita embefore night fallsem memoir persecution exile hands communist dictatorship difference communist [liberal democratic] capitalist systems kick ass communist system applaud capitalist system screamp |
619584def5d71aca4ac7eb56 | Why is inflation so bad? | pthat is the theme of a relnoopener hrefhttpswwwbloombergcomopinionarticles20211116higherinflationwhydoeconomistsdislikeitsomuchsrefhtohjx5y target_blankmy latest bloomberg columna here is part of the final bitp
blockquotepi am left with two major worries first higher rates of inflation redistribute wealth in a disruptive manner for better or worse more and more americans are employed in the relatively bureaucratic service sector which includes education health care and government if price inflation spikes as high as 6 most of those workers a relnoopener hrefhttpswwwbloombergcomopinionarticles20211110pessimismabouttheuseconomycomesfromunhappyconsumerssrefep6bv7cs target_blankdo not rapidly receivea an offsetting wage hike to restore their previous standards of livingp
pthey might get higher pay by getting a new job or by credibly threatening to leave but thats often a tense and unsettling position from both a personal and professional standpoint people might even have received stimulus dollars earlier in the pandemic either directly or indirectly and thus broken even or come out ahead still with inflation they will experience a loss of purchasing power and they will hate itp
pthe second major worry is that inflation tends to require a subsequent disinflation if only because people hate inflation so much and we macroeconomists a relnoopener hrefhttpswwwbloombergcomopinionarticles20210221thefourtruthsofmacroeconomicsplusonedebatablepoint target_blankknowa that disinflations or outright deflations tend to bring recessions when the us federal reserve tightens monetary policy by a significant amount aggregate demand in the economy falls leading to losses in output and employmentp
pof course thats a funny way of explaining why higher rates of price inflation are bad essentially inflation is bad because it has to end a subtler version of this theory is that workers and voters have only a limited tolerance for disruptions and when they occur we end up making blunders in our efforts to get out of themp
pthe proper critique of inflation is thus quite general a pandemic is also a disruption and weve made many mistakes in our efforts to end that as well one of those mistakes in fact has been excess inflation it will not be our last mistake as we are still building our everwidening circle of errorsp
blockquote
precommendedp
pthe post a relnofollow hrefhttpmarginalrevolutioncommarginalrevolution202111whyisinflationsobadhtmlwhy is inflation so bada appeared first on a relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap | pthat theme relnoopener hrefhttpswwwbloombergcomopinionarticles20211116higherinflationwhydoeconomistsdislikeitsomuchsrefhtohjx5y target_blankmy latest bloomberg columna final bitp blockquotepi left major worries higher rates inflation redistribute wealth disruptive manner better worse americans employed relatively bureaucratic service sector includes education health care government price inflation spikes high 6 workersa relnoopener hrefhttpswwwbloombergcomopinionarticles20211110pessimismabouttheuseconomycomesfromunhappyconsumerssrefep6bv7cs target_blankdo rapidly receiveaan offsetting wage hike restore previous standards livingp pthey higher pay getting new job credibly threatening leave thats tense unsettling position personal professional standpoint people received stimulus dollars earlier pandemic directly indirectly broken come ahead inflation experience loss purchasing power hate itp pthe second major worry inflation tends require subsequent disinflation people hate inflation macroeconomistsa relnoopener hrefhttpswwwbloombergcomopinionarticles20210221thefourtruthsofmacroeconomicsplusonedebatablepoint target_blankknowathat disinflations outright deflations tend bring recessions federal reserve tightens monetary policy significant aggregate demand economy falls leading losses output employmentp pof course thats funny way explaining higher rates price inflation bad essentially inflation bad end subtler version theory workers voters limited tolerance disruptions occur end making blunders efforts themp pthe proper critique inflation general pandemic disruption weve mistakes efforts end mistakes fact excess inflation mistake building everwidening circle errorsp blockquote precommendedp pthe post relnofollow hrefhttpmarginalrevolutioncommarginalrevolution202111whyisinflationsobadhtmlwhy inflation bada appeared relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap |
61958530f5d71aca4ac7eb5a | We need more families | pthe post a relnofollow hrefhttpswwwspikedonlinecom20211117weneedmorefamilieswe need more familiesa appeared first on a relnofollow hrefhttpswwwspikedonlinecomspikedap | pthe post relnofollow hrefhttpswwwspikedonlinecom20211117weneedmorefamilieswe need familiesa appeared relnofollow hrefhttpswwwspikedonlinecomspikedap |
61958534f5d71aca4ac7eb5c | How the Democrats could split | pwith states cities and even a relnoopener hrefhttpsunherdcom202110atlantaseliteshavehadenough target_blankneighbourhoodsa lining up to secede with all signs of a a relnoopener hrefhttpswwwnewsweekcomamericabuiltgreatcultureprogressiveswantabandonitopinion1649089 target_blankcommon culturea slowly dissipating its become commonplace to assume that a relnoopener hrefhttpshiddentribesus target_blankthe united states has never been so divideda this is mirrored in the increasing polarisation of the democrats and republicans few are willing to switch their vote from one election to the nextp
pbut the blocs arent monolithic hairline cracks at the margin of each coalition foreshadow the defections that often decide electionsp
pthat at least is the implication of a new a relnoopener hrefhttpswwwpewresearchorgpolitics20211109beyondredvsbluethepoliticaltypology2 target_blankreporta from the pew research center according to its findings the democrats are divided by cultural issues such as critical race theory look at how many of them flocked to a relnoopener hrefhttpswwwbbccomnewsworlduscanada59149005 target_blankglenn youngkina in virginia while the gop are split over economic questions indeed its all too easy to forget that an important minority of democratic voters is patriotic worried about cancel culture and wants border control and strong policing likewise a significant bloc of republican voters is sceptical of banks and large corporations and wants them to pay higher taxesp
pthese observations echo the analyses of a relnoopener hrefhttpswwwnytimescom20211008opiniondemocratsdavidshoreducationpolarizationhtml target_blankdavid shora a relnoopener hrefhttpsatlanticbookscoukbookthenewclasswar target_blankmichael linda a relnoopener hrefhttpswwwvoterstudygrouporgpublicationpoliticaldivisionsin2016andbeyond target_blanklee drutmana and others that the median voter leans left on the economy and right on culture the serious challenge for both parties then is whether they can resist influential factions in their respective parties for the democrats thats the aocelizabeth warren progressive caucus for the republicans the paul ryanmitch mcconnell corporate taxcut wingp
divdiv
pdrawing on a large representative sample of americans pew has developed a ninecluster typology of voters including four republican and four democratic categories in addition to one in the middle clusters group peoples answers to a large number of questions by the degree to which their responses correlate for example if people who support black lives matter tend to support higher immigration and higher taxes then those three questions can be reduced to one measure if however there is a group of people who support the first two but not the third policy that becomes a separate clusterp
diva hrefhttpsunherdcom202111wouldamericasurviveacivilwarrefinnara hrefhttpsunherdcom202111wouldamericasurviveacivilwarrefinnarimg srchttpsunherdcomwpcontentuploads202111gettyimages6094814501scalede16366526132601300x169jpgadiva hrefhttpsunherdcom202111wouldamericasurviveacivilwarrefinnarspansuggested readingspanaa hrefhttpsunherdcom202111wouldamericasurviveacivilwarrefinnarh5would america survive a civil warh5apa hrefhttpsunherdcom202111wouldamericasurviveacivilwarrefinnarspanbyspan malcom kyeyuneapdivadiv
pignoring the less distinctive middle three clusters of the pew report yields six groupings three for each of the two main parties for republicans faith and flag conservatives are on the right of pretty much every question committed conservatives are more moderate with a final category populist right who are conservative on immigration progressivism and race but moderate on economics and somewhat centrist on religion faith and flag conservatives tend to be older while populist right voters are distinguished by lower levels of education and religiosityp
pamong democrats the progressive left are very leftwing on essentially all issues while the establishment liberals are a more moderate group democratic mainstays are leftwing on economics but centrist on cultural issues such as immigration or cancel culture the outsider left meanwhile is largely made up of voters who opted for biden but are frustrated with the party and its leaders of these the progressive left make up just 12 of democratic voters and are the whitest democratic cluster at 68 they are also younger the share of progressive leftists among democrats under 30 is 18 compared to just 8 among the over 50sp
pon the face of it splitting the two parties into these groupings reveals where the two parties are most strongly united across the four democratic clusters for example 75 or more generally support higher taxes for high earners and say big business earns too much profit while 85 support black lives matter on the other hand more than 80 of republicans oppose blm a similar proportion believe that government assistance to the poor does more harm than good creating welfare dependency these are the issues which unify each partys coalitionp
pmore interesting however are the fissures that divide them presenting opportunities for the other party to poach supporters and win the tight contests that mark the current electoral era this is most clear with the populist right republicans and democratic mainstay democratsp
figure classwpcaptionimg sizesmaxwidth 456px 100vw 456px srchttpsunherdcomwpcontentuploads202111def3g275x300jpg alt width456 srcsethttpsunherdcomwpcontentuploads202111def3g275x300jpg 275w httpsunherdcomwpcontentuploads202111def3g600x653jpg 600w httpsunherdcomwpcontentuploads202111def3gjpg 606w classwpimage267718 height497figcaption classwpcaptiontextemadapted from pew beyond red vs blue the political typology p 86emfigcaptionfigure
pfigure 1 above adapted from pews report illustrates the responses to two statements the first highlights threats to free speech people being too easily offended by things others say is a major problem in the country today the second concerns hate speech people saying things that are very offensive to others is a major problem in the country todayp
pnotice that all four republican groups lie inside the red circle in the top left quadrant this means that most republicans more than threequarters of most gop clusters think there is a problem with free speech while only a minority think there is too much offensive speechp
diva hrefhttpsunherdcom202111designatedcriminalrefinnara hrefhttpsunherdcom202111designatedcriminalrefinnarimg srchttpsunherdcomwpcontentuploads202111gettyimages515350440copy300x199jpgadiva hrefhttpsunherdcom202111designatedcriminalrefinnarspansuggested readingspanaa hrefhttpsunherdcom202111designatedcriminalrefinnarh5designated criminalh5apa hrefhttpsunherdcom202111designatedcriminalrefinnarspanbyspan david mametapdivadiv
pon the other hand the blue circle includes clusters in both righthand quadrants they are less closely aligned indeed despite what a number of progressive politicians would have you think some 81 of the democratic mainstay cluster believe people are too easily offended aligning them with republican opinion nor is this a small minority this group makes up 28 of the democratic coalition and is older less educated and relatively black and hispanic it voted heavily for biden in the primaries but is much cooler toward candidates like sanders or warrenp
pit represents therefore an important target group for the republicans as glenn youngkins victory in virginia a relnoopener hrefhttpsunherdcomthepostyoungpeopleturnagainstcriticalracetheoryinvirginia target_blankrevealeda culture war issues can act as an important wedge issue for the gop making it imperative for the democrats to put distance between themselves and unpopular progressive causes and the democratic mainstay group diverges from the small progressive left wing in more ways than one on increasing legal immigration 63 of progressive leftists agree but only 28 of democratic mainstays do 71 of the first group think american institutions are systematically biased and must be rebuilt but only 38 of the latter agreep
pmeanwhile the right is also riven with its own divisions the biggest outlier is the populist right cluster which makes up a sizeable 23 of republican voters its members were more likely to say trump was the best president in recent times rather than reagan whereas other republican clusters either split or favoured reagan 87 of this relatively less educated and less religious group say the economic system in this country unfairly favours powerful interests and more than half want higher taxes on people earning over 400000 a yearp
pcrucially this puts them at odds with most republican voters and in the company of most democrats here then lies an opportunity for the democrats if they can peel away populist rightwing voters turned off by countryclub republicanism they can split the gop and flip some trump voters while uniting their own ranksp
psimilarly the relatively old and evangelical faith and flag conservatives cluster is also distinct in its religious americanism among its members 75 say the government should support religious values and beliefs whereas fewer than 30 of republicans outside this cluster agree on samesex marriage and abortion this group is more than 20 points more socially conservative than other republican groupsp
diva hrefhttpsunherdcom202111didcriticalracetheorylosevirginiarefinnara hrefhttpsunherdcom202111didcriticalracetheorylosevirginiarefinnarimg srchttpsunherdcomwpcontentuploads202111gettyimages13509840581300x169jpgadiva hrefhttpsunherdcom202111didcriticalracetheorylosevirginiarefinnarspansuggested readingspanaa hrefhttpsunherdcom202111didcriticalracetheorylosevirginiarefinnarh5did critical race theory lose virginiah5apa hrefhttpsunherdcom202111didcriticalracetheorylosevirginiarefinnarspanbyspan joel kotkinapdivadiv
pso if republicans shift too far toward religious conservatism they will open an opportunity for democrats but while pews findings reveal that the republicans are more fragmented than many would expect it is still the case that the democrats should be more concerned for ultimately pews research reinforces the conclusions of more in commons recent a relnoopener hrefhttpshiddentribesus target_blankemhidden tribesema report using data from 2018 emhidden tribesem identified a heavily white 8 progressive activist segment of the population that was leftwing on identity issues unconcerned with free speech and highly active on social media pews report finds a similar segment the 6 progressive left group who share the same elite young and white social profile that david shor and james carville warn is too dominant among democratic staffersp
pin both surveys a much larger group of moderate leftwing voters often nonwhite older and less educated reject the activists progressive politics and since cultural issues in recent western elections appear to be more important in motivating voters to switch than economic questions the activist left could prove a distinct electoral liability this was the story told by recent elections in virginia new jersey wisconsin and a relnoopener hrefhttpswwwseattletimescomseattlenewspoliticsprogressivesontheropesfivetakeawaysfromseattleselectionnightreturns target_blankseattlea and as long as the democrats fail to realise this its only a matter of time before more of its support base is lured across the political aislep
a hrefhttpsunherdcom202111howthedemocratscouldsplitappcommentsview 14 commentsa | pwith states cities relnoopener hrefhttpsunherdcom202110atlantaseliteshavehadenough target_blankneighbourhoodsa lining secede signs relnoopener hrefhttpswwwnewsweekcomamericabuiltgreatcultureprogressiveswantabandonitopinion1649089 target_blankcommon culturea slowly dissipating commonplace assume relnoopener hrefhttpshiddentribesus target_blankthe united states divideda mirrored increasing polarisation democrats republicans willing switch vote election nextp pbut blocs arent monolithic hairline cracks margin coalition foreshadow defections decide electionsp pthat implication new relnoopener hrefhttpswwwpewresearchorgpolitics20211109beyondredvsbluethepoliticaltypology2 target_blankreporta pew research center according findings democrats divided cultural issues critical race theory look flocked relnoopener hrefhttpswwwbbccomnewsworlduscanada59149005 target_blankglenn youngkina virginia gop split economic questions easy forget important minority democratic voters patriotic worried cancel culture wants border control strong policing likewise significant bloc republican voters sceptical banks large corporations wants pay higher taxesp pthese observations echo analyses relnoopener hrefhttpswwwnytimescom20211008opiniondemocratsdavidshoreducationpolarizationhtml target_blankdavid shora relnoopener hrefhttpsatlanticbookscoukbookthenewclasswar target_blankmichael linda relnoopener hrefhttpswwwvoterstudygrouporgpublicationpoliticaldivisionsin2016andbeyond target_blanklee drutmana median voter leans left economy right culture challenge parties resist influential factions respective parties democrats thats aocelizabeth warren progressive caucus republicans paul ryanmitch mcconnell corporate taxcut wingp divdiv pdrawing large representative sample americans pew developed ninecluster typology voters including republican democratic categories addition middle clusters group peoples answers large number questions degree responses correlate example people support black lives matter tend support higher immigration higher taxes questions reduced measure group people support policy separate clusterp diva hrefhttpsunherdcom202111wouldamericasurviveacivilwarrefinnara hrefhttpsunherdcom202111wouldamericasurviveacivilwarrefinnarimg srchttpsunherdcomwpcontentuploads202111gettyimages6094814501scalede16366526132601300x169jpgadiva hrefhttpsunherdcom202111wouldamericasurviveacivilwarrefinnarspansuggested readingspanaa hrefhttpsunherdcom202111wouldamericasurviveacivilwarrefinnarh5would america survive civil warh5apa hrefhttpsunherdcom202111wouldamericasurviveacivilwarrefinnarspanbyspan malcom kyeyuneapdivadiv pignoring distinctive middle clusters pew report yields groupings main parties republicans faith flag conservatives right pretty question committed conservatives moderate final category populist right conservative immigration progressivism race moderate economics somewhat centrist religion faith flag conservatives tend older populist right voters distinguished lower levels education religiosityp pamong democrats progressive left leftwing essentially issues establishment liberals moderate group democratic mainstays leftwing economics centrist cultural issues immigration cancel culture outsider left largely voters opted biden frustrated party leaders progressive left 12 democratic voters whitest democratic cluster 68 younger share progressive leftists democrats 30 18 compared 8 50sp pon face splitting parties groupings reveals parties strongly united democratic clusters example 75 generally support higher taxes high earners big business earns profit 85 support black lives matter hand 80 republicans oppose blm similar proportion believe government assistance poor harm good creating welfare dependency issues unify partys coalitionp pmore interesting fissures divide presenting opportunities party poach supporters win tight contests mark current electoral era clear populist right republicans democratic mainstay democratsp figure classwpcaptionimg sizesmaxwidth 456px 100vw 456px srchttpsunherdcomwpcontentuploads202111def3g275x300jpg alt width456 srcsethttpsunherdcomwpcontentuploads202111def3g275x300jpg 275w httpsunherdcomwpcontentuploads202111def3g600x653jpg 600w httpsunherdcomwpcontentuploads202111def3gjpg 606w classwpimage267718 height497figcaption classwpcaptiontextemadapted pew red vs blue political typology p 86emfigcaptionfigure pfigure 1 adapted pews report illustrates responses statements highlights threats free speech people easily offended things major problem country today second concerns hate speech people saying things offensive major problem country todayp pnotice republican groups lie inside red circle left quadrant means republicans threequarters gop clusters think problem free speech minority think offensive speechp diva hrefhttpsunherdcom202111designatedcriminalrefinnara hrefhttpsunherdcom202111designatedcriminalrefinnarimg srchttpsunherdcomwpcontentuploads202111gettyimages515350440copy300x199jpgadiva hrefhttpsunherdcom202111designatedcriminalrefinnarspansuggested readingspanaa hrefhttpsunherdcom202111designatedcriminalrefinnarh5designated criminalh5apa hrefhttpsunherdcom202111designatedcriminalrefinnarspanbyspan david mametapdivadiv pon hand blue circle includes clusters righthand quadrants closely aligned despite number progressive politicians think 81 democratic mainstay cluster believe people easily offended aligning republican opinion small minority group makes 28 democratic coalition older educated relatively black hispanic voted heavily biden primaries cooler candidates like sanders warrenp pit represents important target group republicans glenn youngkins victory virginia relnoopener hrefhttpsunherdcomthepostyoungpeopleturnagainstcriticalracetheoryinvirginia target_blankrevealeda culture war issues act important wedge issue gop making imperative democrats distance unpopular progressive causes democratic mainstay group diverges small progressive left wing ways increasing legal immigration 63 progressive leftists agree 28 democratic mainstays 71 group think american institutions systematically biased rebuilt 38 agreep pmeanwhile right riven divisions biggest outlier populist right cluster makes sizeable 23 republican voters members likely trump best president recent times reagan republican clusters split favoured reagan 87 relatively educated religious group economic system country unfairly favours powerful interests half want higher taxes people earning 400000 yearp pcrucially puts odds republican voters company democrats lies opportunity democrats peel away populist rightwing voters turned countryclub republicanism split gop flip trump voters uniting ranksp psimilarly relatively old evangelical faith flag conservatives cluster distinct religious americanism members 75 government support religious values beliefs fewer 30 republicans outside cluster agree samesex marriage abortion group 20 points socially conservative republican groupsp diva hrefhttpsunherdcom202111didcriticalracetheorylosevirginiarefinnara hrefhttpsunherdcom202111didcriticalracetheorylosevirginiarefinnarimg srchttpsunherdcomwpcontentuploads202111gettyimages13509840581300x169jpgadiva hrefhttpsunherdcom202111didcriticalracetheorylosevirginiarefinnarspansuggested readingspanaa hrefhttpsunherdcom202111didcriticalracetheorylosevirginiarefinnarh5did critical race theory lose virginiah5apa hrefhttpsunherdcom202111didcriticalracetheorylosevirginiarefinnarspanbyspan joel kotkinapdivadiv pso republicans shift far religious conservatism open opportunity democrats pews findings reveal republicans fragmented expect case democrats concerned ultimately pews research reinforces conclusions commons recent relnoopener hrefhttpshiddentribesus target_blankemhidden tribesema report data 2018 emhidden tribesem identified heavily white 8 progressive activist segment population leftwing identity issues unconcerned free speech highly active social media pews report finds similar segment 6 progressive left group share elite young white social profile david shor james carville warn dominant democratic staffersp pin surveys larger group moderate leftwing voters nonwhite older educated reject activists progressive politics cultural issues recent western elections appear important motivating voters switch economic questions activist left prove distinct electoral liability story told recent elections virginia new jersey wisconsin relnoopener hrefhttpswwwseattletimescomseattlenewspoliticsprogressivesontheropesfivetakeawaysfromseattleselectionnightreturns target_blankseattlea long democrats fail realise matter time support base lured political aislep hrefhttpsunherdcom202111howthedemocratscouldsplitappcommentsview 14 commentsa |
6196d43c0dd8811afaad04f4 | Despite concerns about inflation, the real cost (and ‘time cost’) of Thanksgiving dinner this year is among the most affordable in history | div classwpblockimagefigurea hrefhttpswwwaeiorgwpcontentuploads202111turkey2021apngx91208img alt width679 srchttpswwwaeiorgwpcontentuploads202111turkey2021apngx91208 classwpimage1008615483 height461afigurediv
div classwpblockimagefigurea hrefhttpswwwaeiorgwpcontentuploads202111turkey2021bpngx91208img alt width633 srchttpswwwaeiorgwpcontentuploads202111turkey2021bpngx91208 classwpimage1008615485 height477afigurediv
pfrom todays annual report and press release from the emamerican farm bureau federationem afbf on the cost of a classic holiday meal a relnoreferrer noopener hrefhttpswwwfborgnewsroomfarmbureausurveyshowsthanksgivingdinnercostup14 target_blanksurvey shows thanksgiving dinner cost up 14ap
blockquote classwpblockquotepenjoying thanksgiving dinner with family and friends is a priority for many americans but paying attention to how the meal will impact the budget is also important farm bureaus 36th annual survey indicates the average cost of this years classic thanksgiving feast for 10 is 5331 or less than 600 per person this is a 641 or 14 increase from last years average of 4690ppthe centerpiece on most thanksgiving tables the turkey costs more than last year at 2399 for a 16pound bird thats roughly 150 per pound up 24 from last year but there are several mitigating factors pp several factors contributed to the increase in average cost of this years thanksgiving dinner said afbf senior economist veronica nigh these include dramatic disruptions to the us economy and supply chains over the last 20 months inflationary pressure throughout the economy difficulty in predicting demand during the covid19 pandemic and high global demand for food particularly meat she explained further the trend of consumers cooking and eating at home more often due to the pandemic led to increased supermarket demand and higher retail food prices in 2020 and 2021 compared to prepandemic prices in 2019 pptaking turkey out of the basket of foods reveals a 66 price increase compared to last year which tracks closely with the consumer price index for food and general inflation across the economy said nigh pblockquote
psome commentsp
p1 compared to 4690 last year strongthe cost for a classic thanksgiving day dinner for 10 people this year is 137 higher at 5331 strongsee blue line in top chart going back to 1986 when the afbf annual survey started the 137 increase in cost this year was the secondhighest annual jump since a 168 increase in 1990 there were also doubledigit increases of 132 in 2011 and 109 in 2007 p
p2 the average price for a 16pound turkey this year 2399 is 237 and 460 higher than last years price of 1939 and the a relnoreferrer noopener hrefhttpswwwfborgfilesyear_over_year_price_comparisonpdf target_blankprices of 10 other food items on the menua are slightly higher than last year the only item of the 12 products on the afbfs thanksgiving menu that decreased in price since last year is cubed stuffing which is 185 cheaper than last year p
p3 adjusted for inflation in 2021 dollars the cost of a classic thanksgiving dinner this year 5331 is only strong7 more expensive than last year at 4983strong compared to the much larger 137 increase in current nominal dollars see the brown line in the top chart the significant difference in percent increases between nominal and real prices is because cpi inflation has gone up by 62 over the last year in real inflationadjusted dollars the only other larger increases than 7 since 1986 than 7 were in 2011 93 and 1990 98 so this years increase is the thirdlargest in the history of the afbf survey strongbut the real inflationadjusted cost of a thanksgiving dinner this year at 5331 is lower than any of the 12 years between 2007 and 2018 and also more affordable than any of the five years from 1986 to 1990 and seven of the nine years from 19952003 strongp
p4 measured in the amount of time worked at the a relnoreferrer noopener hrefhttpsresearchstlouisfedorgfred2seriesahetpi target_blankaverage hourly wage for all private production workers of 2626 in october of this yeara a yearoveryear wage increase of 576 the strongtime coststrong of this years classic turkey dinner is only strong203 hours up from 189 hours last yearstrong importantly even though the time cost is higher this year than 2020 its the secondlowest cost of a classic thanksgiving dinner in the 36year history of the annual afbf reportstrong strongsee bottom chart above p
pcompared to 1986 when the average american would have worked 321 hours to earn the income necessary to purchase the turkey dinner for 10 the time cost for a worker today at roughly only two hours strongis 37 lowerstrong another way to think about is that if the strongtime cost of 321 hours hadnt changed over the last 36 years the cost of a thanksgiving dinner this year would have been 8429 instead of only 5331 strongp
pstrongbottom linestrong the fact that a family in america can celebrate thanksgiving with a classic turkey feast for ten people for just over 5 per person and at a time cost of strongemonly two hours of work at the average hourly wage for one person emstrongmeans that we really have a lot to be thankful for on thanksgiving an abundance of cheap affordable food despite the challenges of the pandemic supply chain issues and rising energy prices the average american earns enough money by the time of his or her morning coffee break working on just one day to be able to afford the cost of a traditional thanksgiving meal for ten compared to 1986 the inflationadjusted cost of a turkey dinner today is 26 cheaper and 37 cheaper measured in time cost for the average worker despite all of the handwringing and alarm bells about inflation this years thanksgiving dinner in america is among the most affordable of the past 36 years relative to our income and relative to the cost of in past years p
div classwpblockimagefigurea hrefhttpswwwaeiorgwpcontentuploads202111afbfa1jpgx91208img alt width468 srchttpswwwaeiorgwpcontentuploads202111afbfa1jpgx91208 classwpimage1008615488 height263afigurediv
phappy thanksgiving and strongembon appetitemstrongp
pthe post a relnofollow hrefhttpswwwaeiorgcarpediemdespiteconcernsaboutinflationtherealcostandtimecostofthanksgivingdinnerthisyearisamongthemostaffordableinhistorydespite concerns about inflation the real cost and time cost of thanksgiving dinner this year is among the most affordable in historya appeared first on a relnofollow hrefhttpswwwaeiorgamerican enterprise institute aeiap | div classwpblockimagefigurea hrefhttpswwwaeiorgwpcontentuploads202111turkey2021apngx91208img alt width679 srchttpswwwaeiorgwpcontentuploads202111turkey2021apngx91208 classwpimage1008615483 height461afigurediv div classwpblockimagefigurea hrefhttpswwwaeiorgwpcontentuploads202111turkey2021bpngx91208img alt width633 srchttpswwwaeiorgwpcontentuploads202111turkey2021bpngx91208 classwpimage1008615485 height477afigurediv pfrom todays annual report press release emamerican farm bureau federationem afbf cost classic holiday meal relnoreferrer noopener hrefhttpswwwfborgnewsroomfarmbureausurveyshowsthanksgivingdinnercostup14 target_blanksurvey shows thanksgiving dinner cost up14ap blockquote classwpblockquotepenjoying thanksgiving dinner family friends priority americans paying attention meal impact budget important farm bureaus 36th annual survey indicates average cost years classic thanksgiving feast 10 5331 600 person 641 14 increase years average 4690ppthe centerpiece thanksgiving tables turkey costs year 2399 16pound bird thats roughly 150 pound 24 year mitigating factors pp factors contributed increase average cost years thanksgiving dinner said afbf senior economist veronica nigh include dramatic disruptions economy supply chains 20 months inflationary pressure economy difficulty predicting demand covid19 pandemic high global demand food particularly meat explained trend consumers cooking eating home pandemic led increased supermarket demand higher retail food prices 2020 2021 compared prepandemic prices 2019 pptaking turkey basket foods reveals 66 price increase compared year tracks closely consumer price index food general inflation economy said nigh pblockquote psome commentsp p1 compared 4690 year strongthe cost classic thanksgiving day dinner 10 people year 137 higher 5331 strongsee blue line chart going 1986 afbf annual survey started 137 increase cost year secondhighest annual jump 168 increase 1990 doubledigit increases 132 2011 109 2007 p p2 average price 16pound turkey year 2399 237 460 higher years price 1939 relnoreferrer noopener hrefhttpswwwfborgfilesyear_over_year_price_comparisonpdf target_blankprices 10 food items menua slightly higher year item 12 products afbfs thanksgiving menu decreased price year cubed stuffing 185 cheaper year p p3 adjusted inflation 2021 dollars cost classic thanksgiving dinner year 5331 strong7 expensive year 4983strong compared larger 137 increase current nominal dollars brown line chart significant difference percent increases nominal real prices cpi inflation gone 62 year real inflationadjusted dollars larger increases 7 1986 7 2011 93 1990 98 years increase thirdlargest history afbf survey strongbut real inflationadjusted cost thanksgiving dinner year 5331 lower 12 years 2007 2018 affordable years 1986 1990 seven years 19952003 strongp p4 measured time worked relnoreferrer noopener hrefhttpsresearchstlouisfedorgfred2seriesahetpi target_blankaverage hourly wage private production workers 2626 october yeara yearoveryear wage increase 576 strongtime coststrong years classic turkey dinner strong203 hours 189 hours yearstrong importantly time cost higher year 2020 secondlowest cost classic thanksgiving dinner 36year history annual afbf reportstrong strongsee chart p pcompared 1986 average american worked 321 hours earn income necessary purchase turkey dinner 10 time cost worker today roughly hours strongis 37 lowerstrong way think strongtime cost 321 hours hadnt changed 36 years cost thanksgiving dinner year 8429 instead 5331 strongp pstrongbottom linestrong fact family america celebrate thanksgiving classic turkey feast people 5 person time cost strongemonly hours work average hourly wage person emstrongmeans lot thankful thanksgiving abundance cheap affordable food despite challenges pandemic supply chain issues rising energy prices average american earns money time morning coffee break working day able afford cost traditional thanksgiving meal compared 1986 inflationadjusted cost turkey dinner today 26 cheaper 37 cheaper measured time cost average worker despite handwringing alarm bells inflation years thanksgiving dinner america affordable past 36 years relative income relative cost past years p div classwpblockimagefigurea hrefhttpswwwaeiorgwpcontentuploads202111afbfa1jpgx91208img alt width468 srchttpswwwaeiorgwpcontentuploads202111afbfa1jpgx91208 classwpimage1008615488 height263afigurediv phappy thanksgiving strongembon appetitemstrongp pthe post relnofollow hrefhttpswwwaeiorgcarpediemdespiteconcernsaboutinflationtherealcostandtimecostofthanksgivingdinnerthisyearisamongthemostaffordableinhistorydespite concerns inflation real cost time cost thanksgiving dinner year affordable historya appeared relnofollow hrefhttpswwwaeiorgamerican enterprise institute aeiap |
6196d45b0dd8811afaad04f8 | The American Medical Association Would Like Doctors To Use Woke Jargon | div
picture
source sizesminwidth 600px 331px 100vw typeimagewebp srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202111jeshootscoml0j0dhvwcieunsplash2400x1350jpgwebp 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202111jeshootscoml0j0dhvwcieunsplash1200x675jpgwebp 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202111jeshootscoml0j0dhvwcieunsplash800x450jpgwebp 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202111jeshootscoml0j0dhvwcieunsplash600x338jpgwebp 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202111jeshootscoml0j0dhvwcieunsplash331x186jpgwebp 331w
source sizesminwidth 600px 331px 100vw typeimagejpeg srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202111jeshootscoml0j0dhvwcieunsplash2400x1350jpg 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202111jeshootscoml0j0dhvwcieunsplash1200x675jpg 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202111jeshootscoml0j0dhvwcieunsplash800x450jpg 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202111jeshootscoml0j0dhvwcieunsplash600x338jpg 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202111jeshootscoml0j0dhvwcieunsplash331x186jpg 331w
img width1200 altjeshootscoml0j0dhvwcieunsplash srchttpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202111jeshootscoml0j0dhvwcieunsplash800x450jpg height675
picture
div
pthe american medical association ama is the paramount advocate lobbyist and trade association of doctors and other medical professionals its influence in the health care industry cannot be overstated and it just released a report cosigned by the association of american medical colleges center for health justice a hrefhttpswwwamaassnorgsystemfilesamaaamcequityguidepdftitleda quotadvancing health equity a guide to language narrative and conceptsquotp
pthe report contains different sorts of advice for making health care more equitable but it mostly focuses on language and unfortunately its authors were clearly influenced by the same kind of progressive activists whose jargon has a hrefhttpsreasoncom20171026oberlinmicroaggressionsstudentsinfected academiaa the guidance ranges from bad to actively harmfulp
ptake a lookp
pimg sizesmaxwidth 1222px 100vw 1222px srchttpsd2eehagpk5cl65cloudfrontnetimgq60uploads202111screenshot20211117at90000pmpng alt width1222 srcsethttpsd2eehagpk5cl65cloudfrontnetimgq60uploads202111screenshot20211117at90000pmpng 1222w httpsd2eehagpk5cl65cloudfrontnetimgq60uploads202111screenshot20211117at90000pm300x94png 300w httpsd2eehagpk5cl65cloudfrontnetimgq60uploads202111screenshot20211117at90000pm1024x320png 1024w httpsd2eehagpk5cl65cloudfrontnetimgq60uploads202111screenshot20211117at90000pm768x240png 768w classwpimage8139608 height382p
pof course medical professionals should avoid unintentional blaming but whats the benefit of avoiding words like quottacklequot and quottargetquot should we no longer tackle obesity or target infections whats dehumanizing about terms like quotvulnerablequot or quothighriskquot the benefit of these words is that they have been around a long time and we know what they mean thats the point of language to clearly communicate ideas we want terminology that people understand not terminology that is maximally politically correctp
pmost of the amas new preferred terminology involves additional syllables youre not supposed to say emhomelessem youre supposed to say empeople experiencing homelessnessem youre not suppose to say emdisabledem youre supposed to say emperson experiencing disabilityem doctors often spend only a few minutes with a patient especially an underprivileged patient i dont think the best remedy for that is to ask doctors to use longer phrases when shorter ones would dop
psome of the new terminology is also inaccurate the report wants doctors to stop using the word quotminorityquot and instead say quotmarginalizedquot but not all people who are part of a minority are marginalized and some people who are marginalized are not part of a minority the report also suggests replacing quotvulnerablequot with quotoppressedquot but not all people with a health vulnerability are facing or have faced oppressionp
plast week centers for disease control and prevention director rochelle walensky inadvertently demonstrated how silly some of this new language would be when she made the following statement quotwe know that vaccination helps to decrease community transmission and protect those who are most vulnerablequot imagine if she had said quotmost oppressedquot instead that would make absolutely no sensep
pquotmen are more vulnerable to covid19 than women but not because men are more oppressedquot a hrefhttpswwwtheatlanticcomideasarchive202111leftistlanguagepolicingwontfixhealthdisparities620695writesa emthe atlanticems conor friedersdorf quotmy grandmother is far emmoreem vulnerable to the disease than a wrongfully incarcerated teenager yet she is far emlessem oppressedquotp
pmeanwhile the report avoids criticizing one of the foremost structures standing in the way of health equity the ama itself as matthew yglesias notes in a a hrefhttpswwwslowboringcomptheamasadvancinghealthequitysubstack posta criticizing the new guidance there are all sorts of ways that the ama works to prevent a better health system from emerging he cites this chart which shows that the us has far fewer doctors per person than other countriesp
pimg datacredityglesias sizesmaxwidth 1176px 100vw 1176px srchttpsd2eehagpk5cl65cloudfrontnetimgq60uploads202111screenshot20211117at92015pmpng alt width1176 srcsethttpsd2eehagpk5cl65cloudfrontnetimgq60uploads202111screenshot20211117at92015pmpng 1176w httpsd2eehagpk5cl65cloudfrontnetimgq60uploads202111screenshot20211117at92015pm300x214png 300w httpsd2eehagpk5cl65cloudfrontnetimgq60uploads202111screenshot20211117at92015pm1024x730png 1024w httpsd2eehagpk5cl65cloudfrontnetimgq60uploads202111screenshot20211117at92015pm768x547png 768w classwpimage8139611 height838p
pone reason this is the case is that the ama is constantly quotblocking a hrefhttpsemailmg1substackcomcejxvkchonsaqhz_mstoaqpgvwhtt1zadjkqqqjix1rcv97_pooqwytlzmpmpd4xbko_nivi8n5mfjdbitqcyyxexyzndytwgpkgpyrhsdn44ewhecij4baix4ihjikgnqt1it2zateprynddip0cv7q3zntgv6n66t4z4vocro82xeozm4rfhhznzvtsp17dz3rv27hhaaiypvkvqvcwhpw2jwqycmti1evfmry_poq8e7r5t0srddxpm0atp2pbxwt8zitx9qeg9yautrbcd7fq9rikptwq7toper7knpxgm0g37fk4s5evtw31dllimh_an06rbelofdqgt9y_e3n6tuouozazysgfmam4a5cljclbx_4pvrvgheuldzzmcrrl2zjzorepg4crqvq9qby1fnbykmor2boyd72c7kalqx4rvp2c datasaferedirecturlhttpswwwgooglecomurlqhttpsemailmg1substackcomcejxvkchonsaqhz_mstoaqpgvwhtt1zadjkqqqjix1rcv97_pooqwytlzmpmpd4xbko_nivi8n5mfjdbitqcyyxexyzndytwgpkgpyrhsdn44ewhecij4baix4ihjikgnqt1it2zateprynddip0cv7q3zntgv6n66t4z4vocro82xeozm4rfhhznzvtsp17dz3rv27hhaaiypvkvqvcwhpw2jwqycmti1evfmry_poq8e7r5t0srddxpm0atp2pbxwt8zitx9qeg9yautrbcd7fq9rikptwq7toper7knpxgm0g37fk4s5evtw31dllimh_an06rbelofdqgt9y_e3n6tuouozazysgfmam4a5cljclbx_4pvrvgheuldzzmcrrl2zjzorepg4crqvq9qby1fnbykmor2boyd72c7kalqx4rvp2campsourcegmailampust1637233533962000ampusgaovvaw1ycrcd7lvu8vtswh2tmnotincreased scope of practice for nursesa making it hard for a hrefhttpsemailmg1substackcomcejwlkd2ohcamhz9munoaodgxxoznvobhpuqvuqgrvhtf2diay2npccf3hkswc6tsrk7t4wudcbbwtcggskocmwjwyhrzkocwdbcd147fuvyuwb2gzfd8ug26c1ftj_mztmlzocmwtg9lwtlbjkxpx4wsnxiomvdpthuecmmdwbrds7yxsm28ihj9yk_h8n3ipm8u9pjwvt13vhuvokhhpuv8s8bseeuttur8ug6hlbjaks1e7ifeiipc3y1ipc7auckwjxe0cesjswtqdh0rbwgjopeihfrdkewx5pcvt9sh7chjpkoeh4vsqnq4stb_9h53vkxb566k9gavt583kjdtlrzp1kka4fk3qbbudma0yf_mwyqols_iusloyypbzqmjwx4_yb1faqxaegj7m2owb7lcxuiv5wxusgndr6d7mfoyu datasaferedirecturlhttpswwwgooglecomurlqhttpsemailmg1substackcomcejwlkd2ohcamhz9munoaodgxxoznvobhpuqvuqgrvhtf2diay2npccf3hkswc6tsrk7t4wudcbbwtcggskocmwjwyhrzkocwdbcd147fuvyuwb2gzfd8ug26c1ftj_mztmlzocmwtg9lwtlbjkxpx4wsnxiomvdpthuecmmdwbrds7yxsm28ihj9yk_h8n3ipm8u9pjwvt13vhuvokhhpuv8s8bseeuttur8ug6hlbjaks1e7ifeiipc3y1ipc7auckwjxe0cesjswtqdh0rbwgjopeihfrdkewx5pcvt9sh7chjpkoeh4vsqnq4stb_9h53vkxb566k9gavt583kjdtlrzp1kka4fk3qbbudma0yf_mwyqols_iusloyypbzqmjwx4_yb1faqxaegj7m2owb7lcxuiv5wxusgndr6d7mfoyuampsourcegmailampust1637233533962000ampusgaovvaw0vcolkzuxouyizmcjm2wlnforeigntrained doctors to practice in the united statesa and historically pushing to a hrefhttpsemailmg1substackcomcejw1ke2owyamhu9tdo0gf6qlfroza0qgnaq1gqicyet247yaziglzs9pgeec8qx2vmh8bpguny0ecyihfmcrtmy_bgdwroml54i3xttbwhjfng3ccsruyhxymdcilhh88lrbzahu3ibsyn5txtaynqr6kl71rets3umjhw8yhzou12vcixixmovol7fm61z_c53nwz1qlhbnshf_yqsrcxsxiitej_ltunuk6ouuv0w4x0yrrpjtme8_esigi6hgilpgxuvvc1tna1iieh1u53tuu2htpv9a2v26yqcthc4j4vo5fnttzejcepsj6_alwfzjdyux0x0dvibluin5qpfpqb_iy1zsjjgbwfgyxickrtby2bbvjqyh4ta3t0jrts7bnvrbmb8afoa16xbch_fxmxxg datasaferedirecturlhttpswwwgooglecomurlqhttpsemailmg1substackcomcejw1ke2owyamhu9tdo0gf6qlfroza0qgnaq1gqicyet247yaziglzs9pgeec8qx2vmh8bpguny0ecyihfmcrtmy_bgdwroml54i3xttbwhjfng3ccsruyhxymdcilhh88lrbzahu3ibsyn5txtaynqr6kl71rets3umjhw8yhzou12vcixixmovol7fm61z_c53nwz1qlhbnshf_yqsrcxsxiitej_ltunuk6ouuv0w4x0yrrpjtme8_esigi6hgilpgxuvvc1tna1iieh1u53tuu2htpv9a2v26yqcthc4j4vo5fnttzejcepsj6_alwfzjdyux0x0dvibluin5qpfpqb_iy1zsjjgbwfgyxickrtby2bbvjqyh4ta3t0jrts7bnvrbmb8afoa16xbch_fxmxxgampsourcegmailampust1637233533962000ampusgaovvaw27h_w1kwrflnptnf84pcpptrain too few doctorsa here at homequot writes yglesias quotits a trade association and unfortunately this is what trade associations doquotp
psimilarly the economists tyler cowen and alex tabarrok a hrefhttpsmarginalrevolutioncommarginalrevolution202111thedangerofdemandingwokephysicianshtmlwritea quotif the ama really wants to do something for health equity they should stop trying to police language and instead a hrefhttpswwwamaassnorgpracticemanagementscopepracticeamasuccessfullyfightsscopepracticeexpansionsthreatensupport nurse practitioners midwives physician assistants and other healthcare professionalsa who want to expand their practices a hrefhttpswwwniskanencenterorgwpcontentuploads202109costdiseasesocialismpdflobby for more physiciansa and an end to the absurd residency bottleneck and support greater hospital competition physician heal thyselfquotp
piframe allowfullscreen srchttpswwwyoutubecomembedh9gmumpomafeatureoembed width500 titlerobby soave medical association wants doctors to use woke jargon confuse and annoy patients height281iframep
pthe post a relnofollow hrefhttpsreasoncom20211118americanmedicalassociationhealthequityreportwokejargonthe american medical association would like doctors to use woke jargona appeared first on a relnofollow hrefhttpsreasoncomreasoncomap | div picture source sizesminwidth 600px 331px 100vw typeimagewebp srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202111jeshootscoml0j0dhvwcieunsplash2400x1350jpgwebp 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202111jeshootscoml0j0dhvwcieunsplash1200x675jpgwebp 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202111jeshootscoml0j0dhvwcieunsplash800x450jpgwebp 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202111jeshootscoml0j0dhvwcieunsplash600x338jpgwebp 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202111jeshootscoml0j0dhvwcieunsplash331x186jpgwebp 331w source sizesminwidth 600px 331px 100vw typeimagejpeg srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202111jeshootscoml0j0dhvwcieunsplash2400x1350jpg 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202111jeshootscoml0j0dhvwcieunsplash1200x675jpg 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202111jeshootscoml0j0dhvwcieunsplash800x450jpg 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202111jeshootscoml0j0dhvwcieunsplash600x338jpg 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202111jeshootscoml0j0dhvwcieunsplash331x186jpg 331w img width1200 altjeshootscoml0j0dhvwcieunsplash srchttpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202111jeshootscoml0j0dhvwcieunsplash800x450jpg height675 picture div pthe american medical association ama paramount advocate lobbyist trade association doctors medical professionals influence health care industry overstated released report cosigned association american medical colleges center health justice hrefhttpswwwamaassnorgsystemfilesamaaamcequityguidepdftitleda quotadvancing health equity guide language narrative conceptsquotp pthe report contains different sorts advice making health care equitable focuses language unfortunately authors clearly influenced kind progressive activists jargon hrefhttpsreasoncom20171026oberlinmicroaggressionsstudentsinfected academiaa guidance ranges bad actively harmfulp ptake lookp pimg sizesmaxwidth 1222px 100vw 1222px srchttpsd2eehagpk5cl65cloudfrontnetimgq60uploads202111screenshot20211117at90000pmpng alt width1222 srcsethttpsd2eehagpk5cl65cloudfrontnetimgq60uploads202111screenshot20211117at90000pmpng 1222w httpsd2eehagpk5cl65cloudfrontnetimgq60uploads202111screenshot20211117at90000pm300x94png 300w httpsd2eehagpk5cl65cloudfrontnetimgq60uploads202111screenshot20211117at90000pm1024x320png 1024w httpsd2eehagpk5cl65cloudfrontnetimgq60uploads202111screenshot20211117at90000pm768x240png 768w classwpimage8139608 height382p pof course medical professionals avoid unintentional blaming whats benefit avoiding words like quottacklequot quottargetquot longer tackle obesity target infections whats dehumanizing terms like quotvulnerablequot quothighriskquot benefit words long time know mean thats point language clearly communicate ideas want terminology people understand terminology maximally politically correctp pmost amas new preferred terminology involves additional syllables youre supposed emhomelessem youre supposed empeople experiencing homelessnessem youre suppose emdisabledem youre supposed emperson experiencing disabilityem doctors spend minutes patient especially underprivileged patient dont think best remedy ask doctors use longer phrases shorter ones dop psome new terminology inaccurate report wants doctors stop word quotminorityquot instead quotmarginalizedquot people minority marginalized people marginalized minority report suggests replacing quotvulnerablequot quotoppressedquot people health vulnerability facing faced oppressionp plast week centers disease control prevention director rochelle walensky inadvertently demonstrated silly new language following statement quotwe know vaccination helps decrease community transmission protect vulnerablequot imagine said quotmost oppressedquot instead absolutely sensep pquotmen vulnerable covid19 women men oppressedquot hrefhttpswwwtheatlanticcomideasarchive202111leftistlanguagepolicingwontfixhealthdisparities620695writesa emthe atlanticems conor friedersdorf quotmy grandmother far emmoreemvulnerable disease wrongfully incarcerated teenager faremlessemoppressedquotp pmeanwhile report avoids criticizing foremost structures standing way health equity ama matthew yglesias notes hrefhttpswwwslowboringcomptheamasadvancinghealthequitysubstack posta criticizing new guidance sorts ways ama works prevent better health system emerging cites chart shows far fewer doctors person countriesp pimg datacredityglesias sizesmaxwidth 1176px 100vw 1176px srchttpsd2eehagpk5cl65cloudfrontnetimgq60uploads202111screenshot20211117at92015pmpng alt width1176 srcsethttpsd2eehagpk5cl65cloudfrontnetimgq60uploads202111screenshot20211117at92015pmpng 1176w httpsd2eehagpk5cl65cloudfrontnetimgq60uploads202111screenshot20211117at92015pm300x214png 300w httpsd2eehagpk5cl65cloudfrontnetimgq60uploads202111screenshot20211117at92015pm1024x730png 1024w httpsd2eehagpk5cl65cloudfrontnetimgq60uploads202111screenshot20211117at92015pm768x547png 768w classwpimage8139611 height838p pone reason case ama constantly quotblocking hrefhttpsemailmg1substackcomcejxvkchonsaqhz_mstoaqpgvwhtt1zadjkqqqjix1rcv97_pooqwytlzmpmpd4xbko_nivi8n5mfjdbitqcyyxexyzndytwgpkgpyrhsdn44ewhecij4baix4ihjikgnqt1it2zateprynddip0cv7q3zntgv6n66t4z4vocro82xeozm4rfhhznzvtsp17dz3rv27hhaaiypvkvqvcwhpw2jwqycmti1evfmry_poq8e7r5t0srddxpm0atp2pbxwt8zitx9qeg9yautrbcd7fq9rikptwq7toper7knpxgm0g37fk4s5evtw31dllimh_an06rbelofdqgt9y_e3n6tuouozazysgfmam4a5cljclbx_4pvrvgheuldzzmcrrl2zjzorepg4crqvq9qby1fnbykmor2boyd72c7kalqx4rvp2c datasaferedirecturlhttpswwwgooglecomurlqhttpsemailmg1substackcomcejxvkchonsaqhz_mstoaqpgvwhtt1zadjkqqqjix1rcv97_pooqwytlzmpmpd4xbko_nivi8n5mfjdbitqcyyxexyzndytwgpkgpyrhsdn44ewhecij4baix4ihjikgnqt1it2zateprynddip0cv7q3zntgv6n66t4z4vocro82xeozm4rfhhznzvtsp17dz3rv27hhaaiypvkvqvcwhpw2jwqycmti1evfmry_poq8e7r5t0srddxpm0atp2pbxwt8zitx9qeg9yautrbcd7fq9rikptwq7toper7knpxgm0g37fk4s5evtw31dllimh_an06rbelofdqgt9y_e3n6tuouozazysgfmam4a5cljclbx_4pvrvgheuldzzmcrrl2zjzorepg4crqvq9qby1fnbykmor2boyd72c7kalqx4rvp2campsourcegmailampust1637233533962000ampusgaovvaw1ycrcd7lvu8vtswh2tmnotincreased scope practice nursesa making hard fora hrefhttpsemailmg1substackcomcejwlkd2ohcamhz9munoaodgxxoznvobhpuqvuqgrvhtf2diay2npccf3hkswc6tsrk7t4wudcbbwtcggskocmwjwyhrzkocwdbcd147fuvyuwb2gzfd8ug26c1ftj_mztmlzocmwtg9lwtlbjkxpx4wsnxiomvdpthuecmmdwbrds7yxsm28ihj9yk_h8n3ipm8u9pjwvt13vhuvokhhpuv8s8bseeuttur8ug6hlbjaks1e7ifeiipc3y1ipc7auckwjxe0cesjswtqdh0rbwgjopeihfrdkewx5pcvt9sh7chjpkoeh4vsqnq4stb_9h53vkxb566k9gavt583kjdtlrzp1kka4fk3qbbudma0yf_mwyqols_iusloyypbzqmjwx4_yb1faqxaegj7m2owb7lcxuiv5wxusgndr6d7mfoyu datasaferedirecturlhttpswwwgooglecomurlqhttpsemailmg1substackcomcejwlkd2ohcamhz9munoaodgxxoznvobhpuqvuqgrvhtf2diay2npccf3hkswc6tsrk7t4wudcbbwtcggskocmwjwyhrzkocwdbcd147fuvyuwb2gzfd8ug26c1ftj_mztmlzocmwtg9lwtlbjkxpx4wsnxiomvdpthuecmmdwbrds7yxsm28ihj9yk_h8n3ipm8u9pjwvt13vhuvokhhpuv8s8bseeuttur8ug6hlbjaks1e7ifeiipc3y1ipc7auckwjxe0cesjswtqdh0rbwgjopeihfrdkewx5pcvt9sh7chjpkoeh4vsqnq4stb_9h53vkxb566k9gavt583kjdtlrzp1kka4fk3qbbudma0yf_mwyqols_iusloyypbzqmjwx4_yb1faqxaegj7m2owb7lcxuiv5wxusgndr6d7mfoyuampsourcegmailampust1637233533962000ampusgaovvaw0vcolkzuxouyizmcjm2wlnforeigntrained doctors practice united statesa historically pushing toa hrefhttpsemailmg1substackcomcejw1ke2owyamhu9tdo0gf6qlfroza0qgnaq1gqicyet247yaziglzs9pgeec8qx2vmh8bpguny0ecyihfmcrtmy_bgdwroml54i3xttbwhjfng3ccsruyhxymdcilhh88lrbzahu3ibsyn5txtaynqr6kl71rets3umjhw8yhzou12vcixixmovol7fm61z_c53nwz1qlhbnshf_yqsrcxsxiitej_ltunuk6ouuv0w4x0yrrpjtme8_esigi6hgilpgxuvvc1tna1iieh1u53tuu2htpv9a2v26yqcthc4j4vo5fnttzejcepsj6_alwfzjdyux0x0dvibluin5qpfpqb_iy1zsjjgbwfgyxickrtby2bbvjqyh4ta3t0jrts7bnvrbmb8afoa16xbch_fxmxxg datasaferedirecturlhttpswwwgooglecomurlqhttpsemailmg1substackcomcejw1ke2owyamhu9tdo0gf6qlfroza0qgnaq1gqicyet247yaziglzs9pgeec8qx2vmh8bpguny0ecyihfmcrtmy_bgdwroml54i3xttbwhjfng3ccsruyhxymdcilhh88lrbzahu3ibsyn5txtaynqr6kl71rets3umjhw8yhzou12vcixixmovol7fm61z_c53nwz1qlhbnshf_yqsrcxsxiitej_ltunuk6ouuv0w4x0yrrpjtme8_esigi6hgilpgxuvvc1tna1iieh1u53tuu2htpv9a2v26yqcthc4j4vo5fnttzejcepsj6_alwfzjdyux0x0dvibluin5qpfpqb_iy1zsjjgbwfgyxickrtby2bbvjqyh4ta3t0jrts7bnvrbmb8afoa16xbch_fxmxxgampsourcegmailampust1637233533962000ampusgaovvaw27h_w1kwrflnptnf84pcpptrain doctorsa homequot writes yglesias quotits trade association unfortunately trade associations doquotp psimilarly economists tyler cowen alex tabarrok hrefhttpsmarginalrevolutioncommarginalrevolution202111thedangerofdemandingwokephysicianshtmlwritea quotifthe ama wants health equity stop trying police language instead hrefhttpswwwamaassnorgpracticemanagementscopepracticeamasuccessfullyfightsscopepracticeexpansionsthreatensupport nurse practitioners midwives physician assistants healthcare professionalsawho want expand practicesa hrefhttpswwwniskanencenterorgwpcontentuploads202109costdiseasesocialismpdflobby physiciansa end absurd residency bottleneck support greater hospital competition physician heal thyselfquotp piframe allowfullscreen srchttpswwwyoutubecomembedh9gmumpomafeatureoembed width500 titlerobby soave medical association wants doctors use woke jargon confuse annoy patients height281iframep pthe post relnofollow hrefhttpsreasoncom20211118americanmedicalassociationhealthequityreportwokejargonthe american medical association like doctors use woke jargona appeared relnofollow hrefhttpsreasoncomreasoncomap |
6196d4790dd8811afaad04fc | Jeffrey Frankel offers Biden advice on inflation | pmany americans were shocked by last months 62 percent leap in the consumer price index over last years figure despite economists warnings for months that rising inflation was a normal and temporary byproduct of the recovering us economy consumer demand is surging as covid restrictions ease they say but products are in limited supply because of pandemicdriven difficulties getting goods manufactured and delivered still americans are growing frustrated and president biden is facing dismal new approval numbers ratcheting up fears among democrats about what this might mean for next years midterm elections but what can a president realistically do the gazette asked economist a hrefhttpswwwhksharvardedufacultyjeffreyfrankeljeffrey a frankela james w harpel professor of capital formation and growth at harvard kennedy school about what tools biden has and how political expediency might affect the administrations decisionmaking the interview was edited for clarity and lengthp
h2qampah2
h3jeffrey a frankelh3
pspangazettespan the 62 percent figure alarmed a lot of noneconomists does it indicate somethings wrong with the economyp
pspanfrankelspan i dont think it indicates anything is wrong with the economy if one allows for the pandemic and the recovery from the pandemic but it is a high level of inflation much higher than weve gotten used to over the last 20 years some forecasts that the effects would be very transitory or mild have been disproven its stronger than some people were expectingp
figure classwpcaptionimg sizesmaxwidth 2500px 100vw 2500px srchttpsnewsharvardeduwpcontentuploads20211120211118_inflation_jeffrey_frankel_2500jpg altjeffrey frankel width2500 srcsethttpsnewsharvardeduwpcontentuploads20211120211118_inflation_jeffrey_frankel_2500jpg 2500w httpsnewsharvardeduwpcontentuploads20211120211118_inflation_jeffrey_frankel_2500300x300jpg 300w httpsnewsharvardeduwpcontentuploads20211120211118_inflation_jeffrey_frankel_25001024x1024jpg 1024w httpsnewsharvardeduwpcontentuploads20211120211118_inflation_jeffrey_frankel_2500150x150jpg 150w httpsnewsharvardeduwpcontentuploads20211120211118_inflation_jeffrey_frankel_2500768x768jpg 768w httpsnewsharvardeduwpcontentuploads20211120211118_inflation_jeffrey_frankel_25001536x1536jpg 1536w httpsnewsharvardeduwpcontentuploads20211120211118_inflation_jeffrey_frankel_25002048x2048jpg 2048w httpsnewsharvardeduwpcontentuploads20211120211118_inflation_jeffrey_frankel_25001350x1350jpg 1350w httpsnewsharvardeduwpcontentuploads20211120211118_inflation_jeffrey_frankel_25001600x1600jpg 1600w httpsnewsharvardeduwpcontentuploads20211120211118_inflation_jeffrey_frankel_2500500x500jpg 500w httpsnewsharvardeduwpcontentuploads20211120211118_inflation_jeffrey_frankel_2500250x250jpg 250w httpsnewsharvardeduwpcontentuploads20211120211118_inflation_jeffrey_frankel_25001500x1500jpg 1500w classwpimage335259 height2500figcaption classwpcaptiontextjeffrey frankel photo by benn craigharvard kennedy schoolfigcaptionfigure
pspangazettespan why does it continue to climb by larger increments than expectedp
pspanfrankelspan demand has been recovering from the pandemicinduced recession faster than supply has thats to be expected we know why supply is recovering slowly a lot of people are staying out of the labor force for the time being for various reasons and there are bottlenecks in the supply chain those will ease over time but for now further recovery in demand is pushing against capacity and capacity is temporarily below what it should be in the long run real gdp has attained what it was before the pandemic and the various measures of the labor force also indicate that were back to where we were before the pandemic so we got through it but a longrun upward trend in what economists call potential output is always to be expected we havent caught up with the longrun trendp
pby no means has inflation ever been or should it be the primary indication of how well the economys doing theres a sense in which this is a good problem to have our current inflation is a result of rapid increase in demand and by some measures unprecedentedly rapid recovery from the recession which is much better than having stayed with economic activity and employment as depressed as it was in early in the spring of 2020p
pspangazettespan the federal reserve based its approach to inflation on the idea that it would rise 2 percent on average over an undefined period of time a strategy called flexible average inflation targeting that has not happened was that a mistakep
pspanfrankelspan they clearly underestimated how much inflation was going to go up or how long it was going to last getting the forecasts wrong i dont think has really had a serious effect on behavior and in case youre going to ask about politics i dont think thats had an effect on what the feds done on the average inflation targeting i wasnt necessarily in favor of it unlike many of my friends and colleagues but it allowed inflation to overshoot somewhat above 2 percent which is what you would want given our circumstances the ait decision was done way before the pandemic at a time when demand is increasing faster than supply its inevitable that inflation is going to go above 2 percent unless youre just going to have a continuation of the worst of the recession which would be a much worse situation so average inflation targeting has worked out better than i expected in that they can say with honesty that this is consistent with their targets whereas before that they would have had trouble justifying inflation going above 2 percentp
pbecause of the inflation which they had underestimated they have started tapering now and will raise interest rates sooner than they had previously anticipated based on other signaling you might think that the end of the quantitative easing which is what tapering is and raising interest rates faster than they previously said you might think that would spook the financial markets and precipitate a sharp fall in securities prices but the current fed has succeeded in signaling their intention so thoroughly if they started raising shortterm interest rates in the middle of next year i dont think thatll catch markets by surprisep
aside
divtheres a sense in which this is a good problem to have our current inflation is a result of rapid increase in demand and by some measures unprecedentedly rapid recovery from the recessiondiv
divdiv
aside
pspangazettespan the biden administration has pledged without specifics to address the labor shortage and supply chain issues what can be done to turn around these two complex problemsp
pspanfrankelspan im not sure how much can be done thats an open question about the supplychain bottlenecks you would think that the ports and logistics companies would have plenty of incentive to get the job done but the white house can and it helped a bit on the margin on the labor force returning if everybody got vaccinated that would go a lot faster we hear so much about vaccine reluctance but what about a reluctance among workers to expose yourself to the virus which is a more widespread phenomenon i thinkp
pin terms of what the president can actually control to reduce inflation one neglected tool is trade policy former president donald trump put these tariffs on aluminum and steel and everything we import from china all kinds of goods the tariffs raise prices to consumers it seems to me a nobrainer to undo those barriers biden should be able to get china and other countries to reciprocally lower some barriers against us but with or without that removing tariffs could bring down consumer prices and prices to businesses for steel and aluminum and all kinds of inputs immediately thats the one thing that the government could most rapidly controlp
panother tool that the administration could deploy if it wanted is to allow state governments implementing the new infrastructure spending to source from abroad if the price is lower rather than insisting on buying american regardless of costp
pspangazettespan thus far the biden administration appears to have been following the advice of economists on inflation but the political pressure is mounting what actions should he take or not take nowp
pspanfrankelspan what would be good to do would be to allow more imports as i said from an economics viewpoint maybe it doesnt occur to the political people but it would bring prices down on all kinds of household appliances autos and other goods it would pay off right awayp
pspangazettespan presidents from both parties always fret about high gas prices because its the first thing voters mention when they complain about the economy what could he dop
pspanfrankelspan theres not much a president can do about the price of gas gas prices and energy prices generally are back to where they were in 2014 but still well below the peak of 2008 and in real terms the late 1970sp
pthe two things that biden like any president reaches for when feeling political pressure and when choosing not to listen to the economists is to try to jawbone oilproducing countries into producing more oil which hes already tried to do and trump tried to do it too we probably wont see more of that because they already tried it and failed the other one is the strategic petroleum reserve the market for oil is a world market i dont think the strategic petroleum reserve would be a very effective tool but he might try itp
pspangazettespan opponents of the infrastructure investment and jobs act biden signed into law this week argue that spending 12 trillion will drive up inflation are the two linkedp
pspanfrankelspan the republican argument is that bidens infrastructure bill and hopefully coming his social spending bill are adding to demand and thats what is causing inflation or will cause more inflation in future and so they would say we shouldnt expend for all those bills thats not an option bidens going to do and also thats not right economically a really big increase in demand like further monetary or fiscal stimulus would worsen inflation but contrary to what you would think from these huge numbers 12 trillion on infrastructure and more on social spending those are very misleading because 1 theyre spread over 10 years 2 some of that increased spending would be in line with a growing economy anyway and 3 the white house proposal is to fully pay for the social spending bill by raising taxes in a targeted way and funding irs enforcement now its not very likely thatll happen because politically they wont get the tax increases through but i think they should pass these bills whether they succeed in raising taxes or not because infrastructure spending is stuff we badly need but the basic logic that continuing to increase demand more rapidly than supply would lead to the prolongation of inflation or even rising inflation i think is rightp | pmany americans shocked months 62 percent leap consumer price index years figure despite economists warnings months rising inflation normal temporary byproduct recovering economy consumer demand surging covid restrictions ease products limited supply pandemicdriven difficulties getting goods manufactured delivered americans growing frustrated president biden facing dismal new approval numbers ratcheting fears democrats mean years midterm elections president realistically gazette asked economist hrefhttpswwwhksharvardedufacultyjeffreyfrankeljeffrey frankela james w harpel professor capital formation growth harvard kennedy school tools biden political expediency affect administrations decisionmaking interview edited clarity lengthp h2qampah2 h3jeffrey frankelh3 pspangazettespan 62 percent figure alarmed lot noneconomists indicate somethings wrong economyp pspanfrankelspan dont think indicates wrong economy allows pandemic recovery pandemic high level inflation higher weve gotten 20 years forecasts effects transitory mild disproven stronger people expectingp figure classwpcaptionimg sizesmaxwidth 2500px 100vw 2500px srchttpsnewsharvardeduwpcontentuploads20211120211118_inflation_jeffrey_frankel_2500jpg altjeffrey frankel width2500 srcsethttpsnewsharvardeduwpcontentuploads20211120211118_inflation_jeffrey_frankel_2500jpg 2500w httpsnewsharvardeduwpcontentuploads20211120211118_inflation_jeffrey_frankel_2500300x300jpg 300w httpsnewsharvardeduwpcontentuploads20211120211118_inflation_jeffrey_frankel_25001024x1024jpg 1024w httpsnewsharvardeduwpcontentuploads20211120211118_inflation_jeffrey_frankel_2500150x150jpg 150w httpsnewsharvardeduwpcontentuploads20211120211118_inflation_jeffrey_frankel_2500768x768jpg 768w httpsnewsharvardeduwpcontentuploads20211120211118_inflation_jeffrey_frankel_25001536x1536jpg 1536w httpsnewsharvardeduwpcontentuploads20211120211118_inflation_jeffrey_frankel_25002048x2048jpg 2048w httpsnewsharvardeduwpcontentuploads20211120211118_inflation_jeffrey_frankel_25001350x1350jpg 1350w httpsnewsharvardeduwpcontentuploads20211120211118_inflation_jeffrey_frankel_25001600x1600jpg 1600w httpsnewsharvardeduwpcontentuploads20211120211118_inflation_jeffrey_frankel_2500500x500jpg 500w httpsnewsharvardeduwpcontentuploads20211120211118_inflation_jeffrey_frankel_2500250x250jpg 250w httpsnewsharvardeduwpcontentuploads20211120211118_inflation_jeffrey_frankel_25001500x1500jpg 1500w classwpimage335259 height2500figcaption classwpcaptiontextjeffrey frankel photo benn craigharvard kennedy schoolfigcaptionfigure pspangazettespan continue climb larger increments expectedp pspanfrankelspan demand recovering pandemicinduced recession faster supply thats expected know supply recovering slowly lot people staying labor force time reasons bottlenecks supply chain ease time recovery demand pushing capacity capacity temporarily long run real gdp attained pandemic measures labor force indicate pandemic got longrun upward trend economists potential output expected havent caught longrun trendp pby means inflation primary indication economys theres sense good problem current inflation result rapid increase demand measures unprecedentedly rapid recovery recession better having stayed economic activity employment depressed early spring 2020p pspangazettespan federal reserve based approach inflation idea rise 2 percent average undefined period time strategy called flexible average inflation targeting happened mistakep pspanfrankelspan clearly underestimated inflation going long going getting forecasts wrong dont think effect behavior case youre going ask politics dont think thats effect feds average inflation targeting wasnt necessarily favor unlike friends colleagues allowed inflation overshoot somewhat 2 percent want given circumstances ait decision way pandemic time demand increasing faster supply inevitable inflation going 2 percent youre going continuation worst recession worse situation average inflation targeting worked better expected honesty consistent targets trouble justifying inflation going 2 percentp pbecause inflation underestimated started tapering raise interest rates sooner previously anticipated based signaling think end quantitative easing tapering raising interest rates faster previously said think spook financial markets precipitate sharp fall securities prices current fed succeeded signaling intention thoroughly started raising shortterm interest rates middle year dont think thatll catch markets surprisep aside divtheres sense good problem current inflation result rapid increase demand measures unprecedentedly rapid recovery recessiondiv divdiv aside pspangazettespan biden administration pledged specifics address labor shortage supply chain issues turn complex problemsp pspanfrankelspan im sure thats open question supplychain bottlenecks think ports logistics companies plenty incentive job white house helped bit margin labor force returning everybody got vaccinated lot faster hear vaccine reluctance reluctance workers expose virus widespread phenomenon thinkp pin terms president actually control reduce inflation neglected tool trade policy president donald trump tariffs aluminum steel import china kinds goods tariffs raise prices consumers nobrainer undo barriers biden able china countries reciprocally lower barriers removing tariffs bring consumer prices prices businesses steel aluminum kinds inputs immediately thats thing government rapidly controlp panother tool administration deploy wanted allow state governments implementing new infrastructure spending source abroad price lower insisting buying american regardless costp pspangazettespan far biden administration appears following advice economists inflation political pressure mounting actions nowp pspanfrankelspan good allow imports said economics viewpoint maybe doesnt occur political people bring prices kinds household appliances autos goods pay right awayp pspangazettespan presidents parties fret high gas prices thing voters mention complain economy dop pspanfrankelspan theres president price gas gas prices energy prices generally 2014 peak 2008 real terms late 1970sp pthe things biden like president reaches feeling political pressure choosing listen economists try jawbone oilproducing countries producing oil hes tried trump tried probably wont tried failed strategic petroleum reserve market oil world market dont think strategic petroleum reserve effective tool try itp pspangazettespan opponents infrastructure investment jobs act biden signed law week argue spending 12 trillion drive inflation linkedp pspanfrankelspan republican argument bidens infrastructure bill hopefully coming social spending bill adding demand thats causing inflation cause inflation future shouldnt expend bills thats option bidens going thats right economically big increase demand like monetary fiscal stimulus worsen inflation contrary think huge numbers 12 trillion infrastructure social spending misleading 1 theyre spread 10 years 2 increased spending line growing economy 3 white house proposal fully pay social spending bill raising taxes targeted way funding irs enforcement likely thatll happen politically wont tax increases think pass bills succeed raising taxes infrastructure spending stuff badly need basic logic continuing increase demand rapidly supply lead prolongation inflation rising inflation think rightp |
6196d4870dd8811afaad04fe | 5 questions for John Logsdon on the commercialization and exploration of space | pstrongby james pethokoukis and john logsdonstrongp
pafter a halfcentury break from manned lunar missions nasa has announced its intent to return astronauts to the moon by 2024 today private companies like spacex have lowered launch costs making space more accessible than ever but is the commercialization of space distracting from continued exploration in a recent podcast episode john logsdon discussed the history and future of space explorationp
pjohn is the founder and professor emeritus of the space policy institute at george washington universitys elliott school of international affairs he is the author of several books on the space program his most recent is ema relnoreferrer noopener hrefhttpswwwamazoncomfrontierpalgravestudieshistorytechnologydp3319989618 target_blankronald reagan and the space frontieraemp
diviframe srchttpsplayercaptivatefmepisodee732588371a44a18ac3bcc706e9c237biframediv
pbelow is an abbreviated transcript of our conversation you can read our full discussion a relnoreferrer noopener hrefhttpswwwaeiorgeconomicslookingbackonthespaceracemylongreadqawithjohnlogsdon target_blankherea you can also subscribe to my podcast on a relnoreferrer noopener hrefhttpspodcastsapplecomuspodcastpoliticaleconomywithjimpethokoukisid589914386 target_blankapple podcastsa or a relnoreferrer noopener hrefhttpswwwstitchercompodcastricochetmoneypoliticswithjimpethokoukis target_blankstitchera or download the podcast on a relnoreferrer noopener hrefhttpsricochetcomseriespoliticaleconomyjamespethokoukis target_blankricochetap
pstrongpethokoukis how do you address critics who say apollo was a waste of valuable resources or that space exploration is about little more than national pride or maybe some sort of softpower geopoliticsstrongp
plogsdon amitai etzioni published a book in 1963 called ema relnoreferrer noopener hrefhttpswwwamazoncommoondoggledomesticinternationalimplicationsspacedpb000r0cfdi target_blankmoondoggleaem and it is a trenchant criticism of the priority allocated to apollo and it was an entirely legitimate criticism i didnt agree with it then i dont agree with it now but there were choices made about how to spend public money not on education not on welfare but on competing with the soviet union for global space leadership and you could say that was or was not worth itp
pjohn kennedy when he decided to send americans to the moon was very clear that it was an element of national security strategy but the problem since the 60s has been whats the question to which the answer is go to mars or return to the moon my own view is that space exploration is an element of human experience that is worth investing inp
pstrongwhat role have american presidents played in the history of us space programsstrongp
pits been my view that government space programs are really presidential issues where a president sees the link between space exploration and some important national priority national image national intervention national morale some of the presidents have seen that others have notp
figure classwpblockimageimg alt srchttpswwwaeiorgwpcontentuploads202111logsdon5qsnixonjpgx91208 classwpimage1008615466figcaptionapollo 11 astronauts neil armstrong michael collins and buzz aldrin with president richard nixonbrvia reutersfigcaptionfigure
pjimmy carter wasnt interested in human space flight at all ronald reagan saw human space flight as kind of a a relnoreferrer noopener hrefhttpswwwamazoncomfrontierpalgravestudieshistorytechnologydp3319989618 target_blanknew frontiera but he didnt put money behind that thought george hw bush was convinced to set a return to the moon and then on to mars as a goal but congress was opposed and there wasnt any strong public support bill clinton was focused on using the space station as an instrument of postcold war diplomacy george w bush had to react after the columbia accident in 2003 but he set out again a vision of longterm sustained exploration with people as well as spacecraftp
pthose starts and stops have persisted since 2004 certainly mr trump saw the dramatic potential of space and set us on a sustained course of exploration president biden has said hes going to stay that course were on a path now to return to the moon with humans some time in the next five to seven yearsp
pstronghow did the apollo missions and manned space exploration come to an end during the nixon administrationstrongp
ppresident nixon knew he had to define what happened after apollo the space task group chaired by a wellknown space expert named spiro agnew his vice president recommended going to mars in the mid1980s if that recommendation had been accepted it would have been a very different program nixon had no interest in spending money on doing thatp
phe was skeptical of continued lunar exploration but after apollo 13 he tried very hard to cancel what turned out to be apollo 16 and 17 it was nasa that canceled the final two planned missions and told nixon theyd rather spend the money on new programs than on repeating trips to the moon so nasa has really not embraced exploration as much as it has embraced building and operating the space shuttle building and operating the space station and only then turning to what do we do next the answer is resume explorationp
pstronghow do you think about the commercialization of space that has occurred in the past decadestrongp
pwell i think what has been going on is a paradigm shift space is a place to do business and the lowering of launch costs is key to that one has to give credit to spacex and elon musk and the introduction of reusability now theres the possibility of trying and failing without great cost and trying and succeeding in various lines of business so space has become an area for profitmaking for applications that benefit humanity in a sense its become dullp
pi still am captured by space exploration by going places seeing new things but thats been kind of overcome except on occasion by space exploitation by finding all the useful things you can do from the orbital perspective and eventually beyond the government still has the lead in exploration both robotic and human because nobody has figured out how to monetize it the maturing of space means that people who are there not because of the excitement of exploration but because of the possibility of creating new businesses new wealth new jobs see it as an area with a lot of potentialp
pstrongthe space race began as a geopolitical rivalry now there seems to be a rivalry between the us and china do you think that will be helpful in keeping americans interested in spacestrongp
pi do its very different than the cold war and the space race in the sense that there are so many more capable space actors clearly china is an ambitious space power the united states has maintained its commitment to a leading position in space i think the competition between those two is very different in character than the ussoviet cold war competition and its probably good for both sides to stimulate activity you can compete without racing what china is doing in civil space i think is in a sense good for everybody it is a separate issue that china is developing military space capabilities that are threatening to the us ability to fight and win wars that is very much a matter of concern but chinas lunar exploration program our artemis exploration program private ventures and return to the moon i think are all good for everybodyp
pemjames pethokoukis is the dewitt wallace fellow at the american enterprise institute where he writes and edits the aeideas blog and hosts a weekly podcast a relnoreferrer noopener hrefhttpswwwaeiorgtagpoliticaleconomypodcast target_blankpolitical economy with james pethokoukisa john logsdon is the founder and professor emeritus of the space policy institute at george washington universitys elliott school of international affairsemp
pdivpstronglearn more stronga hrefhttpswwwaeiorgeconomics5questionsforcharlesfishmanontheapolloprogram5 questions for charles fishman on the apollo programa a hrefhttpswwwaeiorgeconomics5questionsforjohnrothrichbolingmikegoldmatthewweinzierlonthefutureofcommerceinspace5 questions for john roth rich boling mike gold amp matthew weinzierl on the future of commerce in spacea a hrefhttpswwwaeiorgeconomics5questionsfordanieldeudneyonthegeopoliticsofspaceexploration5 questions for daniel deudney on the geopolitics of space explorationapdivbr
pthe post a relnofollow hrefhttpswwwaeiorgeconomics5questionsforjohnlogsdononthecommercializationandexplorationofspace5 questions for john logsdon on the commercialization and exploration of spacea appeared first on a relnofollow hrefhttpswwwaeiorgamerican enterprise institute aeiap | pstrongby james pethokoukis john logsdonstrongp pafter halfcentury break manned lunar missions nasa announced intent return astronauts moon 2024 today private companies like spacex lowered launch costs making space accessible commercialization space distracting continued exploration recent podcast episode john logsdon discussed history future space explorationp pjohn founder professor emeritus space policy institute george washington universitys elliott school international affairs author books space program recent ema relnoreferrer noopener hrefhttpswwwamazoncomfrontierpalgravestudieshistorytechnologydp3319989618 target_blankronald reagan space frontieraemp diviframe srchttpsplayercaptivatefmepisodee732588371a44a18ac3bcc706e9c237biframediv pbelow abbreviated transcript conversation read discussion relnoreferrer noopener hrefhttpswwwaeiorgeconomicslookingbackonthespaceracemylongreadqawithjohnlogsdon target_blankherea subscribe podcast relnoreferrer noopener hrefhttpspodcastsapplecomuspodcastpoliticaleconomywithjimpethokoukisid589914386 target_blankapple podcastsa relnoreferrer noopener hrefhttpswwwstitchercompodcastricochetmoneypoliticswithjimpethokoukis target_blankstitchera download podcast relnoreferrer noopener hrefhttpsricochetcomseriespoliticaleconomyjamespethokoukis target_blankricochetap pstrongpethokoukis address critics apollo waste valuable resources space exploration little national pride maybe sort softpower geopoliticsstrongp plogsdon amitai etzioni published book 1963 called ema relnoreferrer noopener hrefhttpswwwamazoncommoondoggledomesticinternationalimplicationsspacedpb000r0cfdi target_blankmoondoggleaem trenchant criticism priority allocated apollo entirely legitimate criticism didnt agree dont agree choices spend public money education welfare competing soviet union global space leadership worth itp pjohn kennedy decided send americans moon clear element national security strategy problem 60s whats question answer mars return moon view space exploration element human experience worth investing inp pstrongwhat role american presidents played history space programsstrongp pits view government space programs presidential issues president sees link space exploration important national priority national image national intervention national morale presidents seen notp figure classwpblockimageimg alt srchttpswwwaeiorgwpcontentuploads202111logsdon5qsnixonjpgx91208 classwpimage1008615466figcaptionapollo 11 astronauts neil armstrong michael collins buzz aldrin president richard nixonbrvia reutersfigcaptionfigure pjimmy carter wasnt interested human space flight ronald reagan saw human space flight kind relnoreferrer noopener hrefhttpswwwamazoncomfrontierpalgravestudieshistorytechnologydp3319989618 target_blanknew frontiera didnt money thought george hw bush convinced set return moon mars goal congress opposed wasnt strong public support bill clinton focused space station instrument postcold war diplomacy george w bush react columbia accident 2003 set vision longterm sustained exploration people spacecraftp pthose starts stops persisted 2004 certainly mr trump saw dramatic potential space set sustained course exploration president biden said hes going stay course path return moon humans time seven yearsp pstronghow apollo missions manned space exploration come end nixon administrationstrongp ppresident nixon knew define happened apollo space task group chaired wellknown space expert named spiro agnew vice president recommended going mars mid1980s recommendation accepted different program nixon interest spending money thatp phe skeptical continued lunar exploration apollo 13 tried hard cancel turned apollo 16 17 nasa canceled final planned missions told nixon theyd spend money new programs repeating trips moon nasa embraced exploration embraced building operating space shuttle building operating space station turning answer resume explorationp pstronghow think commercialization space occurred past decadestrongp pwell think going paradigm shift space place business lowering launch costs key credit spacex elon musk introduction reusability theres possibility trying failing great cost trying succeeding lines business space area profitmaking applications benefit humanity sense dullp pi captured space exploration going places seeing new things thats kind overcome occasion space exploitation finding useful things orbital perspective eventually government lead exploration robotic human figured monetize maturing space means people excitement exploration possibility creating new businesses new wealth new jobs area lot potentialp pstrongthe space race began geopolitical rivalry rivalry china think helpful keeping americans interested spacestrongp pi different cold war space race sense capable space actors clearly china ambitious space power united states maintained commitment leading position space think competition different character ussoviet cold war competition probably good sides stimulate activity compete racing china civil space think sense good everybody separate issue china developing military space capabilities threatening ability fight win wars matter concern chinas lunar exploration program artemis exploration program private ventures return moon think good everybodyp pemjames pethokoukis dewitt wallace fellow american enterprise institute writes edits aeideas blog hosts weekly podcast relnoreferrer noopener hrefhttpswwwaeiorgtagpoliticaleconomypodcast target_blankpolitical economy james pethokoukisa john logsdon founder professor emeritus space policy institute george washington universitys elliott school international affairsemp pdivpstronglearn stronga hrefhttpswwwaeiorgeconomics5questionsforcharlesfishmanontheapolloprogram5 questions charles fishman apollo programa hrefhttpswwwaeiorgeconomics5questionsforjohnrothrichbolingmikegoldmatthewweinzierlonthefutureofcommerceinspace5 questions john roth rich boling mike gold amp matthew weinzierl future commerce spacea hrefhttpswwwaeiorgeconomics5questionsfordanieldeudneyonthegeopoliticsofspaceexploration5 questions daniel deudney geopolitics space explorationapdivbr pthe post relnofollow hrefhttpswwwaeiorgeconomics5questionsforjohnlogsdononthecommercializationandexplorationofspace5 questions john logsdon commercialization exploration spacea appeared relnofollow hrefhttpswwwaeiorgamerican enterprise institute aeiap |
6196d4a00dd8811afaad0502 | The Covid lab leak theory just got even stronger | ptwo years in there is no doubt the covid pandemic began in the chinese city of wuhan but there is also little doubt that the bat carrying the progenitor of the virus lived somewhere elsep
pcentral to the mystery of covids origin is how a virus normally found in horseshoe bats in caves in the far south of china or southeast asia turned up in a city a thousand miles north new evidence suggests that part of the answer might lie in laosp
pthe search for viruses closely related to sarscov2 took a new turn in september when a team of french and laotian scientists found one in a horseshoe bat living in a cave in the west laotian province of vientiane other related viruses had been found in cambodia thailand japan and elsewhere in china but this one banal52 was different for the first time since the pandemic began this was a virus genetically closer to the human sarscov2 virus than one called ratg13 collected in southern yunnan in 2013 ratg13 which had been stored for six years in a freezer in a lab in wuhan itself is genetically 961 percent the same as sarscov2 laoss banal52 is 968 percentp
pthe discovery of banal52 was greeted with relief by champions of the theory that the virus must have jumped into people in a natural spillover event not an accident inside a laboratory if covids closest cousins are flitting about in bats in southeast asia then that sample in the freezer in wuhan looks less suspicious i am more convinced than ever that sarscov2 has a natural origin said linfa wang of dukenus medical school in singapore a close collaborator of the wuhan scientistsp
ptrue the laos virus lacked a critical feature in a key part of a key gene that makes covid so infectious a special twelveletter segment of genetic text called a furin cleavage site its a feature that has never been seen in a sarslike virus except for sarscov2 apart from that it seemed that the laotian virus might have knocked the burden of proof back across the philosophical net into the court of the proponents of lableakp
pthen last month a bunch of emails uncovered by a lawsuit from the socalled white coat waste project returned the ball right back over the net they comprised an exchange between the american virushunting foundation the ecohealth alliance and its funders in the us government the scientists discussed collecting viruses from bats in eight countries including burma vietnam cambodia and laos between 2016 and 2019 but to avoid the complication of signing up local subcontractors to their grants in those countries they promised to send the samples to a laboratory they already funded and where was this lab wuhanp
psome of the emails talk about sending data not samples but some talk repeatedly about sending actual samples all samples collected would be tested at the wuhan institute of virology reads one from 2016 another in 2018 even talks of sending bats themselves the emails make it clear that wuhan scientists would sometimes be working in the field alongside their us colleaguesp
premember the central issue is how a bat virus got to wuhan so now in both yunnan and laos the only people who knowingly transported bat virus samples to wuhan and only to wuhan were scientists gilles demaneuf a new zealandbased data scientist whos been analyzing this issue says the natural spillover theory has no explanation for why this would result in an outbreak in wuhan of all places and nowhere elsep
pas for that missing furin cleavage site another leaked document revealed in september by drastic a confederation of opensource analysts like demaneuf sent shock waves through the scientific community dr peter daszak head of the ecohealth alliance spelled out plans to work with his collaborators in wuhan and elsewhere to artificially insert novel rare cleavage sites into novel sarslike coronaviruses collected in the field so as to better understand the biological function of cleavage sites his 2018 request for 142 million from the pentagon to do this was turned down amid uneasiness that it was too risky but the very fact that he was proposing it was alarmingp
pmost of the funding for the wuhan institute of virology comes from the chinese not the american government after all so the failure to win the us grant may not have prevented the work being done moreover exactly such an experiment had already been done with a different kind of coronavirus by guess who the wuhan institute of virologyp
pit is almost beyond belief that dr daszak had not volunteered this critical information he played a leading role in trying to dismiss the lableak idea as a conspiracy theory using his membership of the whochina investigation to support the farfetched theory that the virus reached wuhan on frozen foodp
pif the trail to the source of the pandemic leads through laos it is possible western countries can find out more the chinese government has blocked anybody who tries to get near to the mineshaft in yunnan where ratg13 was found but now that we know the us government was funding virus sampling in laos the ecohealth alliance should be required to report in full on exactly what was found saying oh that data belongs to the chinese now is not good enough american taxpayers funded the work belatedly the us national institutes of health has requested more informationp
div
a hrefhttpsspectatorworldcomsubscribethedcdiaryimg alt srchttpsspectatorworldcomwpcontentuploads202110emailnewslettermobpng classwpimage29949a div
pthe wuhan institute had a database of 22257 samples mostly from bats but took it offline on september 12 2019 supposedly because somebody was trying to hack into it the lab has published few details of viruses collected after 2015 so details of any found in laos since then are presumably in that database dr daszak says he knows whats there and its of no relevance yet he refused even to request that the wuhan institute release it despite his close relationship with the scientists in questionp
pbut even finding relevant viruses in laos still wont answer the question of how they got loose in wuhan and with the continuing failure to find any evidence of infected animals for sale in chinese markets the astonishing truth remains this the outbreak happened in a city with the worlds largest research program on batborne coronaviruses whose scientists had gone to at least two places where these sarscov2like viruses live and brought them back to wuhan and to nowhere elsep
pemmatt ridley and alina chansem a hrefhttpsbookshoporga30579780063139121viral the search for the origin of covid19aem is out now this article was originally published in ema hrefhttpswwwspectatorcoukarticlethecovidlableaktheoryjustgotevenstrongerthe spectatoraems uk magazine a hrefhttpsspectatorworldcomsubscribenowsubscribe to the world edition hereaemp
pthe post a relnofollow hrefhttpsspectatorworldcomtopicwuhancovidlableaktheoryevenstrongerthe covid lab leak theory just got even strongera appeared first on a relnofollow hrefhttpsspectatorworldcomthe spectator worldap | ptwo years doubt covid pandemic began chinese city wuhan little doubt bat carrying progenitor virus lived elsep pcentral mystery covids origin virus normally found horseshoe bats caves far south china southeast asia turned city thousand miles north new evidence suggests answer lie laosp pthe search viruses closely related sarscov2 took new turn september team french laotian scientists found horseshoe bat living cave west laotian province vientiane related viruses found cambodia thailand japan china banal52 different time pandemic began virus genetically closer human sarscov2 virus called ratg13 collected southern yunnan 2013 ratg13 stored years freezer lab wuhan genetically 961 percent sarscov2 laoss banal52 968 percentp pthe discovery banal52 greeted relief champions theory virus jumped people natural spillover event accident inside laboratory covids closest cousins flitting bats southeast asia sample freezer wuhan looks suspicious convinced sarscov2 natural origin said linfa wang dukenus medical school singapore close collaborator wuhan scientistsp ptrue laos virus lacked critical feature key key gene makes covid infectious special twelveletter segment genetic text called furin cleavage site feature seen sarslike virus sarscov2 apart laotian virus knocked burden proof philosophical net court proponents lableakp pthen month bunch emails uncovered lawsuit socalled white coat waste project returned ball right net comprised exchange american virushunting foundation ecohealth alliance funders government scientists discussed collecting viruses bats countries including burma vietnam cambodia laos 2016 2019 avoid complication signing local subcontractors grants countries promised send samples laboratory funded lab wuhanp psome emails talk sending data samples talk repeatedly sending actual samples samples collected tested wuhan institute virology reads 2016 2018 talks sending bats emails clear wuhan scientists working field alongside colleaguesp premember central issue bat virus got wuhan yunnan laos people knowingly transported bat virus samples wuhan wuhan scientists gilles demaneuf new zealandbased data scientist whos analyzing issue says natural spillover theory explanation result outbreak wuhan places elsep pas missing furin cleavage site leaked document revealed september drastic confederation opensource analysts like demaneuf sent shock waves scientific community dr peter daszak head ecohealth alliance spelled plans work collaborators wuhan artificially insert novel rare cleavage sites novel sarslike coronaviruses collected field better understand biological function cleavage sites 2018 request 142 million pentagon turned amid uneasiness risky fact proposing alarmingp pmost funding wuhan institute virology comes chinese american government failure win grant prevented work exactly experiment different kind coronavirus guess wuhan institute virologyp pit belief dr daszak volunteered critical information played leading role trying dismiss lableak idea conspiracy theory membership whochina investigation support farfetched theory virus reached wuhan frozen foodp pif trail source pandemic leads laos possible western countries find chinese government blocked anybody tries near mineshaft yunnan ratg13 found know government funding virus sampling laos ecohealth alliance required report exactly found saying oh data belongs chinese good american taxpayers funded work belatedly national institutes health requested informationp div hrefhttpsspectatorworldcomsubscribethedcdiaryimg alt srchttpsspectatorworldcomwpcontentuploads202110emailnewslettermobpng classwpimage29949a div pthe wuhan institute database 22257 samples bats took offline september 12 2019 supposedly somebody trying hack lab published details viruses collected 2015 details found laos presumably database dr daszak says knows whats relevance refused request wuhan institute release despite close relationship scientists questionp pbut finding relevant viruses laos wont answer question got loose wuhan continuing failure find evidence infected animals sale chinese markets astonishing truth remains outbreak happened city worlds largest research program batborne coronaviruses scientists gone places sarscov2like viruses live brought wuhan elsep pemmatt ridley alina chansem hrefhttpsbookshoporga30579780063139121viral search origin covid19aem article originally published inema hrefhttpswwwspectatorcoukarticlethecovidlableaktheoryjustgotevenstrongerthe spectatoraemsuk magazinea hrefhttpsspectatorworldcomsubscribenowsubscribe world edition hereaemp pthe post relnofollow hrefhttpsspectatorworldcomtopicwuhancovidlableaktheoryevenstrongerthe covid lab leak theory got strongera appeared relnofollow hrefhttpsspectatorworldcomthe spectator worldap |
6196d4bc0dd8811afaad0506 | Greg Caskey, GMU job candidate | pa relnoopener hrefhttpswwwgregcaskeycom target_blankgreg caskeya is my student and a phd candidate in his 4th year he focuses on applied microeconomics economic development and political economy particularly regarding the role of china in the developing world his job market paper a datalinkindex2 dataauthnotapplicable relnoopener noreferrer hrefhttpswwwgregcaskeycommedia_files32 titlehttpswwwgregcaskeycommedia_files32 target_blankchinese development lending amp the amplification effecta examines the effects of chinese official lending and foreign aid upon the political institutions of 100 developing nations using a variety of estimators on panel data over the period of 20022017 he finds an amplification effect with respect to chinese development flows while chinese aid amplifies the existing institutional orientation of both autocratic and democratic recipient nations this effect exhibits a greater magnitude in autocracies as sampled autocratic recipients become more autocratic in their institutional orientation relative to sampled democratic recipients becoming more democraticp
phis dissertation is ithree essays on the role of china in the developing worldi and one chapter considers chinese policy toward the uighurs greg has several publications and also reviseandresubmits at good journals please let me know if you would like my letter of recommendation for him he is a great teacher too with lots of experiencep
pthe post a relnofollow hrefhttpmarginalrevolutioncommarginalrevolution202111gregcaskeygmujobcandidatehtmlgreg caskey gmu job candidatea appeared first on a relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap | pa relnoopener hrefhttpswwwgregcaskeycom target_blankgreg caskeya student phd candidate 4th year focuses applied microeconomics economic development political economy particularly role china developing world job market paper datalinkindex2 dataauthnotapplicable relnoopener noreferrer hrefhttpswwwgregcaskeycommedia_files32 titlehttpswwwgregcaskeycommedia_files32 target_blankchinese development lending amp amplification effecta examines effects chinese official lending foreign aid political institutions 100 developing nations variety estimators panel data period 20022017 finds amplification effect respect chinese development flows chinese aid amplifies existing institutional orientation autocratic democratic recipient nations effect exhibits greater magnitude autocracies sampled autocratic recipients autocratic institutional orientation relative sampled democratic recipients democraticp phis dissertation ithree essays role china developing worldi chapter considers chinese policy uighurs greg publications reviseandresubmits good journals let know like letter recommendation great teacher lots experiencep pthe post relnofollow hrefhttpmarginalrevolutioncommarginalrevolution202111gregcaskeygmujobcandidatehtmlgreg caskey gmu job candidatea appeared relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap |
6196d5380dd8811afaad0510 | Tyler Cowen speaks at OpenAI | pin front of open ai this was recorded circa may 2021 i quite liked the exchanges recommended and sam is supersharp you can listen a relnoopener hrefhttpssoundcloudcomsamaltman543613753tyleropenai target_blankhereap
pthe post a relnofollow hrefhttpmarginalrevolutioncommarginalrevolution202111samaltmaninterviewsmeaboutaihtmlsam altman interviews me about aia appeared first on a relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap | pin open ai recorded circa 2021 liked exchanges recommended sam supersharp listen relnoopener hrefhttpssoundcloudcomsamaltman543613753tyleropenai target_blankhereap pthe post relnofollow hrefhttpmarginalrevolutioncommarginalrevolution202111samaltmaninterviewsmeaboutaihtmlsam altman interviews aia appeared relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap |
6196d5520dd8811afaad0512 | Was It a Lab Leak? The Mysterious Origin of COVID-19 | div
picture
source sizesminwidth 600px 331px 100vw typeimagewebp srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202111lableakjpegwebp 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202111lableak1200x675jpegwebp 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202111lableak800x450jpegwebp 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202111lableak600x338jpegwebp 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202111lableak331x186jpegwebp 331w
source sizesminwidth 600px 331px 100vw typeimagejpeg srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202111lableakjpeg 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202111lableak1200x675jpeg 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202111lableak800x450jpeg 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202111lableak600x338jpeg 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202111lableak331x186jpeg 331w
img width1200 altlableak srchttpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202111lableak800x450jpeg height675
picture
div
pwhere did the virus that changed the world come fromp
pthe prevailing theory for a long time was that wild animals sold as food at a wet market in wuhan china had started the outbreakp
pone of the first scientists to seriously question the official narrative was botao xiao who in february 2020 published a hrefhttpsimgprodtgcom24mediasetitimages202002161147201925eb8307f017c4075a697348628da0204pdfa preprint papera arguing that quotthe killer coronavirus probably originated from a laboratory in wuhanquotp
pthe author pointed out that there was no evidence that the vendors at the wet market in wuhan sold bat meat on the other hand there emwereem two research labs studying batborne coronaviruses located in wuhan where a virus could have accidentally infected workers causing them to spread the disease to the general public xiao withdrew the paper two weeks later after chinese authorities a hrefhttpswwwglobaltimescncontent1178363shtmldeclareda that the lableak theory had no meritp
pthe chinese government proceeded to a hrefhttpstheweekcomspeedreads908415chinareportedlygivingextrascrutinyresearchcoronavirusoriginsclamp downa on research into the viruss origins and ordered the closure of a lab that had shared the viruss genetic sequence with other scientists in january 2020 the government also forced the lab to destroy its viral samplesp
pto this day the chinese government a hrefhttpswwwwsjcomarticlesintelligenceonsickstaffatwuhanlabfuelsdebateoncovid19origin11621796228modhp_lead_pos7wont allowa outside researchers to test blood drawn from employees of the wuhan institute of virology who according to a us intelligence report were hospitalized for a flulike illness in november 2019weeks before the first documented humantohuman transmission chinese authorities cited a hrefhttpswwwmsncomeninnewsworldcovid19chinaflatlyrejectswhosplantorevisitwuhanlableaktheoryaraamqlvyprivacy concernsa to the world health organization who team that requested the samplesp
ptheres no direct proof that the virus originated from a lab but theres also no such proof that humans first became infected by eating bats or through exposure to pangolins theories that were treated as a hrefhttpswebarchiveorgweb20200403210001httpstwittercomlaurie_garrettstatus1246174250693791745unimpeachable facta early in the pandemicp
pin february 2020 a group of scientists signed a a hrefhttpswwwthelancetcomjournalslancetarticlepiis0140673620304189fulltextstatementa published in emthe lancetem denouncing speculation about potential nonnatural origins of the virus as quotconspiracy theoriesquotp
ponly following the publication of a hrefhttpsusrtkorgwpcontentuploads202011the_lancet_emails_daszak2620pdfleaked emailsa did it become clear that the scientist who brought his colleagues together to cosign the emlancetem statement was peter daszak head of ecohealth alliance the nonprofit that secured us government funding for controversial research on batborne coronaviruses at the wuhan institute of virology daszak assured his cosigners that the ecohealth logo wouldnt appear on the letter and wrote that he hoped quotto avoid the appearance of a political statementquotp
pdaszak also coauthored a june 2020 oped in emtheem iguardiani a hrefhttpswwwtheguardiancomcommentisfree2020jun09conspiraciescovid19labfalsepandemicheadlineda quotignore the conspiracy theories scientists know covid19 wasnt created in a labquot without disclosing a potential conflict of interestp
pmedia coverage following the publication of the emlancetem letter a hrefhttpswwwforbescomsitesstartswithabang20210603thewuhanlableakhypothesisisaconspiracytheorynotscienceoverwhelminglya a hrefhttpswwwpolitifactcomarticle2020jan24factcheckinghoaxesandconspiraciesaboutcoronaframeda a hrefhttpswwwnytimescom20200217businessmediacoronavirustomcottonchinahtmldiscussiona of the lableak hypothesis as a quota hrefhttpswwwvoxcom20203421156607howdidthecoronavirusgetstartedchinawuhanlabconspiracy theoryaquot often tying it to former president donald trump after he and former secretary of state mike pompeo made public statements a hrefhttpswwwpoliticocomnews20210615wuhanlabtrumpofficialscovid494700promotinga the lableak theory as the explanationp
pspanquotthat episode does not reflect well on scientistsquot says sspancience writer matt ridley coauthor of the a hrefhttpswwwamazoncomexecobidosasinb097clv3qpreasonmagazinea20new booka iviral the search for the origin of covid19ip
pridley says that white house covid19 adviser anthony faucis a hrefhttpswwwdocumentcloudorgdocuments20793561leopoldnihfoiaanthonyfauciemailsemailsa which were made public through a freedom of information act request show that behind the scenes scientists were taking the lableak theory seriously all alongp
pspanquota number of leading virologists were talking to each other and were saying to each other we think this might look a bit like a virus thats been engineered in the laboratoryquot says ridley referencing a january 31 2020 email in which researcher kristian g andersen says that quotone has to look really closely at all the sequences to see that some of the features potentially look engineeredquot fauci replies a day later quotthanks kristian talk soon on the callquotspanp
pspanquotand at the end of that phone call they all did a very rapid emvoltefaceem and started writing articles almost immediatelyquot says ridley referring to an influential article andersen and his colleagues a hrefhttpswwwnaturecomarticless4159102008209publisheda in emnature emon march 17 2020 stating that quotour analyses clearly show that sarscov2 is not a laboratory construct or a purposefully manipulated virusquot on march 6 andersen emailed fauci to tell him the paper had been accepted for publication to which fauci replied quotnice job on the paperquotspanp
pspanbut ridley says that its daszaks efforts to obscure his connections to the wuhan institute of virology while publishing attacks on the lableak hypothesis that are most alarmingspanp
pspanquotit does raise very serious concerns that dr spanspandaszak needs to answerquot says ridley quotive tried to correspond with him numerous times ive never yet had a responsei never said anything rude about him but he blocked me on twitter so i cant get answers out of himquot spanp
pdaszak did not reply to emreasonems interview requestp
pridleys writing partner on the new book is the broad institute of mit and harvards alina chan one of the earliest and most outspoken public skeptics of the naturalorigin hypothesis she says that when she and her colleagues published a a hrefhttpseuropepmcorgarticlepprppr157935preprint papera questioning the consensus she hadnt been aware of the ilancet iletter organized by daszak she says she believes it couldve had a major chilling effect on the scientific discussion in those early daysp
pspanquotthey were saying that anyone saying that this virus didnt come from nature is a conspiracy theoristquot says chan quotother people when they read this letter they might have thought im not going to put my neck out to say that this may have come from a labquot spanp
pchan a molecular biologist argued in the paper that because sarscov2 was so well adapted to humans there was reason to be skeptical that it had recently come from an animal if it had recently come from bats or pangolins she wouldve expected the virus to have been rapidly mutating in the early days of the pandemic to become better adapted to human tissuep
pchan partially credits this insight to her experience in the severe acute respiratory syndrome sars outbreak of 2003 which she lived through in singaporep
pspanquotin that situation and that outbreak the virus had rapidly picked up dozens of mutations in the early three monthsquot says chan quotby comparison for sarscov2 that had very few of these mutations so its suggested to me that this virus had really picked up many useful mutations for infecting and transmitting amongst humans prior to its detection in december 2019quotspanp
panother major difference is that during the 2003 outbreak authorities a hrefhttpswwwtheguardiancomworld2003may24chinasarsdiscovereda previous sars infections among animals being sold at markets in south china within a couple of months thats not the case with sarscov2 despite initial suspicions that a wet market was to blamep
pspanquoteven though the first class of cases identified was at the seafood market they never found any signs of animals that were infected by this virusquot says chan quotspanspanso up until today theres no sign of an animal [in wuhan] that was ever infected by sarscov2 and then gave it to humansquotspanp
pwhen the who sent a team to investigate the viruss origins in january 2021 daszak was the only american member included the team dismissed the lableak hypothesis before who leadership later backtrackedp
pdaszak granted an interview to i60 minutesi following that trip to wuhan and suggested that farm animals were the likely culpritp
pspanquotnow what weve gotta do is go to those farms and investigate talk to the farmers talk to their relatives test them see if there were spikes in virus there firstquot daszak toldspanispan 60 minutes spanispanbut no farm animals have been identified as the hosts yetspanp
ptheres a detail that emerged after the i60 minutesi report that ridley would like daszak to explain recentlyleaked documents a hrefhttpstheinterceptcom20211021virusmerswuhanexperimentsshowa that ecohealth alliance applied for a research grant related to inserting whats called a furin cleavage site into sarslike coronaviruses this very furin cleavage site may be what makes sarscov2 a hrefhttpspubmedncbinlmnihgov32869021so infectiousa and its what distinguishes it from any sarslike coronaviruses as yet found in the wild the grant request was rejected but did the wuhan laboratory engage in this research even without funding from that grant daszak may be able to help answer that questionp
pspanquotthe fact that that is probably the feature that makes the virus sufficiently infectious to start a pandemic means that it is a highly important thingquot says ridley quotso you would think that a scientist who knew that he had put in a grant application in 2018 to put furin cleavage sites into sarslike viruseswould volunteer that information early in the pandemicquotspanp
pridley and chan also find it suspicious that when chinas premier bat coronavirus expertand daszaks collaborator in wuhanpublished her complete analysis of the sarscov2 genome she neglected to mention this highly unusual furin cleavage sitep
pafter the em60 minutesem interview more leaked a hrefhttpstheinterceptcom20211021virusmerswuhanexperimentsdocumentsa showed that ecohealth alliance worked with the wuhan institute of virology to make several batborne sarslike coronavirusesand even middle east respiratory syndrome mersmore infectious to human cellsp
pchan and ridley say that when they started writing the book they didnt have a strong view about which theory was correct but these recent revelations have shifted their thinking in favor of the lableak theoryp
pquotin light of grant proposals and reports released in the past 2 monthsquot a hrefhttpstwittercomayjchanstatus1452634561767165962s20chan wrote on twittera quotwe know novel sarslike viruses were being synthesized and engineered at unprecedented scalequotp
pspanquotthat changed my mind completely knowing that there actually was a plan a pipeline a protocol for doing this work in 2018 so now for me genetic engineering is very much on the tablequot says chan quotif it came from a lab [the likelihood is] close to a 5050 chance that [genetic engineering] happenedquotspanp
pthis question was at the center of a a hrefhttpswwwyoutubecomwatchvpnb2yxri6eyheated exchangea between fauci and sen rand paul rky over possible national institutes of health nih funding of socalled gain of function research which involves purposely making a virus more infectious to humansp
pbut much of the blame for the devastating scope of the pandemic says ridley rests on chinese authorities who punished whistleblowers like ophthalmologist a hrefhttpseditioncnncom20200208opinionscoronavirusbociurkiwindexhtmlli wenlianga who tried to get the word out about the emergence of a new sarslike virus to his colleagues the government successfully kept humantohuman transmission of the disease under wraps for weeks and maybe longerp
pspanquotcommunist regimes tend to be secretivequot says ridley quotthere tends to be an assumption that you dont talk about things unless youre allowed to rather than the other way around but [chinese president] xi jinping being a much more dictatorial and authoritarian ruler than his immediate predecessors by 2019 it was more and more the case that scientists in laboratories and doctors in hospitals were under orders not to communicate with thestrong strongoutside world about things that the regime might not want them tospanspandid that play a part in the epidemic escaping and getting to the rest of the world and turning into a pandemic you bet it didquot spanp
pthe wuhan institute of virology houses samples of ratg13 a bat virus that is one of the closest known genetic matches to sarscov2 but to this day information about other coronaviruses in the wuhan lab hasnt been released so we dont know if the lab was working with a virus thats even more closely related to sarscov2p
pthe labs public database of viral samples could hold some answers but it was taken offline in february and had been modified in december which we know because of work by the dedicated research and scientific team investigating covid19 a hrefhttpsdrasticsciencecomdrastica a decentralized group of volunteers who compile and analyze opensource material and leaked documents to investigate the origins of covid19p
pspanquotonce i realized [the lableak hypothesis] was being discredited without any evidence i just couldnt stay silentquot says spanyuri deigin a biotech entrepreneur and one of the founding members of drasticp
pa key revelation uncovered by the group was that the wuhan institute of virology database was first taken down in september 2019 three months before the pandemic became publicly known a description of the database was modified on december 30 2019 the day shi zhengli told chinese state television that her lab first obtained samples of the virus in wuhanp
pwuhan scientists accessed the database a few times before it was permanently removed in february 2020 for alleged quotsecurity concernsquotp
pquotfor them to take it down is very suspicious and of course shis explanation that she took it down to prevent hackers from attacking is complete bullshit because it was a public database to begin withquot says deiginp
pa member of the drastic team also discovered that the wuhan team had collected key samplesincluding one of the viruss closest known genetic matchesfrom a mine where some workers had fallen sick and died after clearing out bat droppings chinese authorities have denied outsiders any access to examine the minep
pthough theres mounting circumstantial evidence to support the lableak theory government officials maintain that the naturalorigin hypothesis is more likely a us intelligence a hrefhttpswwwdnigovfilesodnidocumentsassessmentsdeclassifiedassessmentoncovid19originspdfreporta declassified on october 29 2020 said four intel agencies had low confidence that the virus most likely emerged in nature one agency had moderate confidence that it leaked from a lab and analysts at three agencies remained quotunable to coalesce around either explanation without additional informationquot the report did conclude that sarscov2 was unlikely to be a biological weaponp
pnih director francis collins who didnt reply to emreasonems interview request a hrefhttpswwwyoutubecomwatchvmrzesjshketolda computer scientist and podcast host lex fridman in early november that hes open to the lableak hypothesis but still believes strongly that the virus is of natural originp
pbetween july 2020 and january 2021 an international team of scientists a hrefhttpswwwdigitaljournalcomtechsciencevirusesfoundinlaosbatsareclosestknownrelativestosarscov2articlecaptureda bats in laos carrying a newly discovered coronavirus thats the closest known genetic match to sarscov2even closer than the virus held in the wuhan lab which some say supports the naturalorigin theory but ridley chan and deigin point out that it lacks the crucial furin cleavage site which they suspect scientists inserted in a labp
psupporters of the naturalorigin theory point out that no quotsmoking gunquot virus has yet been found in the version of the wuhan database uncovered by drastic but chan points out that this version of the database is years out of date because the wuhan researchers generally dont enter new viruses until theyve had a chance to sequence and publish studies about themp
pspanquotso we have barely any concept of what viruses and sequences they might have found after 2016 in the years leading up to covid19quot says chan quotso without access to the information it becomes very difficult for us to guess whether or not they finally found the precursor of sarscov2 in the labs and were working with itquotspanp
pridley says that he doesnt want a fear of biotechnology which he credits for alleviating human suffering to hamper scientific progress because of what may have happened in wuhan but he thinks scientists should convene an international forum to set stricter ethical guidelines prohibiting dangerous types of research such as harvesting bat viruses from faraway caves and bringing them to large urban centers to run experiments that make them more infectious to human cells one chinaproduced a hrefhttpswwwyoutubecomwatchv_txymxl9nj0documentarya released in december 2019 showcases researchers doing this work some of them without proper protective gearp
pspanquotgoing out and harvesting viruses in wild places with pandemic potential and bringing them back to cities to work on them probably isnt very sensiblequot says ridley quotispanspanf we could get the us the uk australia japan other major countries to sign a treaty saying when theres an outbreak in our country we promise to open up as far as possible and tell you everything we know then the very fact that some countries wont sign that treaty will itself put pressure on themquotspanp
pspanhe points to the emergence of the international atomic energy agency as a model for nations to follow in terms of preventing future lab leaks of potentially pandemiccausing pathogensspanp
pand ridley says that despite the months of obfuscation by chinese authorities virologists and even some us media outlets hes optimistic that the truth will emerge in timep
pquotit may take a long timequot says ridley quotthe fall of the soviet union did lead to significant revelations about biological accidents therei think therefore it may take a change of regime in beijing before we find out more but i think there are people who know what happened whatever happened even if its just what happened in a marketthere are plenty of people who say its too late weve lost the chance to find out im not one of them at least not yetquotp
pemspanproduced by zach weissmueller graphic intro and timeline graphics by tomasz kaye additional graphics by calvin transpanemp
pemspanimages spanspanhe huan xinhua news agencynewscom yin gang xinhua news agencynewscom imagine chinanewscom kyodonewscom hitoshi katanodapolarisnewscom dickson leescmpnewscom design cellsscience photo librarynewscom wang bingyueyepress eyepressnewscom eyepress eyepressnewscom edwin remsberg vwpicsnewscom shepherd zhoufeaturechinanewscom xie huanchi xinhua news agencynewscom li xueren xinhua news agencynewscom wang ye xinhua news agencynewscom imagine chinanewscom chine nouvellesipanewscom chine nouvellesipanewscom chine nouvellesipanewscom shi zhifeaturechinanewscom xiao yijiu xinhua news agencynewscom christophe gateaudpapicturealliancenewscom yin gang xinhua news agencynewscom andre malerbazumapressnewscom u peng xinhua news agencynewscomspanemp
pthe post a relnofollow hrefhttpsreasoncomvideo20211118wasitalableakthemysteriousoriginofcovid19was it a lab leak the mysterious origin of covid19a appeared first on a relnofollow hrefhttpsreasoncomreasoncomap | div picture source sizesminwidth 600px 331px 100vw typeimagewebp srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202111lableakjpegwebp 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202111lableak1200x675jpegwebp 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202111lableak800x450jpegwebp 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202111lableak600x338jpegwebp 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202111lableak331x186jpegwebp 331w source sizesminwidth 600px 331px 100vw typeimagejpeg srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202111lableakjpeg 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202111lableak1200x675jpeg 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202111lableak800x450jpeg 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202111lableak600x338jpeg 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202111lableak331x186jpeg 331w img width1200 altlableak srchttpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202111lableak800x450jpeg height675 picture div pwhere virus changed world come fromp pthe prevailing theory long time wild animals sold food wet market wuhan china started outbreakp pone scientists seriously question official narrative botao xiao february 2020 published hrefhttpsimgprodtgcom24mediasetitimages202002161147201925eb8307f017c4075a697348628da0204pdfa preprint papera arguing quotthe killer coronavirus probably originated laboratory wuhanquotp pthe author pointed evidence vendors wet market wuhan sold bat meat hand emwereem research labs studying batborne coronaviruses located wuhan virus accidentally infected workers causing spread disease general public xiao withdrew paper weeks later chinese authorities hrefhttpswwwglobaltimescncontent1178363shtmldeclareda lableak theory meritp pthe chinese government proceeded hrefhttpstheweekcomspeedreads908415chinareportedlygivingextrascrutinyresearchcoronavirusoriginsclamp downa research viruss origins ordered closure lab shared viruss genetic sequence scientists january 2020 government forced lab destroy viral samplesp pto day chinese government hrefhttpswwwwsjcomarticlesintelligenceonsickstaffatwuhanlabfuelsdebateoncovid19origin11621796228modhp_lead_pos7wont allowa outside researchers test blood drawn employees wuhan institute virology according intelligence report hospitalized flulike illness november 2019weeks documented humantohuman transmission chinese authorities cited hrefhttpswwwmsncomeninnewsworldcovid19chinaflatlyrejectswhosplantorevisitwuhanlableaktheoryaraamqlvyprivacy concernsa world health organization team requested samplesp ptheres direct proof virus originated lab theres proof humans infected eating bats exposure pangolins theories treated hrefhttpswebarchiveorgweb20200403210001httpstwittercomlaurie_garrettstatus1246174250693791745unimpeachable facta early pandemicp pin february 2020 group scientists signed hrefhttpswwwthelancetcomjournalslancetarticlepiis0140673620304189fulltextstatementa published emthe lancetem denouncing speculation potential nonnatural origins virus quotconspiracy theoriesquotp ponly following publication hrefhttpsusrtkorgwpcontentuploads202011the_lancet_emails_daszak2620pdfleaked emailsa clear scientist brought colleagues cosign emlancetem statement peter daszak head ecohealth alliance nonprofit secured government funding controversial research batborne coronaviruses wuhan institute virology daszak assured cosigners ecohealth logo wouldnt appear letter wrote hoped quotto avoid appearance political statementquotp pdaszak coauthored june 2020 oped emtheem iguardiani hrefhttpswwwtheguardiancomcommentisfree2020jun09conspiraciescovid19labfalsepandemicheadlinedaquotignore conspiracy theories scientists know covid19 wasnt created labquot disclosing potential conflict interestp pmedia coverage following publication emlancetem letter hrefhttpswwwforbescomsitesstartswithabang20210603thewuhanlableakhypothesisisaconspiracytheorynotscienceoverwhelminglya hrefhttpswwwpolitifactcomarticle2020jan24factcheckinghoaxesandconspiraciesaboutcoronaframeda hrefhttpswwwnytimescom20200217businessmediacoronavirustomcottonchinahtmldiscussiona lableak hypothesis quota hrefhttpswwwvoxcom20203421156607howdidthecoronavirusgetstartedchinawuhanlabconspiracy theoryaquot tying president donald trump secretary state mike pompeo public statements hrefhttpswwwpoliticocomnews20210615wuhanlabtrumpofficialscovid494700promotinga lableak theory explanationp pspanquotthat episode reflect scientistsquot says sspancience writer matt ridley coauthor hrefhttpswwwamazoncomexecobidosasinb097clv3qpreasonmagazinea20new booka iviral search origin covid19ip pridley says white house covid19 adviser anthony faucis hrefhttpswwwdocumentcloudorgdocuments20793561leopoldnihfoiaanthonyfauciemailsemailsa public freedom information act request scenes scientists taking lableak theory seriously alongp pspanquota number leading virologists talking saying think look bit like virus thats engineered laboratoryquot says ridley referencing january 31 2020 email researcher kristian g andersen says quotone look closely sequences features potentially look engineeredquot fauci replies day later quotthanks kristian talk soon callquotspanp pspanquotand end phone rapid emvoltefaceem started writing articles immediatelyquot says ridley referring influential article andersen colleagues hrefhttpswwwnaturecomarticless4159102008209publisheda emnatureemon march 17 2020 stating quotour analyses clearly sarscov2 laboratory construct purposefully manipulated virusquot march 6 andersen emailed fauci tell paper accepted publication fauci replied quotnice job paperquotspanp pspanbut ridley says daszaks efforts obscure connections wuhan institute virology publishing attacks lableak hypothesis alarmingspanp pspanquotit raise concerns dr spanspandaszak needs answerquot says ridley quotive tried correspond numerous times ive responsei said rude blocked twitter cant answers himquotspanp pdaszak reply emreasonems interview requestp pridleys writing partner new book broad institute mit harvards alina chan earliest outspoken public skeptics naturalorigin hypothesis says colleagues published hrefhttpseuropepmcorgarticlepprppr157935preprint papera questioning consensus hadnt aware ilancet iletter organized daszak says believes couldve major chilling effect scientific discussion early daysp pspanquotthey saying saying virus didnt come nature conspiracy theoristquot says chan quotother people read letter thought im going neck come labquotspanp pchan molecular biologist argued paper sarscov2 adapted humans reason skeptical recently come animal recently come bats pangolins wouldve expected virus rapidly mutating early days pandemic better adapted human tissuep pchan partially credits insight experience severe acute respiratory syndrome sars outbreak 2003 lived singaporep pspanquotin situation outbreak virus rapidly picked dozens mutations early monthsquot says chan quotby comparison sarscov2 mutations suggested virus picked useful mutations infecting transmitting humans prior detection december 2019quotspanp panother major difference 2003 outbreak authorities hrefhttpswwwtheguardiancomworld2003may24chinasarsdiscovereda previous sars infections animals sold markets south china couple months thats case sarscov2 despite initial suspicions wet market blamep pspanquoteven class cases identified seafood market found signs animals infected virusquot says chan quotspanspanso today theres sign animal [in wuhan] infected sarscov2 gave humansquotspanp pwhen sent team investigate viruss origins january 2021 daszak american member included team dismissed lableak hypothesis leadership later backtrackedp pdaszak granted interview i60 minutesi following trip wuhan suggested farm animals likely culpritp pspanquotnow weve gotta farms investigate talk farmers talk relatives test spikes virus firstquot daszak toldspanispan 60 minutesspanispanbut farm animals identified hosts yetspanp ptheres detail emerged i60 minutesi report ridley like daszak explain recentlyleaked documents hrefhttpstheinterceptcom20211021virusmerswuhanexperimentsshowa ecohealth alliance applied research grant related inserting whats called furin cleavage site sarslike coronaviruses furin cleavage site makes sarscov2 hrefhttpspubmedncbinlmnihgov32869021so infectiousa distinguishes sarslike coronaviruses found wild grant request rejected wuhan laboratory engage research funding grant daszak able help answer questionp pspanquotthe fact probably feature makes virus sufficiently infectious start pandemic means highly important thingquot says ridley quotso think scientist knew grant application 2018 furin cleavage sites sarslike viruseswould volunteer information early pandemicquotspanp pridley chan find suspicious chinas premier bat coronavirus expertand daszaks collaborator wuhanpublished complete analysis sarscov2 genome neglected mention highly unusual furin cleavage sitep pafter em60 minutesem interview leaked hrefhttpstheinterceptcom20211021virusmerswuhanexperimentsdocumentsa showed ecohealth alliance worked wuhan institute virology batborne sarslike coronavirusesand middle east respiratory syndrome mersmore infectious human cellsp pchan ridley started writing book didnt strong view theory correct recent revelations shifted thinking favor lableak theoryp pquotin light grant proposals reports released past 2 monthsquot hrefhttpstwittercomayjchanstatus1452634561767165962s20chan wrote twittera quotwe know novel sarslike viruses synthesized engineered unprecedented scalequotp pspanquotthat changed mind completely knowing actually plan pipeline protocol work 2018 genetic engineering tablequot says chan quotif came lab [the likelihood is] close 5050 chance [genetic engineering] happenedquotspanp pthis question center hrefhttpswwwyoutubecomwatchvpnb2yxri6eyheated exchangea fauci sen rand paul rky possible national institutes health nih funding socalled gain function research involves purposely making virus infectious humansp pbut blame devastating scope pandemic says ridley rests chinese authorities punished whistleblowers like ophthalmologist hrefhttpseditioncnncom20200208opinionscoronavirusbociurkiwindexhtmlli wenlianga tried word emergence new sarslike virus colleagues government successfully kept humantohuman transmission disease wraps weeks maybe longerp pspanquotcommunist regimes tend secretivequot says ridley quotthere tends assumption dont talk things youre allowed way [chinese president] xi jinping dictatorial authoritarian ruler immediate predecessors 2019 case scientists laboratories doctors hospitals orders communicate thestrongstrongoutside world things regime want tospanspandid play epidemic escaping getting rest world turning pandemic bet didquot spanp pthe wuhan institute virology houses samples ratg13 bat virus closest known genetic matches sarscov2 day information coronaviruses wuhan lab hasnt released dont know lab working virus thats closely related sarscov2p pthe labs public database viral samples hold answers taken offline february modified december know work dedicated research scientific team investigating covid19 hrefhttpsdrasticsciencecomdrastica decentralized group volunteers compile analyze opensource material leaked documents investigate origins covid19p pspanquotonce realized [the lableak hypothesis] discredited evidence couldnt stay silentquot says spanyuri deigin biotech entrepreneur founding members drasticp pa key revelation uncovered group wuhan institute virology database taken september 2019 months pandemic publicly known description database modified december 30 2019 day shi zhenglitold chinese state television lab obtained samples virus wuhanp pwuhan scientists accessed database times permanently removed february 2020 alleged quotsecurity concernsquotp pquotfor suspicious course shis explanation took prevent hackers attacking complete bullshit public database begin withquot says deiginp pa member drastic team discovered wuhan team collected key samplesincluding viruss closest known genetic matchesfrom workers fallen sick died clearing bat droppings chinese authorities denied outsiders access examine minep pthough theres mounting circumstantial evidence support lableak theory government officials maintain naturalorigin hypothesis likely intelligence hrefhttpswwwdnigovfilesodnidocumentsassessmentsdeclassifiedassessmentoncovid19originspdfreporta declassified october 29 2020 said intel agencies low confidence virus likely emerged nature agency moderate confidence leaked lab analysts agencies remained quotunable coalesce explanation additional informationquot report conclude sarscov2 unlikely biological weaponp pnih director francis collins didnt reply emreasonems interview request hrefhttpswwwyoutubecomwatchvmrzesjshketolda computer scientist podcast host lex fridman early november hes open lableak hypothesis believes strongly virus natural originp pbetween july 2020 january 2021 international team scientists hrefhttpswwwdigitaljournalcomtechsciencevirusesfoundinlaosbatsareclosestknownrelativestosarscov2articlecaptureda bats laos carrying newly discovered coronavirus thats closest known genetic match sarscov2even closer virus held wuhan lab supports naturalorigin theory ridley chan deigin point lacks crucial furin cleavage site suspect scientists inserted labp psupporters naturalorigin theory point quotsmoking gunquot virus found version wuhan database uncovered drastic chan points version database years date wuhan researchers generally dont enter new viruses theyve chance sequence publish studies themp pspanquotso barely concept viruses sequences found 2016 years leading covid19quot says chan quotso access informationitbecomes difficult guess finally found precursor sarscov2 labs working itquotspanp pridley says doesnt want fear biotechnology credits alleviating human suffering hamper scientific progress happened wuhan thinks scientists convene international forum set stricter ethical guidelines prohibiting dangerous types research harvesting bat viruses faraway caves bringing large urban centers run experiments infectious human cells chinaproduced hrefhttpswwwyoutubecomwatchv_txymxl9nj0documentarya released december 2019 showcases researchers work proper protective gearp pspanquotgoing harvesting viruses wild places pandemic potential bringing cities work probably isnt sensiblequot says ridley quotispanspanf uk australia japan major countries sign treaty saying theres outbreak country promise open far possible tell know fact countries wont sign treaty pressure themquotspanp pspanhe points emergence international atomic energy agency model nations follow terms preventing future lab leaks potentially pandemiccausing pathogensspanp pand ridley says despite months obfuscation chinese authorities virologists media outlets hes optimistic truth emerge timep pquotit long timequot says ridley quotthe fall soviet union lead significant revelations biological accidents therei think change regime beijing find think people know happened happened happened marketthere plenty people late weve lost chance find im yetquotp pemspanproduced zach weissmueller graphic intro timeline graphics tomasz kaye additional graphics calvin transpanemp pemspanimages spanspanhe huan xinhua news agencynewscom yin gang xinhua news agencynewscom imagine chinanewscom kyodonewscom hitoshi katanodapolarisnewscom dickson leescmpnewscom design cellsscience photo librarynewscom wang bingyueyepress eyepressnewscom eyepress eyepressnewscom edwin remsberg vwpicsnewscom shepherd zhoufeaturechinanewscom xie huanchi xinhua news agencynewscom li xueren xinhua news agencynewscom wang ye xinhua news agencynewscom imagine chinanewscom chine nouvellesipanewscom chine nouvellesipanewscom chine nouvellesipanewscom shi zhifeaturechinanewscom xiao yijiu xinhua news agencynewscom christophe gateaudpapicturealliancenewscom yin gang xinhua news agencynewscom andre malerbazumapressnewscom u peng xinhua news agencynewscomspanemp pthe post relnofollow hrefhttpsreasoncomvideo20211118wasitalableakthemysteriousoriginofcovid19was lab leak mysterious origin covid19a appeared relnofollow hrefhttpsreasoncomreasoncomap |
6196d56d0dd8811afaad051a | Boris Johnson has been a disastrous prime minister – but the Conservatives will stick with him | pat some point in late 2016 or early 2017 a cabinet meeting was about to conclude when the foreign secretary made a contribution i really think we need to do more to reduce the regulatory burdens facing businesses said boris johnson i have recently been to new york and they have introduced a onein oneout system so that every time a new regulation is implemented another regulation is dropped i think we should introduce something like that herep
pthere was an awkward silence before an incredulous theresa may responded we do have something like that here boris said the prime minister and we have had it in place for years except we have a onein twoout policyp
pthe cabinet suppressed their sniggers or at least some of my colleagues did while johnson blustered er um well its not very well publicisedp
pi was reminded of this incident when dominic cummings a hrefhttpsdominiccummingssubstackcompriskaggressionbrexitandarticlewrote last weeka that johnson had not appreciated the consequences of leaving the eus customs union until the autumn of 2020 perhaps this allegation is the consequence of cummingss bitterness it appears not the emfinancial times empeter foster not a journalist who could be described as being close to cummings a hrefhttpstwittercompmdfosterstatus1459208337434812420s20reported backa that he had spoken to others present who confirmed the account p
pit turns out that despite all the claims that the voters knew exactly what they were voting for in 2016 or for that matter 2019 even their frontman did not know what he was voting forp
pin his a hrefhttpswwwamazoncoukchiefstaffnotesdowningstreetebookdpb08zxllbmfrefsr_1_1adgrpid1174279333433394hvadid73392660260570hvbmtbehvdevchvlocphy41277hvnetwohvqmtehvtargidkwd733926121092343aloc188hydadcr24435_1846623keywordsgavinbarwellchiefofstaffqid1637173342qsid25946640064029217sr81sres18389541202c09968679022c150988968x2c15293420582c18389524112c17859004712c15293793852c14711546882c08041382652c178590650x2c1633443582srptabis_bookexcellent accounta of his time as chief of staff to may gavin barwell tells how the government wrestled with the challenge of the northern irish border if our customs and regulatory regimes were going to diverge from the eu we had to put a border somewhere david davis disliked the implications of the situation but at least he tried to wrestle with the issue as brexit secretary in contrast from johnson there was a refusal to grapple with the policy detail as he simply refused to acknowledge the problemp
psome years later after johnson won the conservative leadership concluded a withdrawal agreement and northern ireland protocol won a parliamentary majority negotiated the trade and cooperation agreement and now a hrefhttpswwwnewstatesmancomcomment202110theukspositiononthenorthernirelandprotocolisabsurdandrecklessponders triggering article 16 of the protocola he still seems to follow the same approach p
pjohnsons lack of understanding of policy details is extraordinary for someone who has risen so high he is an intelligent man and his incomprehension of what in westminster and whitehall is fairly basic general knowledge must only be because they hold little interest for himp
pit is one of many weaknesses as prime minister and why when he is going through a rocky spell as he has been since a hrefhttpswwwnewstatesmancompoliticsconservatives202111toriesfearthecorruptionscandalhascutthroughtovotersitsworsethantheythinkhe colossally misjudgeda the owen paterson case there is an immediate sense that his end is nigh on this point i am not so surep
pit is true to say that johnsons relationship with the parliamentary conservative party is essentially transactional he was not chosen to lead the party because mps thought he would be a good prime minister but that he would win a general election and on that point they were rightp
pif johnson were to become ana hrefhttpswwwnewstatesmancompoliticsukpolitics202111borisjohnsonsleadershipsteeredthetoriestopowerbutitwillalsobetheirundoing electoral liabilitya he would not find protection from ideological soulmates or close friends he has neither ideology nor many close friends in parliament this makes him it is argued unusually vulnerable for a prime minister who won a hefty majority at his first attemptp
pthere is certainly disgruntlement over the handling of the paterson affair with both the 2019 intake and the old guard aggrieved for different reasons much of the recent intakes anger is apparently directed at paterson and his friends rather than the prime minister who they see as something of the antidote to the old guard he is fortunate that they have reached this conclusion but he was always likely to get the benefit of the doubt from those who consider that they owe their seats to himp
pthe coalition that the conservatives captured in 2019 was an unusual one and it is not obvious that someone else would be able to replicate johnsons achievement he a hrefhttpswwwnewstatesmancompoliticspolling202111labournowleadsthetoriesinmostpollsbutitshouldavoidcelebrationmay not be as popular in the pollsa but he has an appeal to those who only focus on politics from timetotime and make up the swing voters in the new swing seats removing him comes with risksp
phe has been dented by the last two weeks i am told that some letters have trickled in to the chair of the 1922 committee and fledgling leadership campaigns are being formed but the chances of johnson falling this side of a general election look slimp
pit is always possible that a scandal may engulf him cummings still argues that a hrefhttpswwwnewstatesmancompoliticsthestaggers202104borisjohnsons200krefurbishment11downingstreetcouldbuyyouwholehousemuchwallpapergatea is a danger and it has been observed that since he was at school a hrefhttpswwwtheguardiancompolitics2019jun22borisjohnsonbythosewhoknowhimjohnson has considered himself freea of the network of obligation which binds everyone else rules may have been abused one way or another in a manner that causes him real problems p
pthe likelihood however is that for all his misjudgements scandals and failure to grasp basic details not to mention his indecisiveness poor parliamentary performances and lack of vision for what to do with his majority the conservative party will stick with him for now and that tells us more about the conservative party than it does about boris johnsonp | pat point late 2016 early 2017 cabinet meeting conclude foreign secretary contribution think need reduce regulatory burdens facing businesses said boris johnson recently new york introduced onein oneout system time new regulation implemented regulation dropped think introduce like herep pthere awkward silence incredulous theresa responded like boris said prime minister place years onein twoout policyp pthe cabinet suppressed sniggers colleagues johnson blustered er um publicisedp pi reminded incident dominic cummings hrefhttpsdominiccummingssubstackcompriskaggressionbrexitandarticlewrote weeka johnson appreciated consequences leaving eus customs union autumn 2020 allegation consequence cummingss bitterness appears emfinancial times empeter foster journalist described close cummings hrefhttpstwittercompmdfosterstatus1459208337434812420s20reported backa spoken present confirmed accountp pit turns despite claims voters knew exactly voting 2016 matter 2019 frontman know voting forp pin hrefhttpswwwamazoncoukchiefstaffnotesdowningstreetebookdpb08zxllbmfrefsr_1_1adgrpid1174279333433394hvadid73392660260570hvbmtbehvdevchvlocphy41277hvnetwohvqmtehvtargidkwd733926121092343aloc188hydadcr24435_1846623keywordsgavinbarwellchiefofstaffqid1637173342qsid25946640064029217sr81sres18389541202c09968679022c150988968x2c15293420582c18389524112c17859004712c15293793852c14711546882c08041382652c178590650x2c1633443582srptabis_bookexcellent accounta time chief staff gavin barwell tells government wrestled challenge northern irish border customs regulatory regimes going diverge eu border david davis disliked implications situation tried wrestle issue brexit secretary contrast johnson refusal grapple policy detail simply refused acknowledge problemp psome years later johnson won conservative leadership concluded withdrawal agreement northern ireland protocol won parliamentary majority negotiated trade cooperation agreement hrefhttpswwwnewstatesmancomcomment202110theukspositiononthenorthernirelandprotocolisabsurdandrecklessponders triggering article 16 protocola follow approachp pjohnsons lack understanding policy details extraordinary risen high intelligent man incomprehension westminster whitehall fairly basic general knowledge hold little interest himp pit weaknesses prime minister going rocky spell hrefhttpswwwnewstatesmancompoliticsconservatives202111toriesfearthecorruptionscandalhascutthroughtovotersitsworsethantheythinkhe colossally misjudgeda owen paterson case immediate sense end nigh point surep pit true johnsons relationship parliamentary conservative party essentially transactional chosen lead party mps thought good prime minister win general election point rightp pif johnson ana hrefhttpswwwnewstatesmancompoliticsukpolitics202111borisjohnsonsleadershipsteeredthetoriestopowerbutitwillalsobetheirundoing electoral liabilitya find protection ideological soulmates close friends ideology close friends parliament makes argued unusually vulnerable prime minister won hefty majority attemptp pthere certainly disgruntlement handling paterson affair 2019 intake old guard aggrieved different reasons recent intakes anger apparently directed paterson friends prime minister antidote old guard fortunate reached conclusion likely benefit doubt consider owe seats himp pthe coalition conservatives captured 2019 unusual obvious able replicate johnsons achievement hrefhttpswwwnewstatesmancompoliticspolling202111labournowleadsthetoriesinmostpollsbutitshouldavoidcelebrationmay popular pollsa appeal focus politics timetotime swing voters new swing seats removing comes risksp phe dented weeks told letters trickled chair 1922 committee fledgling leadership campaigns formed chances johnson falling general election look slimp pit possible scandal engulf cummings argues hrefhttpswwwnewstatesmancompoliticsthestaggers202104borisjohnsons200krefurbishment11downingstreetcouldbuyyouwholehousemuchwallpapergatea danger observed school hrefhttpswwwtheguardiancompolitics2019jun22borisjohnsonbythosewhoknowhimjohnson considered freea network ofobligationwhich binds rules abused way manner causes real problemsp pthe likelihood misjudgements scandals failure grasp basic details mention indecisiveness poor parliamentary performances lack vision majority conservative party stick tells conservative party boris johnsonp |
6196d62a0dd8811afaad0528 | Why Many Americans Underestimate Who Is Most Concerned About The Environment | p dataparagraphmainlawmakers in washington have spent months now negotiating legislation to address climate change and other environmental issues and it is still a relnoopener hrefhttpswwwvoxcom202111522766086infrastructurebidenhousedemocratsvotepassbbbspendingbill target_blanknot clear what they will end up doinga or a relnoopener hrefhttpswwwtheatlanticcomsciencearchive202110whatsactuallyjoebidensnewclimateproposal620543 target_blankwhether those actions will be enougha given the significant environmental damage that has already been done meanwhile just this year americans have experienced a series of extreme weather events that a relnoopener hrefhttpswwwsciencedirectcomsciencearticlepiis2214629621001997 target_blankleft millions in the colda a relnoopener hrefhttpsapnewscomarticlehurricaneidaenvironmentandnaturelouisianastormshurricanes9f305dd811e9d8fea248b5e514c9aaf1 target_blankdestroyed their homes and battered their communitiesa and a relnoopener hrefhttpswwwfirecagovincidents target_blankburned millions of acres of land around thema p
p dataparagraphmainbut this is not an article about washingtons inaction polar vortexes hurricanes wildfires or any other particular environmental issue instead it is an article about the empeopleem who are affected by these issues and the perceptions and misperceptions americans have about those peoplep
p dataparagraphmainpdivhrspanspandiv
p dataparagraphmainearlier this year i a relnoopener hrefhttpsfivethirtyeightcomfeatureswhymanyamericansdontseetheracialwealthgap target_blankwrote abouta how the structure of american society makes it difficult for many people to understand the racial wealth gap that still exists between white and black america many of those same social structures also matter for how americans experience and perceive environmental issuesp
p dataparagraphmainlets start by how we as a country experience environmental issues p
p dataparagraphmaindecades of research has found that the a relnoopener hrefhttpswwwannualreviewsorgdoiabs101146annurevenviron082508094348 target_blankrisk of exposure to environmental hazards is unequally distributeda by race and class in the united states that is racial and ethnic minorities and lowincome americans are more likely to live in what environmental sociologist dorceta taylor calls a relnoopener hrefhttpsnyupressorg9781479861781toxiccommunities target_blanktoxic communitiesa places with higher levels of pollution more hazardous waste sites and toxic facilities and as a result they are more likely to experience a relnoopener hrefhttpsprojectspropublicaorgtoxmap target_blankworse health and wellbeing outcomesa than their white and more affluent peersp
p dataparagraphmainthese differences in exposure to risk are not accidental either p
p dataparagraphmainnumerous scholars from both inside and outside of academia have studied how policy decisions over the previous several decades created these conditions in one early study conducted in the 1980s for instance the us government accountability officea datafootnotecontentltpgtltpgtthen known as the general accounting officeltpgt
ltpgt hrefhttpsfivethirtyeightcomfeatureswhymanyamericansunderestimatewhoismostconcernedabouttheenvironmentfn19 datafootnoteid19sup19supa found that a relnoopener hrefhttpswwwgaogovproductsrced83168 target_blanka disproportionate number of waste sitesa were placed in african american communities in the south a few years later a relnoopener hrefhttpswwwnrcgovdocsml1310ml13109a339pdf target_blankanother studya built on the gao results and found that the percentage of racial and ethnic minorities in a community was a large predictor of where commercial hazardous waste facilities were placed around the country p
p dataparagraphmainby the early 1990s those initial studies garnered enough attention that the environmental protection agency a relnoopener hrefhttpswwwepagovsitesdefaultfiles201502documentsreducing_risk_com_vol1pdf target_blankbegan tracking disparitiesa using metrics such as lead exposure and air pollution exposure whether we look at individual studies or at a relnoopener hrefhttpswwwpsychologicalscienceorgobserverintroductiontometaanalysisaguideforthenovice target_blankmetaanalysesa of multiple studies the research suggests that environmental disparities are a relnoopener hrefhttpswwwtaylorfranciscomchaptersedit104324978042930366113environmentalracismreviewingevidencepaulmohaibunyanbryant target_blankbased on racism income inequality or some combination of botha p
div
p
a hrefhttpsfivethirtyeightcomfeatureshowyouviewclimatechangemightdependonwhereyouliveimg sizesminwidth 440px 153px 100vw alta stylized illustration of a profile view open head with a planet globe above it width153 datasrcsethttpsfivethirtyeightcomwpcontentuploads202110americansonclimate4x31pngw153ampquality100ampstripall 153w httpsfivethirtyeightcomwpcontentuploads202110americansonclimate4x31pngw306ampquality100ampstripall 306w httpsfivethirtyeightcomwpcontentuploads202110americansonclimate4x31pngw405ampquality100ampstripall 405w httpsfivethirtyeightcomwpcontentuploads202110americansonclimate4x31pngw810ampquality100ampstripall 810w srcsethttpsfivethirtyeightcomwpcontentuploads202110americansonclimate4x31pngw153ampquality100ampstripall 153w httpsfivethirtyeightcomwpcontentuploads202110americansonclimate4x31pngw306ampquality100ampstripall 306w httpsfivethirtyeightcomwpcontentuploads202110americansonclimate4x31pngw405ampquality100ampstripall 405w httpsfivethirtyeightcomwpcontentuploads202110americansonclimate4x31pngw810ampquality100ampstripall 810w datasizesminwidth 440px 153px 100vw height115a
p
p
strongrelatedstrong
how you view climate change might depend on where you live a hrefhttpsfivethirtyeightcomfeatureshowyouviewclimatechangemightdependonwhereyouliveread more a
p
div
p dataparagraphmainbut it is not just our experiences with environmental issues that differ by race or socioeconomic status how different groups of americans emperceiveem environmental issues also differs by race and class p
p dataparagraphmainfor instance a relnoopener hrefhttpswwwsciencedirectcomsciencearticleabspiis0272494419304220 target_blankin research that my colleagues and i conducteda we found that while participants largely agreed that ecooriented issues like climate change and drought counted as environmental issues they differed on whether more humanoriented issues like poverty and racism counted as environmental issues with nonwhite and lowerincome participants far more likely to rate those issues as environmental than their white and wealthier counterparts this reflects how it is often easier for members of groups who regularly experience these risks to make these connections than it is for members of other groups who do not regularly experience poverty racism or environmental risksp
p dataparagraphmainif you live in a poor predominantly minorityserving neighborhood you may notice that not only are there issues with the a relnoopener hrefhttpswwwcensusgovcontentdamcensuslibraryworkingpapers2017adrmcarrawp201705pdf target_blankair qualitya and a relnoopener hrefhttpswwwnrdcorgresourceswatereddownjustice target_blankwater qualitya but also there is a relnoopener hrefhttpswwwncbinlmnihgovpmcarticlespmc3590901 target_blanknot as much green spacea to get regular exercise you may also notice that the people around you a relnoopener hrefhttpsajphaphapublicationsorgdoipdf102105ajph875730 target_blanksuffer from more health conditionsa and seeing these things may lead you to conclude that they are all related part of a larger interconnected set of problems on the other hand if you live in a rich white neighborhood a relnoopener hrefhttpswwwsciencedirectcomsciencearticlepiis2352154621000486via3dihub target_blankyou may not seea many if any of these problems and thus you would not know that they are related p
p dataparagraphmainin fact if you find yourself in that latter group environmental issues may be more of an abstract political issue for you indeed a a relnoopener hrefhttpswwwsciencedirectcomsciencearticlepiis027249442100133xcasa_tokenfe6v7o3ozueaaaaaviamurqjvwct2anduqwbjmjnio787uggymqrlvovdhux414lgnahvtvpvqkojmvu89xgbahwfig1 target_blankrecent papera examining how the american public has thought about climate change from 2008 through 2019 found that white people were far more likely than people of color to be politically polarized on climate change for many white americans these issues were largely seen as political but for americans of color they were viewed as issues of survival with people of color far more likely to say that global warming poses a danger to them p
p dataparagraphmainthat lowincome people and people of color are more concerned than white people about environmental issues is important because it points to a glaring disconnect in what most americans think p
p dataparagraphmainin 2018 a team of environmental social scientists a relnoopener hrefhttpswwwpnasorgcontent1154912429 target_blankran a studya in which they asked americans how concerned they thought a variety of groups were about environmental issues in addition to how concerned they were individually and they found that while most people thought white people young people and women were the most concerned about the environment it was actually people of color and poor people who reported the highest levels of environmental concernp
figure classwpblockimageimg datasrchttpsfivethirtyeightcomwpcontentuploads202111lewisclimateinequality11181png srchttpsfivethirtyeightcomwpcontentuploads202111lewisclimateinequality11181png width1150 alt datasrcsethttpsfivethirtyeightcomwpcontentuploads202111lewisclimateinequality11181pngw700 1x httpsfivethirtyeightcomwpcontentuploads202111lewisclimateinequality11181pngw1400 2x srcsethttpsfivethirtyeightcomwpcontentuploads202111lewisclimateinequality11181pngw700 1x httpsfivethirtyeightcomwpcontentuploads202111lewisclimateinequality11181pngw1400 2x classwpimage320991 height1704figurep dataparagraphmainbecause black and hispanic americans are disproportionately exposed to environmental risks and a relnoopener hrefhttpswwwannualreviewsorgdoi101146annurevsoc073117041222 target_blankbear the brunt of those risksa it makes sense that they would be more concerned the striking part is that people starkly misperceive and specifically underestimate the environmental concerns of lowincome black hispanic and asian americans why p
p dataparagraphmainin part it is related to the larger structural issues i mentioned before and to how we a relnoopener hrefhttpswwwtandfonlinecomdoiabs1010801047840x20211971441journalcodehpli20 target_blankmake sense of the world around usa our position in society either leads us to easily see some issues like environmental injustices or it makes those issues much harder to see in my a relnoopener hrefhttpsfivethirtyeightcomfeatureswhymanyamericansdontseetheracialwealthgap target_blankprevious articlea i also discussed how the segregated and stratified nature of american society affects things like a relnoopener hrefhttpswwwannualreviewsorgdoiabs101146annurevsoc073018022707journalcodesoc target_blankwho were friends witha which also affects what we learn about but there are other factors at play here p
p dataparagraphmainone factor is the media we consume a relnoopener hrefhttpsknightfoundationorgarticlestheracialdivideonnewscoverageandwhyrepresentationmatters target_blanknews coverage is also divided along racial linesa and that in turn affects the stories that get told many editors and producers at mainstream media outlets have white audiences in mind which a relnoopener hrefhttpsprospectorgcultureijustdonthearitvoicesofcolornprpublicradio target_blankshapes the storiesa they create and in the environmental realm there has been the a relnoopener hrefhttpswwwwuprorg20200123whitewashingintheclimatemovement target_blankwhitewashing of storiesa about climate and other environmental movements which contributes to a perception that it is primarily white people who are concerned about environmental issues the people who tend to get spotlighted in the environmental movement are also a relnoopener hrefhttpsimagessquarespacecdncomcontentv158e3dc309de4bbecc76c473314939103854924wwyiiu3vqvl4ejqygzlimageassetjpeg target_blankwealthy white peoplea because of that americans end up thinking those are the people who care most about the environmentp
p dataparagraphmainit is not just the media though that overlooks the contributions of people of color to environmental movements environmental organizations are also a relnoopener hrefhttpswwwnbcnewscomnewsusnewsnumbersdontliegreenmovementremainsoverwhelminglywhitereportn1253972 target_blankoverwhelmingly whitea this is true not only in governmental and nongovernmental environmental organizations but also in the environmental sciences which are a relnoopener hrefhttpswwwnaturecomarticlesnclimate2415 target_blankless diverse than many other scientific disciplinesap
p dataparagraphmainthis lack of diversity has real consequences too for instance research on a relnoopener hrefhttpswwwsciencedirectcomsciencearticleabspiis0959378017308671 target_blankgender in climate change policiesa has found that men were more likely to positively evaluate climate arguments that were about science and business than about ethics and environmental justice consider though that it was a failure of ethics and environmental justice that led to something like a relnoopener hrefhttpswwwnprorgsectionsthetwoway20160420465545378leadlacedwaterinflintastepbysteplookatthemakingsofacrisis target_blankthe flint water crisisa a decisionmaking process that at least one environmental scholar has described as a relnoopener hrefhttpsnewsumicheduflintwatercrisismostegregiousexampleofenvironmentalinjusticesaysumresearcher target_blankthe most egregious example of environmental injustice in recent us historyap
p dataparagraphmainits why the omission of people of color in conversations and research about the environment is such a problem when we make decisions about who gets to participate in environmental discussions who gets to participate in environmental research who gets to be featured in stories about environmental issues and who gets to work at environmental organizations we are implicitly making decisions about whose lives and futures matter and we have to remember that those decisions have important implications for what we learn about environmental issues and for the policies and practices that get developed as a result of that knowledgep
pwatch httpsabcnewsgocomthisweekvideobuyuspoliticalforcesalignedclimatechangesilver80888230p | p dataparagraphmainlawmakers washington spent months negotiating legislation address climate change environmental issues relnoopener hrefhttpswwwvoxcom202111522766086infrastructurebidenhousedemocratsvotepassbbbspendingbill target_blanknot clear end doinga relnoopener hrefhttpswwwtheatlanticcomsciencearchive202110whatsactuallyjoebidensnewclimateproposal620543 target_blankwhether actions enougha given significant environmental damage year americans experienced series extreme weather events relnoopener hrefhttpswwwsciencedirectcomsciencearticlepiis2214629621001997 target_blankleft millions colda relnoopener hrefhttpsapnewscomarticlehurricaneidaenvironmentandnaturelouisianastormshurricanes9f305dd811e9d8fea248b5e514c9aaf1 target_blankdestroyed homes battered communitiesa relnoopener hrefhttpswwwfirecagovincidents target_blankburned millions acres land thema p p dataparagraphmainbut article washingtons inaction polar vortexes hurricanes wildfires particular environmental issue instead article empeopleem affected issues perceptions misperceptions americans peoplep p dataparagraphmainpdivhrspanspandiv p dataparagraphmainearlier year relnoopener hrefhttpsfivethirtyeightcomfeatureswhymanyamericansdontseetheracialwealthgap target_blankwrote abouta structure american society makes difficult people understand racial wealth gap exists white black america social structures matter americans experience perceive environmental issuesp p dataparagraphmainlets start country experience environmental issuesp p dataparagraphmaindecades research found relnoopener hrefhttpswwwannualreviewsorgdoiabs101146annurevenviron082508094348 target_blankrisk exposure environmental hazards unequally distributeda race class united states racial ethnic minorities lowincome americans likely live environmental sociologist dorceta taylor calls relnoopener hrefhttpsnyupressorg9781479861781toxiccommunities target_blanktoxic communitiesa places higher levels pollution hazardous waste sites toxic facilities result likely experience relnoopener hrefhttpsprojectspropublicaorgtoxmap target_blankworse health wellbeing outcomesa white affluent peersp p dataparagraphmainthese differences exposure risk accidental eitherp p dataparagraphmainnumerous scholars inside outside academia studied policy decisions previous decades created conditions early study conducted 1980s instance government accountability officea datafootnotecontentltpgtltpgtthen known general accounting officeltpgt ltpgt hrefhttpsfivethirtyeightcomfeatureswhymanyamericansunderestimatewhoismostconcernedabouttheenvironmentfn19 datafootnoteid19sup19supa found relnoopener hrefhttpswwwgaogovproductsrced83168 target_blanka disproportionate number waste sitesa placed african american communities south years later relnoopener hrefhttpswwwnrcgovdocsml1310ml13109a339pdf target_blankanother studya built gao results found percentage racial ethnic minorities community large predictor commercial hazardous waste facilities placed country p p dataparagraphmainby early 1990s initial studies garnered attention environmental protection agency relnoopener hrefhttpswwwepagovsitesdefaultfiles201502documentsreducing_risk_com_vol1pdf target_blankbegan tracking disparitiesa metrics lead exposure air pollution exposure look individual studies relnoopener hrefhttpswwwpsychologicalscienceorgobserverintroductiontometaanalysisaguideforthenovice target_blankmetaanalysesa multiple studies research suggests environmental disparities relnoopener hrefhttpswwwtaylorfranciscomchaptersedit104324978042930366113environmentalracismreviewingevidencepaulmohaibunyanbryant target_blankbased racism income inequality combination botha p div p hrefhttpsfivethirtyeightcomfeatureshowyouviewclimatechangemightdependonwhereyouliveimg sizesminwidth 440px 153px 100vw alta stylized illustration profile view open head planet globe width153 datasrcsethttpsfivethirtyeightcomwpcontentuploads202110americansonclimate4x31pngw153ampquality100ampstripall 153w httpsfivethirtyeightcomwpcontentuploads202110americansonclimate4x31pngw306ampquality100ampstripall 306w httpsfivethirtyeightcomwpcontentuploads202110americansonclimate4x31pngw405ampquality100ampstripall 405w httpsfivethirtyeightcomwpcontentuploads202110americansonclimate4x31pngw810ampquality100ampstripall 810w srcsethttpsfivethirtyeightcomwpcontentuploads202110americansonclimate4x31pngw153ampquality100ampstripall 153w httpsfivethirtyeightcomwpcontentuploads202110americansonclimate4x31pngw306ampquality100ampstripall 306w httpsfivethirtyeightcomwpcontentuploads202110americansonclimate4x31pngw405ampquality100ampstripall 405w httpsfivethirtyeightcomwpcontentuploads202110americansonclimate4x31pngw810ampquality100ampstripall 810w datasizesminwidth 440px 153px 100vw height115a p p strongrelatedstrong view climate change depend live hrefhttpsfivethirtyeightcomfeatureshowyouviewclimatechangemightdependonwhereyouliveread p div p dataparagraphmainbut experiences environmental issues differ race socioeconomic status different groups americans emperceiveem environmental issues differs race classp p dataparagraphmainfor instance relnoopener hrefhttpswwwsciencedirectcomsciencearticleabspiis0272494419304220 target_blankin research colleagues conducteda found participants largely agreed ecooriented issues like climate change drought counted environmental issues differed humanoriented issues like poverty racism counted environmental issues nonwhite lowerincome participants far likely rate issues environmental white wealthier counterparts reflects easier members groups regularly experience risks connections members groups regularly experience poverty racism environmental risksp p dataparagraphmainif live poor predominantly minorityserving neighborhood notice issues relnoopener hrefhttpswwwcensusgovcontentdamcensuslibraryworkingpapers2017adrmcarrawp201705pdf target_blankair qualitya relnoopener hrefhttpswwwnrdcorgresourceswatereddownjustice target_blankwater qualitya relnoopener hrefhttpswwwncbinlmnihgovpmcarticlespmc3590901 target_blanknot green spacea regular exercise notice people relnoopener hrefhttpsajphaphapublicationsorgdoipdf102105ajph875730 target_blanksuffer health conditionsa seeing things lead conclude related larger interconnected set problems hand live rich white neighborhood relnoopener hrefhttpswwwsciencedirectcomsciencearticlepiis2352154621000486via3dihub target_blankyou seea problems know related p p dataparagraphmainin fact find group environmental issues abstract political issue relnoopener hrefhttpswwwsciencedirectcomsciencearticlepiis027249442100133xcasa_tokenfe6v7o3ozueaaaaaviamurqjvwct2anduqwbjmjnio787uggymqrlvovdhux414lgnahvtvpvqkojmvu89xgbahwfig1 target_blankrecent papera examining american public thought climate change 2008 2019 found white people far likely people color politically polarized climate change white americans issues largely seen political americans color viewed issues survival people color far likely global warming poses danger themp p dataparagraphmainthat lowincome people people color concerned white people environmental issues important points glaring disconnect americans think p p dataparagraphmainin 2018 team environmental social scientists relnoopener hrefhttpswwwpnasorgcontent1154912429 target_blankran studya asked americans concerned thought variety groups environmental issues addition concerned individually found people thought white people young people women concerned environment actually people color poor people reported highest levels environmental concernp figure classwpblockimageimg datasrchttpsfivethirtyeightcomwpcontentuploads202111lewisclimateinequality11181png srchttpsfivethirtyeightcomwpcontentuploads202111lewisclimateinequality11181png width1150 alt datasrcsethttpsfivethirtyeightcomwpcontentuploads202111lewisclimateinequality11181pngw700 1x httpsfivethirtyeightcomwpcontentuploads202111lewisclimateinequality11181pngw1400 2x srcsethttpsfivethirtyeightcomwpcontentuploads202111lewisclimateinequality11181pngw700 1x httpsfivethirtyeightcomwpcontentuploads202111lewisclimateinequality11181pngw1400 2x classwpimage320991 height1704figurep dataparagraphmainbecause black hispanic americans disproportionately exposed environmental risks relnoopener hrefhttpswwwannualreviewsorgdoi101146annurevsoc073117041222 target_blankbear brunt risksa makes sense concerned striking people starkly misperceive specifically underestimate environmental concerns lowincome black hispanic asian americans p p dataparagraphmainin related larger structural issues mentioned relnoopener hrefhttpswwwtandfonlinecomdoiabs1010801047840x20211971441journalcodehpli20 target_blankmake sense world usa position society leads easily issues like environmental injustices makes issues harder relnoopener hrefhttpsfivethirtyeightcomfeatureswhymanyamericansdontseetheracialwealthgap target_blankprevious articlea discussed segregated stratified nature american society affects things like relnoopener hrefhttpswwwannualreviewsorgdoiabs101146annurevsoc073018022707journalcodesoc target_blankwho friends witha affects learn factors play p p dataparagraphmainone factor media consume relnoopener hrefhttpsknightfoundationorgarticlestheracialdivideonnewscoverageandwhyrepresentationmatters target_blanknews coverage divided racial linesa turn affects stories told editors producers mainstream media outlets white audiences mind relnoopener hrefhttpsprospectorgcultureijustdonthearitvoicesofcolornprpublicradio target_blankshapes storiesa create environmental realm relnoopener hrefhttpswwwwuprorg20200123whitewashingintheclimatemovement target_blankwhitewashing storiesa climate environmental movements contributes perception primarily white people concerned environmental issues people tend spotlighted environmental movement relnoopener hrefhttpsimagessquarespacecdncomcontentv158e3dc309de4bbecc76c473314939103854924wwyiiu3vqvl4ejqygzlimageassetjpeg target_blankwealthy white peoplea americans end thinking people care environmentp p dataparagraphmainit media overlooks contributions people color environmental movements environmental organizations relnoopener hrefhttpswwwnbcnewscomnewsusnewsnumbersdontliegreenmovementremainsoverwhelminglywhitereportn1253972 target_blankoverwhelmingly whitea true governmental nongovernmental environmental organizations environmental sciences relnoopener hrefhttpswwwnaturecomarticlesnclimate2415 target_blankless diverse scientific disciplinesap p dataparagraphmainthis lack diversity real consequences instance research relnoopener hrefhttpswwwsciencedirectcomsciencearticleabspiis0959378017308671 target_blankgender climate change policiesa found men likely positively evaluate climate arguments science business ethics environmental justice consider failure ethics environmental justice led like relnoopener hrefhttpswwwnprorgsectionsthetwoway20160420465545378leadlacedwaterinflintastepbysteplookatthemakingsofacrisis target_blankthe flint water crisisa decisionmaking process environmental scholar described relnoopener hrefhttpsnewsumicheduflintwatercrisismostegregiousexampleofenvironmentalinjusticesaysumresearcher target_blankthe egregious example environmental injustice recent historyap p dataparagraphmainits omission people color conversations research environment problem decisions gets participate environmental discussions gets participate environmental research gets featured stories environmental issues gets work environmental organizations implicitly making decisions lives futures matter remember decisions important implications learn environmental issues policies practices developed result knowledgep pwatch httpsabcnewsgocomthisweekvideobuyuspoliticalforcesalignedclimatechangesilver80888230p |
6196d6670dd8811afaad052c | Why did southern Italy lag behind? | pive long been suspicious of the deep deep roots theory of southern italian stagnation given the neapolitan enlightenment in the 18th century this explanation however at least in principle makes more sense to mep
blockquotepthe provincial gap in human capital at the time of italys unification is a plausible explanation for the northsouth divide of the following decades we show that the roots of the literacy gap that existed in 1861 can be traced back to napoleonic educational reforms enacted between 1801 and 1814 we use exogenous variation in provincial distance to paris to quantify effects linking the duration of napoleonic control to human capital if the south had experienced the same napoleonic impact as the north southern literacy rates would have been up to 70 percent higher than they were in 1861pblockquote
pthat is a relnoopener hrefhttpsacademicoupcomereharticleabstract2547575940438 target_blankfrom m postigliola and m rota in european review of economic historya might napoleon be underratedp
pthe post a relnofollow hrefhttpmarginalrevolutioncommarginalrevolution202111whydidsouthernitalylagbehindhtmlwhy did southern italy lag behinda appeared first on a relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap | pive long suspicious deep deep roots theory southern italian stagnation given neapolitan enlightenment 18th century explanation principle makes sense mep blockquotepthe provincial gap human capital time italys unification plausible explanation northsouth divide following decades roots literacy gap existed 1861 traced napoleonic educational reforms enacted 1801 1814 use exogenous variation provincial distance paris quantify effects linking duration napoleonic control human capital south experienced napoleonic impact north southern literacy rates 70 percent higher 1861pblockquote pthat relnoopener hrefhttpsacademicoupcomereharticleabstract2547575940438 target_blankfrom m postigliola m rota european review economic historya napoleon underratedp pthe post relnofollow hrefhttpmarginalrevolutioncommarginalrevolution202111whydidsouthernitalylagbehindhtmlwhy southern italy lag behinda appeared relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap |
6196d67a0dd8811afaad0530 | Where to put your nuclear arsenal | blockquotepive been thinking about the article on mad you linked to haller amp frys a relnoopener hrefhttpswwwrealcleardefensecomarticles20211108the_math_is_bad_for_mad_802552html target_blankthe math is bada their point that you have to run the game theory for the case where a surprise first launch has already occurred is interestingp
pi agree mad looks bad in that scenario but i think the authors misunderstand why and therefore their proposed solution harden amp build more capability wont workp
pfrom a mad point of view its incredibly stupid to put all your minuteman missiles in a vast empty area no one cares about obviously the better placement would be to intermix the missiles with major urban centersp
ptheres a reason the minutemen arent scattered about new york chicago los angeles houston et all and its not because our 1950s leaders were stupid its because were the good guys or at least we were and the good guys are inherently at a disadvantage when it comes to fightingp
pit is at least possible to imagine a us president facing either confirmed missiles in the air or the immediate aftermath of a successful first strike on the minutemen might ask themself at least for a moment what would be best for my grandchildren humanity rather than resignedly push the red button whilst saying even though this wont help anything mad requires i now launch more missilesp
pfrom that perspective it really doesnt matter how formidable our secondstrike capacity is our enemies will always question our willingness to launch a return strike on no doubt much messier targets indeed during the cold war even the allegedly inhuman soviets worried about the human element creating and possibly even implementing the famous doomsday machine referenced in dr strangelove in an attempt to prevent some wishywashy comrade from choosing in the heat of the moment to avoid exterminating all life on the planetp
pthat doesnt mean mad is invalid howeverp
pthere is another important component to the deterrent that haller and fry dont consider it may be that use of nuclear weapons even with no return strike is still not a survivable event even if falloutnuclear winter effects prove mild a first strike on even the smallest scale would upend the world there is no leadership in any nation save possibly north korea that could reasonably expect to survive the consequent metaphorical falloutp
pthis was put a little more pithily in the 1995 film crimson tide when denzel washington says to gene hackman in the nuclear world the true enemy is war itselfpblockquote
pthat is from a relnoopener hrefhttpandylewicky target_blankandy lewickyap
pthe post a relnofollow hrefhttpmarginalrevolutioncommarginalrevolution202111wheretoputyournucleararsenalhtmlwhere to put your nuclear arsenala appeared first on a relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap | blockquotepive thinking article mad linked haller amp frys relnoopener hrefhttpswwwrealcleardefensecomarticles20211108the_math_is_bad_for_mad_802552html target_blankthe math bada point run game theory case surprisefirst launch occurred interestingp pi agree mad looks bad scenario think authors misunderstand proposed solution harden amp build capability wont workp pfrom mad point view incredibly stupid minuteman missiles vast area cares obviously better placement intermix missiles major urban centersp ptheres reason minutemen arent scattered new york chicago los angeles houston et 1950s leaders stupid good guys good guys inherently disadvantage comes fightingp pit possible imagine president facing confirmedmissiles air immediate aftermath successful strike minutemen ask themself moment best grandchildren humanity resignedly push red button whilst saying wont help mad requires launch missilesp pfrom perspective doesnt matter formidable secondstrike capacity enemies question willingness launch return strike doubt messier targets cold war allegedly inhuman soviets worried human element creating possibly implementing famous doomsday machine referenced dr strangelove attempt prevent wishywashy comrade choosing heat moment avoid exterminating life planetp pthat doesnt mean mad invalid howeverp pthere important component deterrent haller fry dont consider use nuclear weapons return strike survivable event falloutnuclear winter effects prove mild strike smallest scale upend world leadership nation save possibly north korea reasonably expect survive consequent metaphorical falloutp pthis little pithily 1995 film crimson tide denzel washington says togene hackman nuclear world true enemy war itselfpblockquote pthat relnoopener hrefhttpandylewicky target_blankandy lewickyap pthe post relnofollow hrefhttpmarginalrevolutioncommarginalrevolution202111wheretoputyournucleararsenalhtmlwhere nuclear arsenala appeared relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap |
6196d6880dd8811afaad0534 | Can the University of Austin spark a new Enlightenment? | pthe university of austin americas newest university was launched this month i am one of five founders because i am convinced that higher education is at considerable risk a new ideology sometimes called social justice and revealed in numerous ways but most succinctly called woke is taking a huge toll on the free exchange of ideasp
psafe spaces and trigger warnings are demanded by students and many faculty as well rather than recognizing that challenge risk and discomfort create strength of will and wisdom instead of being the adults in the room scared and hapless administrators capitulate to their demandsp
pwe are told that borrowing from other cultures is inherently predatory cultural appropriation rather than being one of the most ancient ways that humans have expanded our repertoire making connections between both people and ideas we are asked to believe anew in original sin this one based on skin color faculty and students who step outside of the new orthodoxy risk being ridiculed shouted at even chased off campus tenure means nothing when a mob is at the door the very concepts of objective reality and merit are taken to be offensive at best outdated and untrue at worstp
pthese are instantiations of a selflimiting ideology that mocks the very premises of americas founding documents and of the mottos of many established universities as well harvard proclaims emveritasem yale adds emluxem to the mix but there is little truth in the woke ideology and little lightp
pthese manifestations of the new ideology are a caricature of deep thought from the naivete of the beliefs to the insistence that they not be questioned but there are forces older and yet more influential in play which for decades have bent research and curriculum to their willp
pthe culprits in this decadeslong process are many we have seen the subordination of content to resortlike offerings for students and bloated administrations the education of undergraduates has been offloaded to grad students and adjuncts in order to free the most ambitious faculty to dedicate themselves to grant writing the grants themselves all too often arrive with strings sometimes invisible sometimes not which drive the direction of research facilitating some research programs while driving others extinct theoretical work which often brings in no grant money has been eclipsed by data collection which does in a world calling for more generalists who have the ability to cross disciplinary divides we instead see the everincreasing specialization of faculty and therefore of the studentsp
pall of these things lead to an academy in which some questions are never explored when what we need is utter freedom of inquiry the search for truth is an apolitical activity and a necessary onep
pallow a medical analogy if you will sometimes when a person dies what is put on their death certificate is true at one level but incomplete we desire concise answers and simple prescriptions but the causes of illness are often complex a persons death certificate may say they died of the flu but if they were in their eighties they were surely made vulnerable by age and only pushed over the brink by influenzap
plike that elderly patient higher ed is in danger at risk of being pushed over the brink by an epidemic of wokeness an epidemic that has managed to compromise every single institution nearly equally but wokeness was only able to take hold in an educational body that had been left defenseless by a kind of analytical immunodeficiency terrible ideas took over a system in which new ideas and the discussion thereof were increasingly rarep
pit would never have happened had our universities been vibrant and healthy there would have been no appetite for it in a system that generally provided good value to students awakening their minds and enhancing their capacity and insight while providing faculty true and unfettered freedom of inquiryp
pour institutions havent been healthy in a very long time while it is true that they have only recently begun actively miseducating students this came after decades of generally failing to educate themp
pthe challenge before the newly launched university of austin is therefore this can we build a new kind of institution that once again fosters a culture not just of competence but of insight one where the authoritarianism and selfflattering assertions of the woke would persuade no one one in which analysis and creativity exploration and discovery are pursued by all can we in some sense spark a new enlightenmentp
pi believe that we canp
pdoing so is not simply a matter of creating a nonwoke university however that is necessary but it is far from sufficientp
pimagine a university in which entire humans are engaged not just as brains to be filled with facts or as future workers or payers of tuition imagine a university in which everything can be questioned but the old is not thrown out simply because it is old nor the new adopted simply because it is new imagine a university that is actually capable of addressing the injustices that wokeness is supposed to be about imagine a university in which all of the faculty know something of value know how to communicate it and have an unflinching belief in the fundamental humanity of all of their studentsp
pthere is hunger for all of this from students and faculty alike people want to think new thoughts and strange ones to experiment and question and to have the freedom to change their mindsp
pthe post a relnofollow hrefhttpsspectatorworldcomtopicuniversityaustinsparknewenlightenmentcan the university of austin spark a new enlightenmenta appeared first on a relnofollow hrefhttpsspectatorworldcomthe spectator worldap | pthe university austin americas newest university launched month founders convinced higher education considerable risk new ideology called social justice revealed numerous ways succinctly called woke taking huge toll free exchange ideasp psafe spaces trigger warnings demanded students faculty recognizing challenge risk discomfort create strength wisdom instead adults room scared hapless administrators capitulate demandsp pwe told borrowing cultures inherently predatory cultural appropriation ancient ways humans expanded repertoire making connections people ideas asked believe anew original sin based skin color faculty students step outside new orthodoxy risk ridiculed shouted chased campus tenure means mob door concepts objective reality merit taken offensive best outdated untrue worstp pthese instantiations selflimiting ideology mocks premises americas founding documents mottos established universities harvard proclaims emveritasem yale adds emluxem mix little truth woke ideology little lightp pthese manifestations new ideology caricature deep thought naivete beliefs insistence questioned forces older influential play decades bent research curriculum willp pthe culprits decadeslong process seen subordination content resortlike offerings students bloated administrations education undergraduates offloaded grad students adjuncts order free ambitious faculty dedicate grant writing grants arrive strings invisible drive direction research facilitating research programs driving extinct theoretical work brings grant money eclipsed data collection world calling generalists ability cross disciplinary divides instead everincreasing specialization faculty studentsp pall things lead academy questions explored need utter freedom inquiry search truth apolitical activity necessary onep pallow medical analogy person dies death certificate true level incomplete desire concise answers simple prescriptions causes illness complex persons death certificate died flu eighties surely vulnerable age pushed brink influenzap plike elderly patient higher ed danger risk pushed brink epidemic wokeness epidemic managed compromise single institution nearly equally wokeness able hold educational body left defenseless kind analytical immunodeficiency terrible ideas took system new ideas discussion thereof increasingly rarep pit happened universities vibrant healthy appetite system generally provided good value students awakening minds enhancing capacity insight providing faculty true unfettered freedom inquiryp pour institutions havent healthy long time true recently begun actively miseducating students came decades generally failing educate themp pthe challenge newly launched university austin build new kind institution fosters culture competence insight authoritarianism selfflattering assertions woke persuade analysis creativity exploration discovery pursued sense spark new enlightenmentp pi believe canp pdoing simply matter creating nonwoke university necessary far sufficientp pimagine university entire humans engaged brains filled facts future workers payers tuition imagine university questioned old thrown simply old new adopted simply new imagine university actually capable addressing injustices wokeness supposed imagine university faculty know value know communicate unflinching belief fundamental humanity studentsp pthere hunger students faculty alike people want think new thoughts strange ones experiment question freedom change mindsp pthe post relnofollow hrefhttpsspectatorworldcomtopicuniversityaustinsparknewenlightenmentcan university austin spark new enlightenmenta appeared relnofollow hrefhttpsspectatorworldcomthe spectator worldap |
6196d6e70dd8811afaad0540 | This is how civilisations collapse | pspanlast week in an attempt to explain away the supply chain woes that are increasingly leading to goods shortages in america president biden citedspana relnoopener hrefhttpsenwikipediaorgwikii_pencil target_blank spana popular neoliberal fablespanaspan hespana relnoopener hrefhttpstwittercomabcpoliticsstatus1458555757616631809 target_blankspan observedspanaspan that to make a pencil wood and graphite must be sourced from the other ends of the world before the finished product can end up in american hands it sounds silly but thats exactly how it happens biden mused thats just the nature of the modern economy but the result he added is that when global disruptions hit it can hit supply chains particularly hardspanspan spanp
pspanfor neoliberal ideologues such as milton friedman whospan a relnoopener hrefhttpswwwyoutubecomwatchvr5gppio3a8 target_blankspanused the pencil fablespanaspan to argue for opaque worldspanning supply chains the beauty of such complex systems is not only that the consumer obtains his product at the lowest price possible and that the producer can maximise his profits spanspanbut even more to foster harmony and peace among the peoples of the world spanspanas the historian quinn slobodian noted inspan a relnoopener hrefhttpswwwhupharvardeducatalogphpisbn9780674979529 target_blankispanglobalistsspaniaspan his recent study of the first neoliberal theorists such idealistic motivations were evident from the very start ignoring the fact that the globalised world of the late 19th century failed to prevent world war one they believed that creating a giant interconnected market would make a repeat of such a cataclysm impossiblespanp
pspandivdiv spanp
pspanthey were wrong instead the restructuring of the global economy into a large web vastly increases the risk ofspana relnoopener hrefhttpswwwbbccomfuturearticle20190218areweontheroadtocivilisationcollapse target_blank spana total system collapsespanaspan instead of one economy failing a shock in one corner of the world can place great and sudden stress on economic and political systems thousands of miles away a war in distant taiwan can meanspana relnoopener hrefhttpswwwtheguardiancomworld2021may19chipswitheverythinghowonetaiwanesecompanydrivestheworldeconomy target_blank spanyoure no longer able to buy a new carspanaspan a drought on the other end of the worldspana relnoopener hrefhttpswwwbrinknewscomglobalfoodsupplychainsarebeingoverwhelmed target_blank spanmeans empty shelves at homespanaspan spanp
pspanas archaeologists and historians spana relnoopener hrefhttpswwwbbccomfuturearticle20190218areweontheroadtocivilisationcollapse target_blankspanhave increasingly begun to stressspanaspan our globalised world has seen two antecedents in the past in the interconnected hyperspecialised trading systems of the bronze age and those of the roman empire at its height when both buckled under a wave of unexpected shocks the result was not decline or recession but total collapse a process defined byspana relnoopener hrefhttpswwwamazoncoukcollapsecomplexsocietiesstudiesarchaeologydp052138673x target_blank spanthe great theorist joseph tainterspanaspan as fundamentally a sudden pronounced loss of an established level of sociopolitical complexity spanp
diva hrefhttpsunherdcom202111shouldweforcechinaintowarrefinnara hrefhttpsunherdcom202111shouldweforcechinaintowarrefinnarimg srchttpsunherdcomwpcontentuploads202111gettyimages518133336scalede16363944946311300x175jpgadiva hrefhttpsunherdcom202111shouldweforcechinaintowarrefinnarspanmore from this authorspanaa hrefhttpsunherdcom202111shouldweforcechinaintowarrefinnarh5how america can save taiwanh5apa hrefhttpsunherdcom202111shouldweforcechinaintowarrefinnarspanbyspan aris roussinosapdivadiv
pspanthis is as tainter observes a suddenly smaller simpler less stratified and less socially differentiated society where the flow of information drops people trade and interact less and specialization decreases and there is less centralized control spanspan spanspanthis is not a spenglerian moral fable of societal decline but an inexorable process whereby growing complexity and sophistication bring with them a growing fragility when a combination of shocks arrive the entire society is suddenly forced to reorganise itself it is not an extinction event or the end of the world life goes on just in a poorer simpler fashionspanp
pspanthe great trading civilisations of the bronze age mediterranean present just such an example as the archaeologist eric h cline notes in his recently reissued bookspana relnoopener hrefhttpspressprincetonedubookspaperback97806912080151177bc target_blank ispan1177 bcspaniaispan spanispanfor more than two thousand years the great civilisations of egypt western asia and the aegean had formed a single interconnected trading system dependent on complex trading networks that were open to instability the minute there was a change in one of the integral partsspanp
pspanwhen crisis struck shortly after 1200 bc it took down all the civilisations of the bronze age mediterranean simultaneously as cline notes perhaps the inhabitants could have survived one disaster such as an earthquake or a drought but they could not survive the combined effects of earthquake drought and invaders all occurring in rapid succession a domino effect followed in which thanks to the globalised nature of their world the disintegration of one civilisation led to the fall of the othersspanp
pspanthe collapse of roman civilisation a product of an overextended underfinanced empire weakened by internal feuding among its political elites presents another apposite example as the archaeologist bryan wardperkins emphasised in his 2005 bookspana relnoopener hrefhttpsglobaloupcomusheproductthefallofrome9780192807281ccgblangen target_blank ispanthe fall of rome and the end of civilisationspaniaispan spanispanthe most remarkable aspect of roman civilisation archaeologically speaking was the ability of even the poorest members of society to afford cheap and highquality consumer goods enabled by immense specialisation in production and an interconnected trading network that spanned the entire empire spanspan spanp
pspanyet after rome collapsed such goods were only available for the very richest members of society in the production of ceramics the use of coinage and the construction of stone buildings the western half of the empire suddenly sank back to a level of societal complexity lower than in iron age prehistory not returning to a roman level of sophistication until the later middle ages and indeed as wardperkins warns the roman economys complexity was the precise reason its collapse was so total economic complexity made massproduced goods available but it also made people dependent on specialists or semispecialists sometimes working hundreds of miles away for many of their material needs while this worked well in times of stability it precipitated collapse when trade routes were disruptedspanp
diva hrefhttpsunherdcom202110crisisisthenewnormalrefinnara hrefhttpsunherdcom202110crisisisthenewnormalrefinnarimg srchttpsunherdcomwpcontentuploads2021102gettyimages870601034scalede16344915347321024x6141300x180jpgadiva hrefhttpsunherdcom202110crisisisthenewnormalrefinnarspanmore from this authorspanaa hrefhttpsunherdcom202110crisisisthenewnormalrefinnarh5crisis is the new normalh5apa hrefhttpsunherdcom202110crisisisthenewnormalrefinnarspanbyspan aris roussinosapdivadiv
pspanlike friedman or biden wardperkins observes that today we are wholly dependent for our needs on thousands indeed hundreds of thousands of other people spread around the globe each doing their own little thing yet he draws a very different conclusion about the desirability of this situation noting that now we would be quite incapable of meeting our needs locally even in an emergencyspanspan spanp
pspanyet of course even as they were living through its early stages the romans were unaware their society was collapsing yes goods were harder to come by infrastructure was increasingly degraded urban life was increasingly unsettled economic growth was only a memory and new religions boomed as people tried to make sense of their declining prospects but even still the military failures on the empires eastern fringes barely impacted life in the imperial centre for some people great profits could still be made for most things went on much as before though with a lower standard of living with each passing year no doubt things will improve soon romans told themselves this is only a temporary blipspanp
pspanthe theorist of collapsespan a relnoopener hrefhttpswwwresilienceorgstories20110120onsetcataboliccollapse target_blankspanjohn michael greerspanaspan dates the beginning of the collapse of our own society inspana relnoopener hrefhttpsnewleftrevieworgissuesii62articlesimmanuelwallersteinstructuralcrises target_blank spanthe economic crisis of the mid1970sspanaspan which drove deindustrialisation in both the united states and britain and initiated the erosion of state capacity in search of everharder to accumulate profits hoarded by oligarchs even as it destroyed the tax base this is the process of what greer termsspan a relnoopener hrefhttpswwwecoshockorgtranscriptsgreer_on_collapsepdf target_blankspancatabolic collapsespanaspan spanspan the stairstep sequence of decline where decades of crisis are followed by decades of seeming improvement though the underlying society is left weaker and less resilient before the next crisis hits rinse and repeat and youve got the process that turned the forum of imperial rome into an early medieval sheep pasturespanspan spanp
pspanthis gloomy view accords well with the marxist theorist wolfgang streecksspana relnoopener hrefhttpswwwversobookscombooks2519howwillcapitalismend target_blank span2016 analysisspanaspan that the post1970s crisis of capitalism accelerated by the 2008 financial crash has led us into a period of civilisational entropy and decay for him we experiencespanspan life in the shadow of uncertainty always at risk of being upset by surprise events and unpredictable disturbances and dependent on individuals resourcefulness skillful improvisation and good luckspanspan it is a period where the state can no longer guarantee its citizens order or security where spanspandeep changes will occur in an unpredictable fashion and where every last effort to squeeze profit out of a collapsing system further undermines the social structure spanp
pspanfor streeck this interregnum is a time when personal wealth dwindles and financial insecurity becomes the norm spanspanindeed as streeck observes it is a period where spanspanas growth declines and risks increase the struggle for survival will become more intense it offers rich opportunities to oligarchs and warlords while imposing uncertainty and insecurity on all others in some ways like the long interregnum that began in the fifth century ce and is now called the dark age it is not a vision of hell or of the kind of apocalypse fantasised by hollywood but simply of a degraded version of the present a world closer to the modern global south than our recent past it is not necessarily a sudden cataclysm but a process that will take decades perhaps even centuries to fully reveal itselfspanp
diva hrefhttpsunherdcom202110crisisisthenewnormalrefinnara hrefhttpsunherdcom202110crisisisthenewnormalrefinnarimg srchttpsunherdcomwpcontentuploads2021102gettyimages870601034scalede16344915347321024x6141300x180jpgadiva hrefhttpsunherdcom202110crisisisthenewnormalrefinnarspansuggested readingspanaa hrefhttpsunherdcom202110crisisisthenewnormalrefinnarh5crisis is the new normalh5apa hrefhttpsunherdcom202110crisisisthenewnormalrefinnarspanbyspan john michael greerapdivadiv
pspanneither rome nor the civilisations of the bronze age mediterranean were brought down by one single cause it took the combination of climate change elite rivalry military disaster and migratory pressures combined with the extreme fragility engendered by economic specialisation and tightlyknit international trading networks to ensure that when collapse came it was total as wardperkins warns romes system of complex supply chains spanspanworked very well in stable times but it rendered consumers extremely vulnerable if for any reason the networks of production and distribution were disruptedspanp
pspanthe belated efforts of governments across the world tospan a relnoopener hrefhttpswwwwhitehousegovbriefingroomstatementsreleases20211031chairsstatementonprinciplesforsupplychainresilience target_blankspansecure fragile supply chainsspanaspan andspana relnoopener hrefhttpseceuropaeucommissionpresscornerdetailenip_21_5903 target_blank spanenhance food securityspanaspan are the refutation in action of the fable of the pencil as tainter notes the whole concern with collapse and selfsufficiency may itself be a significant social indicator of declinespan spana focused effort on domestic resilience is after all in itself evidence of reduced civilisational complexity as trade routes wither andspana relnoopener hrefhttpswwwbloombergcomopinionarticles20211112personalfinanceamericansneedtolivemorelikeeuropeans target_blank spanconsumption begins to dropspanaspan we should strive to ensure that we are heading towards a controlled descent and not a sudden cataclysmic crash the imperial centre may not hold but our lives must go onspanp
a hrefhttpsunherdcom202111thisishowcivilisationscollapseappcommentsview 34 commentsa | pspanlast week attempt explain away supply chain woes increasingly leading goods shortages america president biden citedspana relnoopener hrefhttpsenwikipediaorgwikii_pencil target_blank spana popular neoliberal fablespanaspan hespana relnoopener hrefhttpstwittercomabcpoliticsstatus1458555757616631809 target_blankspan observedspanaspan pencil wood graphite sourced ends world finished product end american hands sounds silly thats exactly happens biden mused thats nature modern economy result added global disruptions hit hit supply chains particularly hardspanspanspanp pspanfor neoliberal ideologues milton friedman whospan relnoopener hrefhttpswwwyoutubecomwatchvr5gppio3a8 target_blankspanused pencil fablespanaspan argue opaque worldspanning supply chains beauty complex systems consumer obtains product lowest price possible producer maximise profits spanspanbut foster harmony peace peoples world spanspanas historian quinn slobodian noted inspan relnoopener hrefhttpswwwhupharvardeducatalogphpisbn9780674979529 target_blankispanglobalistsspaniaspan recent study neoliberal theorists idealistic motivations evident start ignoring fact globalised world late 19th century failed prevent world war believed creating giant interconnected market repeat cataclysm impossiblespanp pspandivdivspanp pspanthey wrong instead restructuring global economy large web vastly increases risk ofspana relnoopener hrefhttpswwwbbccomfuturearticle20190218areweontheroadtocivilisationcollapse target_blank spana total system collapsespanaspan instead economy failing shock corner world place great sudden stress economic political systems thousands miles away war distant taiwan meanspana relnoopener hrefhttpswwwtheguardiancomworld2021may19chipswitheverythinghowonetaiwanesecompanydrivestheworldeconomy target_blank spanyoure longer able buy new carspanaspan drought end worldspana relnoopener hrefhttpswwwbrinknewscomglobalfoodsupplychainsarebeingoverwhelmed target_blank spanmeans shelves homespanaspanspanp pspanas archaeologists historians spana relnoopener hrefhttpswwwbbccomfuturearticle20190218areweontheroadtocivilisationcollapse target_blankspanhave increasingly begun stressspanaspan globalised world seen antecedents past interconnected hyperspecialised trading systems bronze age roman empire height buckled wave unexpected shocks result decline recession total collapse process defined byspana relnoopener hrefhttpswwwamazoncoukcollapsecomplexsocietiesstudiesarchaeologydp052138673x target_blank spanthe great theorist joseph tainterspanaspan fundamentally sudden pronounced loss established level sociopolitical complexityspanp diva hrefhttpsunherdcom202111shouldweforcechinaintowarrefinnara hrefhttpsunherdcom202111shouldweforcechinaintowarrefinnarimg srchttpsunherdcomwpcontentuploads202111gettyimages518133336scalede16363944946311300x175jpgadiva hrefhttpsunherdcom202111shouldweforcechinaintowarrefinnarspanmore authorspanaa hrefhttpsunherdcom202111shouldweforcechinaintowarrefinnarh5how america save taiwanh5apa hrefhttpsunherdcom202111shouldweforcechinaintowarrefinnarspanbyspan aris roussinosapdivadiv pspanthis tainter observes suddenly smaller simpler stratified socially differentiated society flow information drops people trade interact specialization decreases centralized control spanspanspanspanthis spenglerian moral fable societal decline inexorable process growing complexity sophistication bring growing fragility combination shocks arrive entire society suddenly forced reorganise extinction event end world life goes poorer simpler fashionspanp pspanthe great trading civilisations bronze age mediterranean present example archaeologist eric h cline notes recently reissued bookspana relnoopener hrefhttpspressprincetonedubookspaperback97806912080151177bc target_blank ispan1177 bcspaniaispan spanispanfor thousand years great civilisations egypt western asia aegean formed single interconnected trading system dependent complex trading networks open instability minute change integral partsspanp pspanwhen crisis struck shortly 1200 bc took civilisations bronze age mediterranean simultaneously cline notes inhabitants survived disaster earthquake drought survive combined effects earthquake drought invaders occurring rapid succession domino effect followed thanks globalised nature world disintegration civilisation led fall othersspanp pspanthe collapse roman civilisation product overextended underfinanced empire weakened internal feuding political elites presents apposite example archaeologist bryan wardperkins emphasised 2005 bookspana relnoopener hrefhttpsglobaloupcomusheproductthefallofrome9780192807281ccgblangen target_blank ispanthe fall rome end civilisationspaniaispan spanispanthe remarkable aspect roman civilisation archaeologically speaking ability poorest members society afford cheap highquality consumer goods enabled immense specialisation production interconnected trading network spanned entire empirespanspanspanp pspanyet rome collapsed goods available richest members society production ceramics use coinage construction stone buildings western half empire suddenly sank level societal complexity lower iron age prehistory returning roman level sophistication later middle ages wardperkins warns roman economys complexity precise reason collapse total economic complexity massproduced goods available people dependent specialists semispecialists working hundreds miles away material needs worked times stability precipitated collapse trade routes disruptedspanp diva hrefhttpsunherdcom202110crisisisthenewnormalrefinnara hrefhttpsunherdcom202110crisisisthenewnormalrefinnarimg srchttpsunherdcomwpcontentuploads2021102gettyimages870601034scalede16344915347321024x6141300x180jpgadiva hrefhttpsunherdcom202110crisisisthenewnormalrefinnarspanmore authorspanaa hrefhttpsunherdcom202110crisisisthenewnormalrefinnarh5crisis new normalh5apa hrefhttpsunherdcom202110crisisisthenewnormalrefinnarspanbyspan aris roussinosapdivadiv pspanlike friedman biden wardperkins observes today wholly dependent needs thousands hundreds thousands people spread globe little thing draws different conclusion desirability situation noting incapable meeting needs locally emergencyspanspanspanp pspanyet course living early stages romans unaware society collapsing yes goods harder come infrastructure increasingly degraded urban life increasingly unsettled economic growth memory new religions boomed people tried sense declining prospects military failures empires eastern fringes barely impacted life imperial centre people great profits things went lower standard living passing year doubt things improve soon romans told temporary blipspanp pspanthe theorist collapsespan relnoopener hrefhttpswwwresilienceorgstories20110120onsetcataboliccollapse target_blankspanjohn michael greerspanaspan dates beginning collapse society inspana relnoopener hrefhttpsnewleftrevieworgissuesii62articlesimmanuelwallersteinstructuralcrises target_blank spanthe economic crisis mid1970sspanaspan drove deindustrialisation united states britain initiated erosion state capacity search everharder accumulate profits hoarded oligarchs destroyed tax base process greer termsspan relnoopener hrefhttpswwwecoshockorgtranscriptsgreer_on_collapsepdf target_blankspancatabolic collapsespanaspan spanspan stairstep sequence decline decades crisis followed decades improvement underlying society left weaker resilient crisis hits rinse repeat youve got process turned forum imperial rome early medieval sheep pasturespanspanspanp pspanthis gloomy view accords marxist theorist wolfgang streecksspana relnoopener hrefhttpswwwversobookscombooks2519howwillcapitalismend target_blank span2016 analysisspanaspan post1970s crisis capitalism accelerated 2008 financial crash led period civilisational entropy decay experiencespanspan life shadow uncertainty risk upset surprise events unpredictable disturbances dependent individuals resourcefulness skillful improvisation good luckspanspan period state longer guarantee citizens order security spanspandeep changes occur unpredictable fashion effort squeeze profit collapsing system undermines social structure spanp pspanfor streeck interregnum time personal wealth dwindles financial insecurity norm spanspanindeed streeck observes period spanspanas growth declines risks increase struggle survival intense offers rich opportunities oligarchs warlords imposing uncertainty insecurity ways like long interregnum began fifth century ce called dark age vision hell kind apocalypse fantasised hollywood simply degraded version present world closer modern global south recent past necessarily sudden cataclysm process decades centuries fully reveal itselfspanp diva hrefhttpsunherdcom202110crisisisthenewnormalrefinnara hrefhttpsunherdcom202110crisisisthenewnormalrefinnarimg srchttpsunherdcomwpcontentuploads2021102gettyimages870601034scalede16344915347321024x6141300x180jpgadiva hrefhttpsunherdcom202110crisisisthenewnormalrefinnarspansuggested readingspanaa hrefhttpsunherdcom202110crisisisthenewnormalrefinnarh5crisis new normalh5apa hrefhttpsunherdcom202110crisisisthenewnormalrefinnarspanbyspan john michael greerapdivadiv pspanneither rome civilisations bronze age mediterranean brought single cause took combination climate change elite rivalry military disaster migratory pressures combined extreme fragility engendered economic specialisation tightlyknit international trading networks ensure collapse came total wardperkins warns romes system complex supply chains spanspanworked stable times rendered consumers extremely vulnerable reason networks production distribution disruptedspanp pspanthe belated efforts governments world tospan relnoopener hrefhttpswwwwhitehousegovbriefingroomstatementsreleases20211031chairsstatementonprinciplesforsupplychainresilience target_blankspansecure fragile supply chainsspanaspan andspana relnoopener hrefhttpseceuropaeucommissionpresscornerdetailenip_21_5903 target_blank spanenhance food securityspanaspan refutation action fable pencil tainter notes concern collapse selfsufficiency significant social indicator declinespan spana focused effort domestic resilience evidence reduced civilisational complexity trade routes wither andspana relnoopener hrefhttpswwwbloombergcomopinionarticles20211112personalfinanceamericansneedtolivemorelikeeuropeans target_blank spanconsumption begins dropspanaspan strive ensure heading controlled descent sudden cataclysmic crash imperial centre hold lives onspanp hrefhttpsunherdcom202111thisishowcivilisationscollapseappcommentsview 34 commentsa |
6196d7150dd8811afaad0547 | Get Organized to Win! – Jane McAlevey Pt 1 | a relnofollow hrefhttpstheanalysisnewsgetorganizedtowinjanemcaleveypt1 titleget organized to win jane mcalevey pt 1img sizesmaxwidth 1024px 100vw 1024px srchttpstheanalysisnewswpcontentuploads202111raisingexpectationandraisinghellweb1024x603jpg width1024 alt srcsethttpstheanalysisnewswpcontentuploads202111raisingexpectationandraisinghellweb1024x603jpg 1024w httpstheanalysisnewswpcontentuploads202111raisingexpectationandraisinghellweb300x177jpg 300w httpstheanalysisnewswpcontentuploads202111raisingexpectationandraisinghellweb768x452jpg 768w httpstheanalysisnewswpcontentuploads202111raisingexpectationandraisinghellwebjpg 1100w classwebfeedsfeaturedvisual wppostimage height603apone of the worlds leading organizers organizer jane mcalevey has trained thousands of activists in building more militant unions and winning electoral organizing she sees the fight for effective unions as critical to winning transformative climate policy jane tells her story to paul jay on reality asserts itself stop subsidizing wall st start subsidizing workers for high energy costsp
pa relnofollow hrefhttpstheanalysisnewsgetorganizedtowinjanemcaleveypt1sourceap | relnofollow hrefhttpstheanalysisnewsgetorganizedtowinjanemcaleveypt1 titleget organized win jane mcalevey pt 1img sizesmaxwidth 1024px 100vw 1024px srchttpstheanalysisnewswpcontentuploads202111raisingexpectationandraisinghellweb1024x603jpg width1024 alt srcsethttpstheanalysisnewswpcontentuploads202111raisingexpectationandraisinghellweb1024x603jpg 1024w httpstheanalysisnewswpcontentuploads202111raisingexpectationandraisinghellweb300x177jpg 300w httpstheanalysisnewswpcontentuploads202111raisingexpectationandraisinghellweb768x452jpg 768w httpstheanalysisnewswpcontentuploads202111raisingexpectationandraisinghellwebjpg 1100w classwebfeedsfeaturedvisual wppostimage height603apone worlds leading organizers organizer jane mcalevey trained thousands activists building militant unions winning electoral organizing sees fight effective unions critical winning transformative climate policy jane tells story paul jay reality asserts stop subsidizing wall st start subsidizing workers high energy costsp pa relnofollow hrefhttpstheanalysisnewsgetorganizedtowinjanemcaleveypt1sourceap |
619825dde3c4ba27c852d0d6 | The ACLU Thinks Kyle Rittenhouse's Civil Liberties Got Too Much Protection | div
picture
source sizesminwidth 600px 331px 100vw typeimagewebp srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202111eyepress109040jpgwebp 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202111eyepress1090401200x675jpgwebp 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202111eyepress109040800x450jpgwebp 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202111eyepress109040600x338jpgwebp 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202111eyepress109040331x186jpgwebp 331w
source sizesminwidth 600px 331px 100vw typeimagejpeg srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202111eyepress109040jpg 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202111eyepress1090401200x675jpg 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202111eyepress109040800x450jpg 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202111eyepress109040600x338jpg 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202111eyepress109040331x186jpg 331w
img width1200 alteyepress109040 srchttpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202111eyepress109040800x450jpg height675
picture
div
pkyle rittenhouse the 17yearold who shot and killed two men during the riots in kenosha wisconsin last summer was a hrefhttpsreasoncom20211119kylerittenhousehasbeenacquittedonallchargesacquitteda on friday prosecutors had charged him with firstdegree reckless homicide firstdegree intentional homicide attempted firstdegree intentional homicide and two counts of firstdegree recklessly endangering safety but the jury was persuaded by rittenhouses argument that he acted in selfdefensep
pfor anyone who had followed the trial closely this outcome is unsurprising the prosecution simply did not meet its burden of proof and rittenhouses defense team presented considerable evidence that he reasonably feared for his life each time he pulled the trigger a witness a hrefhttpsapnewscomarticlekylerittenhousewisconsinshootingshomicidekenosha376152e7942b06122dcf899f779b0057testifieda that joseph rosenbaum the first man shot by rittenhouse had threatened rittenhouses life and was attempting to wrest control of rittenhouses ar15 the second man anthony huber struck rittenhouse with a skateboard and the third mangaige grosskreutz who surviveda hrefhttpsreasoncom20211109theprosecutionhadaverybaddayinthekylerittenhousetrialadmitted on the standa that he had first pointed his own gun at rittenhouse rittenhouse shot him in response to this perceived threat as former rep justin amash lmich a hrefhttpstwittercomjustinamashstatus1461761777633533958put ita quotthe rittenhouse case was a clear case of selfdefense based on the evidence presented the initial media narrative was false justice prevailedquotp
pindeed people who did emnot emfollow the trial closely and instead relied on secondhand punditry from liberal media figures a hrefhttpstwittercommattyglesiasstatus1461774066831011840probably missed some very basic facts about the casea including that it had little to do with race rittenhouse and all three of his victims were white this is an important point that some mainstream media coverage emcontinues emto miss a hrefhttpswwwmsnbccomthereidoutreidoutblogkylerittenhouseacquittedhomicidercna5748cidsm_npd_ms_tw_maat msnbca for instance jahan jones a writer for show host joy reids blog reacted to the verdict by explicitly saying rittenhouses whiteness produced the acquittalp
blockquotepthe case had the a relnoopener hrefhttpswwwmsnbccomopinionkylerittenhousesnotguiltyverdictsmakeperfectsenseamerican1284073 target_blankmakings of an acquittala before the trial even began the outcome seemed clear even before a hrefhttpswwwnbcnewscomnewsusnewsrittenhousejuryselectedopeningstatementsexpectedstarttuesdayn1282930an almost exclusively white jury pool was selecteda even before judge bruce schroeder created an uproar by ruling that the slain protesters could be referred to a hrefhttpswwwnbcnewscomnewsusnewsmenshotrittenhousecantbecalledvictimsduringtrialn1282466as quotriotersquot and quotlootersquota but not quotvictimsquot even before schroeder a hrefhttpswwwnbcnewscomnewsusnewsjudgedeniesrequestincreasekylerittenhousesbailwontn1257489refused to punish rittenhousea for what prosecutors said amounted to a violation of his bond conditions rittenhouse is a white teen who abides by white rules and white people empathetic to those rules seemed poised to insulate him from repercussionspblockquote
prep cori bush dmo described the verdict as quotwhite supremacy in actionquotp
blockquote datawidth500 classtwittertweet datadnttrue
p langen dirltrthe judge the jury the defendantp
pits white supremacy in actionp
pthis system isnt built to hold white supremacists accountable its why black and brown folks are brutalized and put in cages while white supremacist murderers walk freep
pim hurt im angry im heartbrokenp
p cori bush coribush a hrefhttpstwittercomcoribushstatus1461776152255774722ref_srctwsrc5etfwnovember 19 2021apblockquote
pp
pthe accounts of former quarterback a hrefhttpstwittercomkaepernick7status1461781712275443721colin kaepernicka and the a hrefhttpstwittercomblklivesmatterstatus1461764892441128960black lives matter movementa made similar statements these remarks all reek of ignorance a jury acquitting a white defendant for killing three white men is hardly an example of white supremacyp
pperhaps its not surprising that activists and democratic politicians would reflexively cite white supremacy in a trial outcome that disappoints team blue more troubling is the response to the verdict from an organization that should know better the american civil liberties union aclu in a statement reacting to the verdict acluwisconsin interim executive director shaadie ali lamented the quotdeep roots of white supremacyquot in kenosha that prevented rittenhouse from being quotheld responsible for his actionsquotp
pquotkyle rittenhouse was a juvenile who traveled across state lines on a vigilante mission was allowed by police to roam the streets of kenosha with an assault rifle and ended up shooting three people and killing twoquot said span langenbrandon buskey director of the aclus criminal law reform project quotspanthese are the simple tragic facts his acquittal comes after an aclu investigation exposing how kenosha law enforcement used violence against protesters and drove them toward white militia groups in ways that escalated tensions and almost certainly led to these shootingsquotp
pin a twitter a hrefhttpstwittercomaclustatus1461762952567136259threada the aclu complained that rittenhouse was not held accountable for his quotconscious decision to travel across state lines and injure one person and take the lives of two people protesting the shooting of jacob blake by policequotp
pof course it is not illegal to travel across state lines the fact that rittenhouse wandered outside the boundaries of his home and entered a neighboring municipality was irrelevant to the case the jury did not agree withand the facts of the case did not supportthe claim that his decision to shoot three people was quotconsciousquot in the sense that it was premeditated he argued that he rationally believed his life was in imminent danger and the surviving shooting victim provided testimony that supported this argumentp
pone might have expected that an organization dedicated to the preservation of civil liberties would not so cavalierly take the side of prosecutors against the concept of selfdefense in the past the aclu has done terrific work shining a light on a hrefhttpswwwacluorgnewsbyissueprosecutorialmisconductandcapitalpunishmentprosecutorial misconductathe tremendous power the state has to stack the deck against defendants the aclu purports to believe that all people even the guilty deserve due process protections the organization is evidently outraged by the verdict is the aclu outraged that the prosecutor tried to argue that a hrefhttpsreasoncom20211116kylerittenhousejurydeliberationstrialgunjudgeselfdefenserittenhouse exercising his miranda rights was evidence of his guiltap
pit is not necessary to a hrefhttpswwwtheatlanticcomideasarchive202111kylerittenhouserightselfdefenserolemodel620715elevate rittenhouse to hero statusa or to agree with his very poor decision to involve himself in the kenosha riots to accept that the prosecution failed to prove the charges against him rittenhouse is now a free mannot because of white supremacy or because the criminal justice system failed activists politicians and media figures who purport to care about civil liberties should work toward empowering other defendants to avail themselves of due process rather than complain that in this one case the prosecutors did not get its wayp
pthe post a relnofollow hrefhttpsreasoncom20211119kylerittenhouseverdictacquittedaclumedialiberalsthe aclu thinks kyle rittenhouses civil liberties got too much protectiona appeared first on a relnofollow hrefhttpsreasoncomreasoncomap | div picture source sizesminwidth 600px 331px 100vw typeimagewebp srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202111eyepress109040jpgwebp 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202111eyepress1090401200x675jpgwebp 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202111eyepress109040800x450jpgwebp 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202111eyepress109040600x338jpgwebp 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202111eyepress109040331x186jpgwebp 331w source sizesminwidth 600px 331px 100vw typeimagejpeg srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202111eyepress109040jpg 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202111eyepress1090401200x675jpg 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202111eyepress109040800x450jpg 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202111eyepress109040600x338jpg 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202111eyepress109040331x186jpg 331w img width1200 alteyepress109040 srchttpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202111eyepress109040800x450jpg height675 picture div pkyle rittenhouse 17yearold shot killed men riots kenosha wisconsin summer hrefhttpsreasoncom20211119kylerittenhousehasbeenacquittedonallchargesacquitteda friday prosecutors charged firstdegree reckless homicide firstdegree intentional homicide attempted firstdegree intentional homicide counts firstdegree recklessly endangering safety jury persuaded rittenhouses argument acted selfdefensep pfor followed trial closely outcome unsurprising prosecution simply meet burden proof rittenhouses defense team presented considerable evidence reasonably feared life time pulled trigger witness hrefhttpsapnewscomarticlekylerittenhousewisconsinshootingshomicidekenosha376152e7942b06122dcf899f779b0057testifieda joseph rosenbaum man shot rittenhouse threatened rittenhouses life attempting wrest control rittenhouses ar15 second man anthony huber struck rittenhouse skateboard mangaige grosskreutz surviveda hrefhttpsreasoncom20211109theprosecutionhadaverybaddayinthekylerittenhousetrialadmitted standa pointed gun rittenhouse rittenhouse shot response perceived threat rep justin amash lmich hrefhttpstwittercomjustinamashstatus1461761777633533958put ita quotthe rittenhouse case clear case selfdefense based evidence presented initial media narrative false justice prevailedquotp pindeed people didemnotemfollow trial closely instead relied secondhand punditry liberal media figures hrefhttpstwittercommattyglesiasstatus1461774066831011840probably missed basic facts casea including little race rittenhouse victims white important point mainstream media coverage emcontinuesemto miss hrefhttpswwwmsnbccomthereidoutreidoutblogkylerittenhouseacquittedhomicidercna5748cidsm_npd_ms_tw_maat msnbca instance jahan jones writer host joy reids blog reacted verdict explicitly saying rittenhouses whiteness produced acquittalp blockquotepthe case thea relnoopener hrefhttpswwwmsnbccomopinionkylerittenhousesnotguiltyverdictsmakeperfectsenseamerican1284073 target_blankmakings acquittalabefore trial beganthe outcome clear beforea hrefhttpswwwnbcnewscomnewsusnewsrittenhousejuryselectedopeningstatementsexpectedstarttuesdayn1282930an exclusively white jury pool selecteda judge bruce schroeder created uproar ruling slain protesters referred hrefhttpswwwnbcnewscomnewsusnewsmenshotrittenhousecantbecalledvictimsduringtrialn1282466as quotriotersquot quotlootersquotabut quotvictimsquot schroedera hrefhttpswwwnbcnewscomnewsusnewsjudgedeniesrequestincreasekylerittenhousesbailwontn1257489refused punish rittenhouseafor prosecutors said amounted violation bond conditions rittenhouse white teen abides white rules white people empathetic rules poised insulate repercussionspblockquote prep cori bush dmo described verdict quotwhite supremacy actionquotp blockquote datawidth500 classtwittertweet datadnttrue p langen dirltrthe judge jury defendantp pits white supremacy actionp pthis system isnt built hold white supremacists accountable black brown folks brutalized cages white supremacist murderers walk freep pim hurt im angry im heartbrokenp p cori bush coribush hrefhttpstwittercomcoribushstatus1461776152255774722ref_srctwsrc5etfwnovember 19 2021apblockquote pp pthe accounts quarterback hrefhttpstwittercomkaepernick7status1461781712275443721colin kaepernicka hrefhttpstwittercomblklivesmatterstatus1461764892441128960black lives matter movementa similar statements remarks reek ignorance jury acquitting white defendant killing white men hardly example white supremacyp pperhaps surprising activists democratic politicians reflexively cite white supremacy trial outcome disappoints team blue troubling response verdict organization know better american civil liberties union aclu statement reacting verdict acluwisconsin interim executive director shaadie ali lamented quotdeep roots white supremacyquot kenosha prevented rittenhouse quotheld responsible actionsquotp pquotkyle rittenhouse juvenile traveled state lines vigilante mission allowed police roam streets kenosha assault rifle ended shooting people killing twoquot said span langenbrandon buskey director aclus criminal law reform project quotspanthese simple tragic facts acquittal comes aclu investigation exposing kenosha law enforcement violence protesters drove white militia groups ways escalated tensions certainly led shootingsquotp pin twitter hrefhttpstwittercomaclustatus1461762952567136259threada aclu complained rittenhouse held accountable quotconscious decision travel state lines injure person lives people protesting shooting jacob blake policequotp pof course illegal travel state lines fact rittenhouse wandered outside boundaries home entered neighboring municipality irrelevant case jury agree withand facts case supportthe claim decision shoot people quotconsciousquot sense premeditated argued rationally believed life imminent danger surviving shooting victim provided testimony supported argumentp pone expected organization dedicated preservation civil liberties cavalierly prosecutors concept selfdefense past aclu terrific work shining light hrefhttpswwwacluorgnewsbyissueprosecutorialmisconductandcapitalpunishmentprosecutorial misconductathe tremendous power state stack deck defendants aclu purports believe people guilty deserve process protections organization evidently outraged verdict aclu outraged prosecutor tried argue hrefhttpsreasoncom20211116kylerittenhousejurydeliberationstrialgunjudgeselfdefenserittenhouse exercising miranda rights evidence guiltap pit necessary hrefhttpswwwtheatlanticcomideasarchive202111kylerittenhouserightselfdefenserolemodel620715elevate rittenhouse hero statusa agree poor decision involve kenosha riots accept prosecution failed prove charges rittenhouse free mannot white supremacy criminal justice system failed activists politicians media figures purport care civil liberties work empowering defendants avail process complain case prosecutors wayp pthe post relnofollow hrefhttpsreasoncom20211119kylerittenhouseverdictacquittedaclumedialiberalsthe aclu thinks kyle rittenhouses civil liberties got protectiona appeared relnofollow hrefhttpsreasoncomreasoncomap |
619825e4e3c4ba27c852d0d8 | What has Annapolis to do with Austin? My conversation with Pano Kanelos | pthe launch of the a relnoreferrer noopener hrefhttpswwwuaustinorg target_blankuniversity of austin texasa uatx last week has reignited the simmering conflict over what the left and the right think has gone wrong with american liberal arts education the left has deconstructed and in some cases dismissed traditional liberal arts as irretrievably biased against nonwhites women and sexual and gender minorities for the right such education is often seen as irrelevant to earning a living and at worst an adversary of traditional american values because of the deconstruction i just mentionedp
pwhat the left and the right share in
common is a skepticism of the liberal arts grounded in a highly instrumental
understanding of the purpose of education study is not for its own sake but for
other goals like social reform or employment this is a profound and often
unacknowledged shift with ramifications for institutions of higher education
for students and for american societyp
pit was the perceived need to
reinvigorate traditional liberal arts that led to the foundation of uatx a
significant part of the criticism leveled at this project emanates from the
academic left which both questions the need for such an institution while also
calling into doubt the motives integrity and judgment of the founders this
is a very unfortunate new front in the nations ongoing culture war and it
represents an effort to extinguish an interesting new model before it has a
chance to take shape p
figure classwpblockimageimg alt srchttpswwwaeiorgwpcontentuploads202111orrell1119libraryjpgx91208 classwpimage1008615662figcaptionvia twenty20figcaptionfigure
pto help provide some context to the uatx story we have developed a transcript of a conversation i had with the new president of the university pano kanelos who prior to joining uatx led a relnoreferrer noopener hrefhttpswwwsjcedu target_blankst johns collegea in annapolis maryland and santa fe new mexico st johns provides a great books education centered on the classic works of western civilization and not surprisingly this kind of schooling is a key element in the kind of education uatx plans to offer our conversation explores why such education is necessary to human flourishing and how it is against expectation also surprisingly good career preparationp
pemthis transcript has been edited for length and clarity the full transcript is available a relnoreferrer noopener hrefhttpswwwaeiorgwpcontentuploads202111panofulltranscriptformattedpdfx91208 target_blankhereaemp
pstrongorrell
lets start with you talking about your own life the influences that brought
you to where you are today what kind of conclusions youve reached about what
actually creates human happinessstrongp
pkanelos i am one of the least likely
people to have ended up to be a college president i wasnt even really
supposed to go to college at all my family are greek immigrants i grew up in
the back of a greek diner neither of my parents were educated and nobody in
my family had ever been to college at all i was the oldest in our immediate
family none of my cousins or anybody so there werent really kind of
evident pathways for me other than my fears for going off to college but i
somehow stumbled my way into collegep
pi went to a jesuit high school in
phoenix arizona it was a place where everybody was oriented towards college
and i would say one of the things that really propelled me forward i had a
couple fantastic english teachers i really developed a love for literature a kind
of insatiable appetite for wanting to read more booksp
spanspan
pill just share an anecdote to show
you how naive i wasp
pi went to northwestern university in
chicago my very first week of being there i was sitting in my dorm room with
my new roommate and we were just chatting he came from a family that was
pretty privileged and i was a bit intimidated by him he looked at me and he
said pano so what are you going to major in i had no idea what he was
talking about i didnt know what a major was i thought you went to college
like you went to high schoolp
pthis of course was before you could
look things up on google so i started asking people as quietly as possible so
what are you majoring in it dawned on me that oh you pick something like a
specialty and then you make your way forward i was an english major creative
writing is part of that which is fantastic i did teach for america
immediately after college and taught in the rio grande valley of texas the
very bottom of texas towards the point on the border in a very interesting
community therep
pand then i went into a graduate
program at boston university called the university professors program which is
kind of interdisciplinary and in line with somebody like me who really was
just using graduate school as a platform to read even more books and they had
this wonderful collection of really amazing towering figures which i only
came to appreciate in retrospect people in the program faculty included elie
wiesel derek walcott and two people who became very important in my life the
poet geoffrey hill and the philosopher roger scrutonp
pfrom there i did a postdoc at
stanford and then onto teaching gigs at the university of san diego loyola in
chicago moved on to be the dean of the honors college the great books honors
college at valparaiso university called christ college wonderful program
great place and then from there st johns made the totally irrational
decision to hire me as president four years ago and ive been here in
annapolis sincep
pstrongthe
question that i want to pose to you is what have you learned you talked
earlier in this conversation about you discovered the importance of the life of
the mind whats the life of the mind and then why is it importantstrongp
plife of the mind is a life that takes very
seriously the selfreflection that others have engaged in usually through text
and works of art human beings are separate from the rest of creation the rest
of the material universe in a sense that we can come to know ourselves but
not entirelyp
figure classwpblockimageimg alt srchttpswwwaeiorgwpcontentuploads202111orrell1119walkingjpgx91208 classwpimage1008615673figcaptionstudents walk through the university of michigan campus reutersemily elconinfigcaptionfigure
pso a life of the mind is not just a
game its about asking the fundamental human questions and orienting ourselves
around our search for those answers i think anybody who is thoughtful and
attentive to the world and attentive to their own place in the world and who
reads and who looks around them with curiosity in the world i think all of
that is life of the mindp
pstronghow
does knowing yourself lead to a happy life as some of the people at st johns
might think of happinessstrongp
pwhen i think of happiness i think of
aristotle who defines happiness essentially as fulfilling ones purpose so
were all imbued with a sort of potential as we strive to reach that potential
we reach a state of happiness its not a euphoric state its a state of i
think feeling fulfilled i think this does circle around to the life of the
mind human beings are creatures of language language allows us to perceive
the world in very very complex nuanced and sophisticated waysp
pand so as our perception of the world
is amplified enhanced as we learn more about ourselves and the world around
us i think we feel like were doing what human beings have been engineered
designed i dont know what the right word is to do and i think it is very
very gratifyingp
pstrongi
want you to talk to us about st johns college give us its origin story and
what its designed to do how does it go about achieving its purposestrongp
pso st johns actually has i think
two origin stories theres two st johns theres the one that spans most of
the history of the college and then one that started more recently the college
was originally founded in 1696 so its the third oldest college in the country
after harvard and william and mary and it was founded as a conventional
colonial liberal arts institution first called the king william school but as
you might imagine towards the end of the 18th century naming things after
british monarchs was less popular than it had originally been so the name was
changed to st johns and so for most of the colleges history its been one
among many of the sort of archetypal east coast traditional liberal arts
institutionsp
pbut in the early 20th century the
college took a turn in 1937 the college had been on financial rocks at many
points throughout its history most colleges can say that and there was sort
of an existential crisis in the 1930s between the wars the originators of the
new program of instruction were two fellows named scott buchanan and
stringfellow barr they decided that it would be revolutionary to move from
what had been a relatively conventional program of study that you would find in
almost any college to a program that exclusively focused on about 200 of the
great books of the western tradition studied by all the students collectively
in the same order over a period of four yearsp
pand so at that time the new program
began and it was mapped out as a study from the ancient world to the modern
world integrated program of literature philosophy math science music
languages and very ambitious at that time there was a general movement
towards great books that was meant to democratize elite education the idea was
that the authors that had formed the canon of the western tradition should not
be the exclusive province of families who could send off young sons to elite
prep schools but that they should be the inheritance of everybodyp
pso what if we created this curriculum
and made it available to everybody and for 80ish years we have been
conducting what we call the new program its stayed roughly the same every
student comes in there are no majors everybody follows the same course of
study the books there is some change over time of the books some books make
their way onto the program some are taken off but its i would say glacial
in terms of changep
pall the students share the same
material same discussions same sequence of study whats even more
extraordinary about it is that our faculty come to us with phds from all
different backgrounds but they all have to teach all the texts in the program
over the course of their career so they over the course of their teaching
career exemplify the comprehensive approach to the program that we want our
students to undertake its really unlike anything youd find anywhere elsep
pstrongwhats
the product do you think the student product for getting people graduating
from st johns since theyre not being equipped for a technical field
theyre not being equipped as experts in history or philosophy or some
subject matterstrongp
pand one of the things i always say is
theres no such thing as a liberal art there are only liberal arts so to be
educated in liberal arts means you have to be educated comprehensively across
disciplinesp
pin studying mathematics in studying
music studying ancient languages modern languages you come to understand the
world and the human condition through a kind of prism through different
lenses different angles all aiming at the same thing which is
selfunderstanding but coming at it from different angles and what you find
is those things start to cross over and converge ill give an examplep
pwe study biology in the natural
sciences extensively the very first thing we have our students do when they
begin their study of the natural world of biology is we dont open a textbook
theres no sort of quiz about anatomy or anything like that we send them
outside it happens to be a time of year where the wonderful magnolia trees we
have on campus are in blossom and we have them each sit apart from each other
with a sketchbook and draw a magnolia focus on the plant on the living
organism and they have to do it for like an hourp
pand what they learn is through
intensive observation of a natural organism they start to ask questions why
is it shaped this way what about its coloration what about the different
textures on its surface what about the magnolias position relative to the
rest of the natural world around it and a whole series of questions arises
from that so they return to the classroom and they start sharing the questions
that they have and start thinking about those questionsp
figure classwpblockimageimg alt srchttpswwwaeiorgwpcontentuploads202111orrell1119quadjpgx91208 classwpimage1008615671figure
pwhat theyre essentially doing is
going back to what natural philosopher has always done observe ask questions
and then try to figure the answers so we dont begin with the answers right
which we get in a textbook we begin with the process of questioning and then
the process of trying to teach oneself how to answer the question thats what
you get from a st johns education intense habits that ask fundamental
questions about the world and then the ability to find a way to answer those
questions to use ones own native resources ones own intellect to answer
questions and solve problemsp
pi cant imagine that theres any
employer out there in the world that doesnt want a person who has been trained
to identify problems and use their own resources to solve those problems all
right i actually think when you study things within the disciplines it can be
debilitating over time i always say that a liberal arts education is not about
the transfer of information but about transformation and so what were doing
at st johns is were transforming young people into seekers of knowledge with
the capacity to find the thing theyre looking forp
pstrongis
that something st johns teaches people to do or does it draw people who are
already predisposed to that kind of learning and that kind of an approach to
lifestrongp
pi think its a bothand students understand
that they are embarking upon an education thats unconventional and that is
bookcentered so we tend to draw students who have a natural inclination to
seek out books now in terms of stepping back pausing and thinking about
questions those are habits that we purposefully form herep
pcustomarily our classes begin with an
opening question so the students will do the reading prepare for class come
in and its usually the tutor but sometimes a student whos tasked with an
opening question theyll just pose a question that comes out of the reading
sometimes its a simple question sometimes its complex sometimes its
nuanced but it could be something like we just finished reading the middle
section of machiavellis emprinceem
machiavelli suggests that the ends justify the means is he rightp
pthere are sometimes these prolonged
silences and youre right under any other circumstances you would think the
students were unprepared but what theyre doing is processing one of the
greatest sins at st johns is to speak in a less than thoughtful way to just
speak to be heard so what theyre doing is theyre trying to formulate a
response and most of them are not eager to be the first one to speak because
what they really want to do is hear what other people have to say they want to
listen and then respond to thatp
pstrongwe
have such a performative educational culture of people needing to be right and
to gain the affirmation of the authority figure in a classroom and at st
johns i think youre pushing against a deeply entrenched culture how long
does it take students to get into a rhythmstrongp
pby sophomore year its almost like
youre at a different institution freshman year they tend to be eager and they
tend to bring with them the habits that theyve acquired elsewhere the ones
you described it takes kind of going back to knowing ourselves to be able
to be quiet takes a degree of selfconfidence right i mean why do we speak
out and try to receive the approval of our authority figures its because we
need assurance that were okay that were not dumb that were smart p
pstrongwhere
do they wind up after they leave st johnsstrongp
pa significant number of them do end up
doing graduate studies theyre not all going to become phds in philosophy
many of them are going into the sciences a significant number are going into
tech a significant number are going into medicine some into business they go
in every directionp
pa lot of our students go into education
in one form or another not surprisingly but then we have these sort of
clusters of students in very unexpected places the most famous winemaker in
napa valley is a graduate of st johns college people joke out there that the
two most important schools for winemakers are uc davis and st johns college
and i dont think theyre wrongp
figure classwpblockimageimg alt srchttpswwwaeiorgwpcontentuploads202111orrell1119graduationjpgx91208 classwpimage1008615674figcaptionvia twenty20figcaptionfigure
pthere arent too many significant
patterns i would say what most of them are looking for is careers where
learning can continue to happen i would say thats a trend that i seep
pstrongi
want to ask you about the pushback that weve seen against college
bachelorlevel study and education over the last couple years we dont need
more philosophers we need plumbers we need electricians we need welders we
need people who work with robots in factories to build things how do you
react when you hear that and youre leading a college where youre doing the
oppositestrongp
pi think theres two things that prompt
the questioning of the value of the fouryear college degree the first is if
you treat higher education simply as something instrumental it makes a heck of
a lot of sense to try and find an end around a fouryear education its
expensive its time consuming p
pthe other is a fault of the system
itself of higher education fouryear degrees have essentially come to be what
i call 120 credit delivery systems the whole point is youre kind of racking
up this abstract thing called college credit thats attached to an assortment
of classes that mostly dont add up together to anything in particular at
least half of the credits most students take are general electives that are
disconnected from one another general education requirements oneoff classes
things are done buffetstyle and even within majors sometimes the pathways
arent very clearp
pthe disconnectedness of higher
education the fact that its not holistic in its approach where theres a sequence
of coursework that is adding up to something greater than the sum of its parts
i think thats very frustrating to a lot of students i think a lot of students
feel like theyre spinning their wheels taking classes that are just checking
boxesp
pi would say that i think fouryear
education should be questioned i dont really understand why college is four
years to be honest with you its a convention think of it this way we look
at graduate programs that are perfectly comfortable with graduate programs
having different lengths you do three years for a law degree but eight years
for a medical specialty one year or two years for an mba the length of those
programs is dictated by the course of study and what it is that one needs to
encounter why is every bachelors degree essentially the same shape and size
i dont knowp
pstrongdo
you think there isnt an answer to that question how did it evolve into a fouryear
programstrongp
pi think it is a convention here
roughly mirroring the fouryear convention of the high school yearsp
pwe have this elastic sense of college you show up you hang out you explore you figure out what a major means and then you hone in on what youre going to do its very expensive to do that its very expensive if we were to shorten our bachelor degrees by a single year so if we made three years the standard we would lower the cost of higher education by at least 50 percent twentyfive percent of that would just simply be the cost of that fourth year tuition and otherwise and then the opportunity cost in there of not being employed that year would be added back into the cost of educationp
figure classwpblockimageimg alt srchttpswwwaeiorgwpcontentuploads202111orrell1119studentsjpgx91208 classwpimage1008615668figcaptionvia twenty20figcaptionfigure
pwe would solve the financial crisis of
higher education in one fell swoop if we could convince our accreditors the
whole system to certify threeyear college degrees unless theyre justified i
mean there are programs for example engineering or maybe nursing where
four years is really critical i think four years at st johns is critical we
use every second of that time very purposefully but i think its something to
take seriouslyp
pstrongyouve
been at st johns for four years and youve done some really remarkable things
but youre moving on id like to know where youre going and what youre
doing what are you trying to createstrongp
pive been asked to found a new university and that will be near austin texas and the reason for this institution is to solve some of the problems weve been talking about the questions of the right scope of higher education how one combines all the benefits of a liberal arts education towards professional life in the modern world and also to try and move us back towards a center in higher education where we recommit to principles of freedom of inquiry freedom of expression and freedom of conscience and model those critical freedoms as best as we canp
divpstronglearn more stronga hrefhttpswwwaeiorgopedsthelabormarketneedsthesoftskillsolderworkershavethe labor market needs the soft skills older workers havea a hrefhttpswwwaeiorgpovertystudiesbenefitscliffshighlightsfrommyconversationwithalexruderbenefits cliffs highlights from my conversation with alex rudera a hrefhttpswwwaeiorguncategorizedthefutureofremoteworkhighlightsfrommyconversationwithnicholasbloomthe future of remote work highlights from my conversation with nicholas bloomapdiv
pthe post a relnofollow hrefhttpswwwaeiorgeducationhighereducationwhathasannapolistodowithaustinmyconversationwithpanokaneloswhat has annapolis to do with austin my conversation with pano kanelosa appeared first on a relnofollow hrefhttpswwwaeiorgamerican enterprise institute aeiap | pthe launch relnoreferrer noopener hrefhttpswwwuaustinorg target_blankuniversity austin texasa uatx week reignited simmering conflict left right think gone wrong american liberal arts education left deconstructed cases dismissed traditional liberal arts irretrievably biased nonwhites women sexual gender minorities right education seen irrelevant earning living worst adversary traditional american values deconstruction mentionedp pwhat left right share common skepticism liberal arts grounded highly instrumental understanding purpose education study sake goals like social reform employment profound unacknowledged shift ramifications institutions higher education students american societyp pit perceived need reinvigorate traditional liberal arts led foundation uatx significant criticism leveled project emanates academic left questions need institution calling doubt motives integrity judgment founders unfortunate new nations ongoing culture war represents effort extinguish interesting new model chance shape p figure classwpblockimageimg alt srchttpswwwaeiorgwpcontentuploads202111orrell1119libraryjpgx91208 classwpimage1008615662figcaptionvia twenty20figcaptionfigure pto help provide context uatx story developed transcript conversation new president university pano kanelos prior joining uatx led relnoreferrer noopener hrefhttpswwwsjcedu target_blankst johns collegea annapolis maryland santa fe new mexico st johns provides great books education centered classic works western civilization surprisingly kind schooling key element kind education uatx plans offer conversation explores education necessary human flourishing expectation surprisingly good career preparationp pemthis transcript edited length clarity transcript available relnoreferrer noopener hrefhttpswwwaeiorgwpcontentuploads202111panofulltranscriptformattedpdfx91208 target_blankhereaemp pstrongorrell lets start talking life influences brought today kind conclusions youve reached actually creates human happinessstrongp pkanelos likely people ended college president wasnt supposed college family greek immigrants grew greek diner parents educated family college oldest immediate family cousins anybody werent kind evident pathways fears going college stumbled way collegep pi went jesuit high school phoenix arizona place everybody oriented college things propelled forward couple fantastic english teachers developed love literature kind insatiable appetite wanting read booksp spanspan pill share anecdote naive wasp pi went northwestern university chicago week sitting dorm room new roommate chatting came family pretty privileged bit intimidated looked said pano going major idea talking didnt know major thought went college like went high schoolp pthis course look things google started asking people quietly possible majoring dawned oh pick like specialty way forward english major creative writing fantastic teach america immediately college taught rio grande valley texas texas point border interesting community therep pand went graduate program boston university called university professors program kind interdisciplinary line somebody like graduate school platform read books wonderful collection amazing towering figures came appreciate retrospect people program faculty included elie wiesel derek walcott people important life poet geoffrey hill philosopher roger scrutonp pfrom postdoc stanford teaching gigs university san diego loyola chicago moved dean honors college great books honors college valparaiso university called christ college wonderful program great place st johns totally irrational decision hire president years ago ive annapolis sincep pstrongthe question want pose learned talked earlier conversation discovered importance life mind whats life mind importantstrongp plife mind life takes seriously selfreflection engaged usually text works art human beings separate rest creation rest material universe sense come know entirelyp figure classwpblockimageimg alt srchttpswwwaeiorgwpcontentuploads202111orrell1119walkingjpgx91208 classwpimage1008615673figcaptionstudents walk university michigan campus reutersemily elconinfigcaptionfigure pso life mind game asking fundamental human questions orienting search answers think anybody thoughtful attentive world attentive place world reads looks curiosity world think life mindp pstronghow knowing lead happy life people st johns think happinessstrongp pwhen think happiness think aristotle defines happiness essentially fulfilling ones purpose imbued sort potential strive reach potential reach state happiness euphoric state state think feeling fulfilled think circle life mind human beings creatures language language allows perceive world complex nuanced sophisticated waysp pand perception world amplified enhanced learn world think feel like human beings engineered designed dont know right word think gratifyingp pstrongi want talk st johns college origin story designed achieving purposestrongp pso st johns actually think origin stories theres st johns theres spans history college started recently college originally founded 1696 oldest college country harvard william mary founded conventional colonial liberal arts institution called king william school imagine end 18th century naming things british monarchs popular originally changed st johns colleges history sort archetypal east coast traditional liberal arts institutionsp pbut early 20th century college took turn 1937 college financial rocks points history colleges sort existential crisis 1930s wars originators new program instruction fellows named scott buchanan stringfellow barr decided revolutionary relatively conventional program study find college program exclusively focused 200 great books western tradition studied students collectively order period yearsp pand time new program began mapped study ancient world modern world integrated program literature philosophy math science music languages ambitious time general movement great books meant democratize elite education idea authors formed canon western tradition exclusive province families send young sons elite prep schools inheritance everybodyp pso created curriculum available everybody 80ish years conducting new program stayed roughly student comes majors everybody follows course study books change time books books way program taken glacial terms changep pall students share material discussions sequence study whats extraordinary faculty come phds different backgrounds teach texts program course career course teaching career exemplify comprehensive approach program want students undertake unlike youd find elsep pstrongwhats product think student product getting people graduating st johns theyre equipped technical field theyre equipped experts history philosophy subject matterstrongp pand things theres thing liberal art liberal arts educated liberal arts means educated comprehensively disciplinesp pin studying mathematics studying music studying ancient languages modern languages come understand world human condition kind prism different lenses different angles aiming thing selfunderstanding coming different angles find things start cross converge ill examplep pwe study biology natural sciences extensively thing students begin study natural world biology dont open textbook theres sort quiz anatomy like send outside happens time year wonderful magnolia trees campus blossom sit apart sketchbook draw magnolia focus plant living organism like hourp pand learn intensive observation natural organism start ask questions shaped way coloration different textures surface magnolias position relative rest natural world series questions arises return classroom start sharing questions start thinking questionsp figure classwpblockimageimg alt srchttpswwwaeiorgwpcontentuploads202111orrell1119quadjpgx91208 classwpimage1008615671figure pwhat theyre essentially going natural philosopher observe ask questions try figure answers dont begin answers right textbook begin process questioning process trying teach oneself answer question thats st johns education intense habits ask fundamental questions world ability find way answer questions use ones native resources ones intellect answer questions solve problemsp pi cant imagine theres employer world doesnt want person trained identify problems use resources solve problems right actually think study things disciplines debilitating time liberal arts education transfer information transformation st johns transforming young people seekers knowledge capacity find thing theyre looking forp pstrongis st johns teaches people draw people predisposed kind learning kind approach lifestrongp pi think bothand students understand embarking education thats unconventional bookcentered tend draw students natural inclination seek books terms stepping pausing thinking questions habits purposefully form herep pcustomarily classes begin opening question students reading prepare class come usually tutor student whos tasked opening question theyll pose question comes reading simple question complex nuanced like finished reading middle section machiavellis emprinceem machiavelli suggests ends justify means rightp pthere prolonged silences youre right circumstances think students unprepared theyre processing greatest sins st johns speak thoughtful way speak heard theyre theyre trying formulate response eager speak want hear people want listen respond thatp pstrongwe performative educational culture people needing right gain affirmation authority figure classroom st johns think youre pushing deeply entrenched culture long students rhythmstrongp pby sophomore year like youre different institution freshman year tend eager tend bring habits theyve acquired ones described takes kind going knowing able quiet takes degree selfconfidence right mean speak try receive approval authority figures need assurance okay dumb smart p pstrongwhere wind leave st johnsstrongp pa significant number end graduate studies theyre going phds philosophy going sciences significant number going tech significant number going medicine business directionp pa lot students education form surprisingly sort clusters students unexpected places famous winemaker napa valley graduate st johns college people joke important schools winemakers uc davis st johns college dont think theyre wrongp figure classwpblockimageimg alt srchttpswwwaeiorgwpcontentuploads202111orrell1119graduationjpgx91208 classwpimage1008615674figcaptionvia twenty20figcaptionfigure pthere arent significant patterns looking careers learning continue happen thats trend seep pstrongi want ask pushback weve seen college bachelorlevel study education couple years dont need philosophers need plumbers need electricians need welders need people work robots factories build things react hear youre leading college youre oppositestrongp pi think theres things prompt questioning value fouryear college degree treat higher education simply instrumental makes heck lot sense try find end fouryear education expensive time consuming p pthe fault system higher education fouryear degrees essentially come 120 credit delivery systems point youre kind racking abstract thing called college credit thats attached assortment classes dont add particular half credits students general electives disconnected general education requirements oneoff classes things buffetstyle majors pathways arent clearp pthe disconnectedness higher education fact holistic approach theres sequence coursework adding greater sum parts think thats frustrating lot students think lot students feel like theyre spinning wheels taking classes checking boxesp pi think fouryear education questioned dont understand college years honest convention think way look graduate programs perfectly comfortable graduate programs having different lengths years law degree years medical specialty year years mba length programs dictated course study needs encounter bachelors degree essentially shape size dont knowp pstrongdo think isnt answer question evolve fouryear programstrongp pi think convention roughly mirroring fouryear convention high school yearsp pwe elastic sense college hang explore figure major means hone youre going expensive expensive shorten bachelor degrees single year years standard lower cost higher education 50 percent twentyfive percent simply cost fourth year tuition opportunity cost employed year added cost educationp figure classwpblockimageimg alt srchttpswwwaeiorgwpcontentuploads202111orrell1119studentsjpgx91208 classwpimage1008615668figcaptionvia twenty20figcaptionfigure pwe solve financial crisis higher education fell swoop convince accreditors system certify threeyear college degrees theyre justified mean programs example engineering maybe nursing years critical think years st johns critical use second time purposefully think seriouslyp pstrongyouve st johns years youve remarkable things youre moving id like know youre going youre trying createstrongp pive asked found new university near austin texas reason institution solve problems weve talking questions right scope higher education combines benefits liberal arts education professional life modern world try center higher education recommit principles freedom inquiry freedom expression freedom conscience model critical freedoms best canp divpstronglearn stronga hrefhttpswwwaeiorgopedsthelabormarketneedsthesoftskillsolderworkershavethe labor market needs soft skills older workers havea hrefhttpswwwaeiorgpovertystudiesbenefitscliffshighlightsfrommyconversationwithalexruderbenefits cliffs highlights conversation alex rudera hrefhttpswwwaeiorguncategorizedthefutureofremoteworkhighlightsfrommyconversationwithnicholasbloomthe future remote work highlights conversation nicholas bloomapdiv pthe post relnofollow hrefhttpswwwaeiorgeducationhighereducationwhathasannapolistodowithaustinmyconversationwithpanokaneloswhat annapolis austin conversation pano kanelosa appeared relnofollow hrefhttpswwwaeiorgamerican enterprise institute aeiap |
61982601e3c4ba27c852d0e0 | John McWhorter: 'Woke Racism' Has Betrayed Black America | div
picture
source sizesminwidth 600px 331px 100vw typeimagewebp srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202111thumbnail11jpgwebp 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202111thumbnail111200x675jpgwebp 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202111thumbnail11800x450jpgwebp 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202111thumbnail11600x338jpgwebp 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202111thumbnail11331x186jpgwebp 331w
source sizesminwidth 600px 331px 100vw typeimagejpeg srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202111thumbnail11jpg 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202111thumbnail111200x675jpg 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202111thumbnail11800x450jpg 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202111thumbnail11600x338jpg 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202111thumbnail11331x186jpg 331w
img width1200 altthumbnail 1 srchttpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202111thumbnail11800x450jpg height675
picture
div
pquotthe people who are calling themselves black people saviors dont understand this but theyre hurting black people because what theyre caught up in is more about virtue signaling to one another than helping people who actually need helpquotp
pthats emnew york timesem columnist and columbia university linguist john mcwhorter talking about his bestselling new book ia hrefhttpswwwamazoncomexecobidosasin0593423062reasonmagazinea20woke racism how a new religion has betrayed black americaai he argues that the ideas of robin diangelo ibram x kendi and the 1619 project undermine the success of black people by sharpening racial divides and distracting from actual obstacles to real progressp
phis shortlist for what would most help black america quotthere should be no war on drugs society should get behind teaching everybody to read the right way and we should make solid vocational training as easy to obtain as a college educationquotp
pemreasonsem nick gillespie spoke with the 56yearold mcwhorter about what white people get out of cooperating with an ideological agenda that casts them as devils what black people gain by quotperformingquot victimhood and what needs to change so that all americans can get on with creating a more perfect unionp
pemphoto credits photo by bp miller on unsplash tim evanszumapressnewscom eddie moorezumapressnewscom photo by devin berko on unsplash photo by matheus viana on unsplash jacquie boyd ikon imagesnewscom john marshall mantelzuma pressnewscomemp
pemmusic credit quotseductivequot by evgeny bardyuzha via artlistio emp
pemaudio production by by ian keyser intro by regan taylor emp
pthe post a relnofollow hrefhttpsreasoncomvideo20211119johnmcwhorterwokeracismhasbetrayedblackamericajohn mcwhorter woke racism has betrayed black americaa appeared first on a relnofollow hrefhttpsreasoncomreasoncomap | div picture source sizesminwidth 600px 331px 100vw typeimagewebp srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202111thumbnail11jpgwebp 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202111thumbnail111200x675jpgwebp 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202111thumbnail11800x450jpgwebp 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202111thumbnail11600x338jpgwebp 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202111thumbnail11331x186jpgwebp 331w source sizesminwidth 600px 331px 100vw typeimagejpeg srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202111thumbnail11jpg 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202111thumbnail111200x675jpg 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202111thumbnail11800x450jpg 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202111thumbnail11600x338jpg 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202111thumbnail11331x186jpg 331w img width1200 altthumbnail 1 srchttpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202111thumbnail11800x450jpg height675 picture div pquotthe people calling black people saviors dont understand theyre hurting black people theyre caught virtue signaling helping people actually need helpquotp pthats emnew york timesem columnist columbia university linguist john mcwhorter talking bestselling new book ia hrefhttpswwwamazoncomexecobidosasin0593423062reasonmagazinea20woke racism new religion betrayed black americaai argues ideas robin diangelo ibram x kendi 1619 project undermine success black people sharpening racial divides distracting actual obstacles real progressp phis shortlist help black america quotthere war drugs society teaching everybody read right way solid vocational training easy obtain college educationquotp pemreasonsem nick gillespie spoke 56yearold mcwhorter white people cooperating ideological agenda casts devils black people gain quotperformingquot victimhood needs change americans creating perfect unionp pemphoto credits photo bp miller unsplash tim evanszumapressnewscom eddie moorezumapressnewscom photo devin berko unsplash photo matheus viana unsplash jacquie boyd ikon imagesnewscom john marshall mantelzuma pressnewscomemp pemmusic credit quotseductivequot evgeny bardyuzha artlistio emp pemaudio production ian keyser intro regan taylor emp pthe post relnofollow hrefhttpsreasoncomvideo20211119johnmcwhorterwokeracismhasbetrayedblackamericajohn mcwhorter woke racism betrayed black americaa appeared relnofollow hrefhttpsreasoncomreasoncomap |
61982629e3c4ba27c852d0ea | Groomer Schools 1: The Long Cultural Marxist History of Sex Education | h4the new discourses podcast with james lindsay episode 54h4
pthrough brand names like comprehensive sex education and one of its parent programs socialemotional learning sel our government schools have been turned into groomer schools and parents are beginning to notice what many will not understand however is that this isnt just a fluke of our weird and increasingly degenerate times it is in fact a longpurposed marxist project reaching back into the early 20th century in this episode of the new discourses podcast join james lindsay as he explains the long history of the sexual grooming that has come into our schools through critical gender theory and queer theory as they have crept into educational programs if you want an explanation for how sexually explicit materials gender ideology pornography and strippers have made their way into our government schools including for young children this is a musthearp
hr
pemsubscribe to the new discourses podcast on spanspana relnoopener noreferrer hrefhttpssoundcloudcomnewdiscourses target_blanksoundcloudaspanspan spanspana relnoopener noreferrer hrefhttpspodcastsapplecomuspodcastnewdiscoursesid1499880546 target_blankapple podcastsaspanspan spanspana relnoopener noreferrer hrefhttpspodcastsgooglecomfeedahr0cdovl2zlzwrzlnnvdw5ky2xvdwquy29tl3vzzxjzl3nvdw5ky2xvdwq6dxnlcnm6nzgxmte2mzi1l3nvdw5kcy5yc3m target_blankgoogle podcastsaspanspan spanspana relnoopener noreferrer hrefhttpsopenspotifycomshow0hfzdaxi5l4lnjqstfwgzpsikd5rtswgt1epiuyrixmlgw target_blankspotifyaspanspan spanspana relnoopener noreferrer hrefhttpswwwstitchercompodcastnewdiscourses target_blankstitcheraspanspana relnoopener noreferrer hrefhttpswwwstitchercompodcastnewdiscourses target_blanka spanspana relnoopener noreferrer hrefhttpswwwyoutubecomplaylistlistpl2hruftaprxcqcbydcaullid2d9exyny target_blankyoutubeaspanspan or by spanspana relnoopener noreferrer hrefhttpsfeedssoundcloudcomuserssoundcloudusers781116325soundsrss target_blankrssaspanspanemp
pemprevious episodes of the new discourses podcast are available spanspana relnoopener hrefhttpsnewdiscoursescomtagndpodcast target_blankhereaspanspanemp
pthe post a relnofollow hrefhttpsnewdiscoursescom202111groomerschools1longculturalmarxisthistorysexeducationgroomer schools 1 the long cultural marxist history of sex educationa appeared first on a relnofollow hrefhttpsnewdiscoursescomnew discoursesap | h4the new discourses podcast james lindsay episode 54h4 pthrough brand names like comprehensive sex education parent programs socialemotional learning sel government schools turned groomer schools parents beginning notice understand isnt fluke weird increasingly degenerate times fact longpurposed marxist project reaching early 20th century episode new discourses podcast join james lindsay explains long history sexual grooming come schools critical gender theory queer theory crept educational programs want explanation sexually explicit materials gender ideology pornography strippers way government schools including young children musthearp hr pemsubscribe new discourses podcast spanspana relnoopener noreferrer hrefhttpssoundcloudcomnewdiscourses target_blanksoundcloudaspanspanspanspana relnoopener noreferrer hrefhttpspodcastsapplecomuspodcastnewdiscoursesid1499880546 target_blankapple podcastsaspanspanspanspana relnoopener noreferrer hrefhttpspodcastsgooglecomfeedahr0cdovl2zlzwrzlnnvdw5ky2xvdwquy29tl3vzzxjzl3nvdw5ky2xvdwq6dxnlcnm6nzgxmte2mzi1l3nvdw5kcy5yc3m target_blankgoogle podcastsaspanspanspanspana relnoopener noreferrer hrefhttpsopenspotifycomshow0hfzdaxi5l4lnjqstfwgzpsikd5rtswgt1epiuyrixmlgw target_blankspotifyaspanspanspanspana relnoopener noreferrer hrefhttpswwwstitchercompodcastnewdiscourses target_blankstitcheraspanspana relnoopener noreferrer hrefhttpswwwstitchercompodcastnewdiscourses target_blankaspanspana relnoopener noreferrer hrefhttpswwwyoutubecomplaylistlistpl2hruftaprxcqcbydcaullid2d9exyny target_blankyoutubeaspanspan byspanspana relnoopener noreferrer hrefhttpsfeedssoundcloudcomuserssoundcloudusers781116325soundsrss target_blankrssaspanspanemp pemprevious episodes new discourses podcast available spanspana relnoopener hrefhttpsnewdiscoursescomtagndpodcast target_blankhereaspanspanemp pthe post relnofollow hrefhttpsnewdiscoursescom202111groomerschools1longculturalmarxisthistorysexeducationgroomer schools 1 long cultural marxist history sex educationa appeared relnofollow hrefhttpsnewdiscoursescomnew discoursesap |
619826f1e3c4ba27c852d0fc | The TSA's 20th Birthday Should Be Its Last | div
picture
source sizesminwidth 600px 331px 100vw typeimagewebp srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202111dreamstime_xxl_1712308812400x1350jpgwebp 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202111dreamstime_xxl_1712308811200x675jpgwebp 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202111dreamstime_xxl_171230881800x450jpgwebp 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202111dreamstime_xxl_171230881600x338jpgwebp 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202111dreamstime_xxl_171230881331x186jpgwebp 331w
source sizesminwidth 600px 331px 100vw typeimagejpeg srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202111dreamstime_xxl_1712308812400x1350jpg 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202111dreamstime_xxl_1712308811200x675jpg 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202111dreamstime_xxl_171230881800x450jpg 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202111dreamstime_xxl_171230881600x338jpg 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202111dreamstime_xxl_171230881331x186jpg 331w
img width1200 altdreamstime_xxl_171230881 srchttpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202111dreamstime_xxl_171230881800x450jpg height675
picture
div
pexactly 20 years ago today president george w bush signed the aviation and transportation security act into law and created the transportation security administration better known as the tsa a response to the 911 attacks the tsa was thought to be a necessary tool for confronting the new reality of terror in the skiesp
ptwo decades later the tsa has more than 54000 employees a budget of 8 billion dollars and a long track record of harassing passengers for no good reason far from contributing to actual safety the tsa is a stunning example of government failure its absurd travel restrictions make air travel no safer deprive passengers of their civil liberties and make the process of flying much more costly timeconsuming inconvenient and unenjoyable the agency should never have been created and its 20th birthday is as good a time as any to abolish itp
pfor starters the tsa routinely fails at its main purpose preventing passengers from carrying deadly weapons onto airplanes tsa agents constantly miss weapons drugs and other illicit items when government agents try to smuggle them in as part of testingp
pquottsa screeners failed to detect weapons drugs and explosives a dataexternalyes hrefhttpabcnewsgocomustsafailstestslatestundercoveroperationusairportsstoryid51022188almost 80 percenta of the timequot a hrefhttpswwwheritageorgtransportationcommentaryhereshowbadthetsafailingairportsecurityitstimeprivatizationnoteda the heritage foundation in 2017 quotwhile the exact failure rate is classified a dataexternalyes hrefhttpswwwforbescomsitesmichaelgoldstein20171109tsamisses70offakeweaponsbutthatsanimprovement56f9f1972a38multiple sourcesa indicate it is greater than 70 percentquot during one test at the minneapolissaint paul international airport the tsas failure rate a hrefhttpswwwyahoocomlifestyletsaagentsminneapolisairportfailed164139315htmlwas 95 percentap
pthe 911 terror attacks in which a small number of men were able to use crude simple weapons to hijack airplanes and crash them into important buildings were a scarring moment for the nation the us government vowed to be more vigilant but the truth of the matter is that preventing hijackings is now trivially easy pilots can lock the cockpit doors which are a hrefhttpswwwthestarcomnewsworld20150326jetcockpitdoorsnearlyimpossibletoopenbyintrudershtmlalmost impossible for intruders to breacha prior to 911 most airplane hijackings involved detours to different locations hijackers did not intend to crash the planes and thus neither crews nor passengers had much reason to fight back this calculus is forever changed wouldbe plane hijackers will face insurmountable difficulties whether or not theyve received aggressive patdowns from the tsap
pmeanwhile the tsas security theater has made air travel a much more grueling process its not just the ritualistic humiliation of having to remove belts and shoes empty out backpacks and suitcases and submit to fullbody scanners tsa agents are also frequently caught a hrefhttpswwwcnncom20150413usairportluggagetheftindexhtmlstealing from passengersa a hrefhttpswwwcnncom20200211ustsagropinggroinsearchallegationindexhtmlgroping thema and delaying them for no reason again there is no point to any of this it does not make people safer if anything it makes us emless emsafe it is likely that some people choose to drive to their destination rather than deal with the hassle car travel though is emfar emmore dangerous than air travelmany more people die in car crashes than in plane crashes each year and not even covid19 could tip the scales in airplanes favor a hrefhttpswwwwashingtonpostcomopinions20210315flyingsaferthandrivingpandemicaccording to emthe washington postemap
penough is enough there is not a single good reason that americans should have to endure such misery at the hands of this utterly pointless bureaucracy the best time to abolish the tsa was right after it was created a hrefhttpsifunnycopicturethebesttimetodeletethispostwasimmediatelyafteroncmsqhi6the secondbest time is nowap
hr
h1free mindsh1
pemnew york times emcolumnist david brooks has a hrefhttpswwwtheatlanticcomideasarchive202111scaryfutureamericanrightnationalconservatismconference620746written a terrific recapa of the recent national conservatism conference in orlando florida for emthe atlanticem his article makes many of the criticisms that emreasonems stephanie slade has a hrefhttpsreasoncom20210926stealthilywieldingcaesarsswordleveleda at the rights latest a hrefhttpsreasoncom20210902jdvancesurrenderstothepoliticsofhateintellectual trendap
blockquote
pthe natcons are wrong to think there is a unified thing called quotthe leftquot that hates america this is just the apocalyptic menace many of them had to invent in order to justify their decision to vote for donald trumpp
pthey are wrong too to think there is a wokeist anschluss taking over all the institutions of american life for people who spend so much time railing about the evils of social media they sure seem to spend an awful lot of their lives on twitter ninety percent of their discourse is about the discourse anecdotalism was also rampant at the conferencegeneralizing from three anecdotes about people who got canceled to conclude that all of american life is a woke hellscape they need to get out morep
pfinally there is something extremely offputting about the natcon public pose in person as i say i find many of them charming warm and friendly but their public posture is dominated by the psychology of threat and menace if there was one expression of sympathy kindness or grace uttered from the podium in orlando i did not hear it but i did hear callousness invocations of combat and whiffs of brutalityp
psitting in that orlando hotel i found myself thinking of what i was seeing as some kind of new theme park natcon world a hermetically sealed dystopian universe with its own confected thrills and chills its own illiberal rides i tried to console myself by noting that this natcon theme park is the brainchild of a few isolated intellectuals with a screwy view of american politics and history but the disconcerting reality is that americas rarified natcon world is just one piece of a larger illiberal populist revolt that is strong and risingp
blockquote
pread the full article a hrefhttpswwwtheatlanticcomideasarchive202111scaryfutureamericanrightnationalconservatismconference620746hereap
hr
h1free marketsh1
ppresident joe biden has nominated gigi sohn an attorney and progressive foe of many conservative media organizations to serve on the federal communications commission fcc sohn previously cofounded public knowledge an advocacy group that encouraged cable providers to stop airing rightwing channels she previously called on the fcc to rescind sinclair broadcast groups broadcast license due to the channels conservative biasp
blockquote datawidth500 classtwittertweet datadnttrue
p langen dirltrthis and its lack of candor during the failed merger with tribune calls into question sinclairs fitness to be a broadcast licensee will a hrefhttpstwittercomfccref_srctwsrc5etfwfcca do anything when sinclairs licenses are up for renewal a hrefhttpstcoepnexbfxs0httpstcoepnexbfxs0ap
p gigi sohn gigibsohn a hrefhttpstwittercomgigibsohnstatus1053982573813264384ref_srctwsrc5etfwoctober 21 2018apblockquote
pp
pshe has also said that fox news is far more dangerous for democracy than facebook embreitbartems tech reporter allum bokhari described her as a quotprocensorship partisan leftistquot and a hrefhttpswwwbreitbartcomtech20211112bidenpushesprocensorshippartisanleftistgigisohnforfcccommissionerwarneda that her confirmation to the fcc would be terrible for conservative news channelsp
pbut one conservative channel disagrees specifically one america news network oann the network is quotworking behind the scenes to rally conservative support for gigi sohnquot a hrefhttpsfreebeaconcommediaconservativecablenetworkgetsbehindbidensfccnomineeaccording to emthe washington free beaconema why wellp
blockquotepconservative political operative bradley blakeman told the emwashington free beacon emthat oanns president personally arranged for him to appear in a prosohn segment on the network and that oann executives believe sohn will be an ally in the networks fight to wrest market share away from fox newsp
pthe belief is rooted in sohns criticism of fox news sohn has a relnoopener hrefhttpstwittercomgigibsohnstatus1321456221740847106s20 target_blankquestioneda whether fox news should be investigated for being quotstatesponsored propaganda with few if any opposing viewpointsquot fox news and oann compete for many of the same viewers and former president donald trump a relnoopener hrefhttpswwwwashingtonpostcommedia20201227foxnewsviewersswitchtonewsmax target_blankencourageda his voters to leave fox news for oann or rightwing outlet newsmaxp
psohn has called for the fcc to intervene in disputes between major cable companies and smaller content providers like oann in 2018 oann newsmax and sohn a relnoopener hrefhttpstwittercomgigibsohnstatus974354580111790080s20 target_blankfound themselvesa fighting on the same side against the more powerful conservative network sinclair according to blakeman oann executives believe that if confirmed sohn will support them in quotcarriage disputesquot with carriers like atampt and comcastp
poann president charles herring a relnoopener hrefhttpswwwoanncomstatementbycharlesherringpresidentofoneamericanewsnetworkendorsingtheconfirmationofgigisohnasfcccommissioner target_blankendorseda sohn in a letter last week praising her quotstrong belief and advocacy for diversity in the programming lineupquot a source with knowledge of the situation said herring is meeting with republican senators on capitol hill to advance sohns nomination he also arranged for blakeman a former adviser to george w bush to praise sohn on the airp
pin an interview that aired friday on oann blakeman noted approvingly that sohn quotdisagrees withquot cancel culture and touted her regulatory credentialspblockquote
pa conservative news network is supporting the confirmation of a progressive government bureaucrat because management believes the bureaucrat will make life even worse for its competitors so much for principlesp
hr
h1quick hitsh1
p sen rand paul rky is a hrefhttpswwwwashingtonpostcompoliticsmarijuanademocratslegalize2021111761dd37b447b311ec95dc5f2a96e00fa3_storyhtmlbegginga democrats to reform marijuana laws before the gop retakes control of congress quotif the republicans get back in charge which i think we will the bills are never going to happen because our leadership doesnt like themquotp
p vice president kamala harris communications director has a hrefhttpswwwfoxnewscompoliticskamalaharriscommsdirectorresignsgrowingcriticismvpresignedap
p the college democrats of america is collapsing amid several different cancel culture scandals one young leader has been asked to a hrefhttpswwwpoliticocomnews20211117collegedemocratsofamericadnc522864denouncea a bad tweet she sent when she was 13p
p an analysis of national science foundation grants between 1990 and 2020 found an a hrefhttpscspicenterorgreportsincreasingpoliticizationandhomogeneityinscientificfundingananalysisofnsfgrants19902020increasing leftward slantap
p quotfuturists have their heads in the cloudsquot some a hrefhttpserikhoelsubstackcompfuturistshavetheirheadsinthepredictionsa for the year 2050p
p early midterm preference for republicans has reached an alltime highp
blockquote datawidth500 classtwittertweet datadnttrue
p langen dirltrjesus christp
pstrongest preference for republicans since 1981p
pif something doesnt change soon were in for an enormous red wave in 2022 a hrefhttpstcocytexzdiocpictwittercomcytexzdiocap
p noah smith noahpinion a hrefhttpstwittercomnoahpinionstatus1461410804650053632ref_srctwsrc5etfwnovember 18 2021apblockquote
pp
pthe post a relnofollow hrefhttpsreasoncom20211119tsa20thbirthdayabolishairportsecurityterrorthe tsas 20th birthday should be its lasta appeared first on a relnofollow hrefhttpsreasoncomreasoncomap | div picture source sizesminwidth 600px 331px 100vw typeimagewebp srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202111dreamstime_xxl_1712308812400x1350jpgwebp 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202111dreamstime_xxl_1712308811200x675jpgwebp 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202111dreamstime_xxl_171230881800x450jpgwebp 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202111dreamstime_xxl_171230881600x338jpgwebp 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202111dreamstime_xxl_171230881331x186jpgwebp 331w source sizesminwidth 600px 331px 100vw typeimagejpeg srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202111dreamstime_xxl_1712308812400x1350jpg 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202111dreamstime_xxl_1712308811200x675jpg 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202111dreamstime_xxl_171230881800x450jpg 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202111dreamstime_xxl_171230881600x338jpg 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202111dreamstime_xxl_171230881331x186jpg 331w img width1200 altdreamstime_xxl_171230881 srchttpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202111dreamstime_xxl_171230881800x450jpg height675 picture div pexactly 20 years ago today president george w bush signed aviation transportation security act law created transportation security administration better known tsa response 911 attacks tsa thought necessary tool confronting new reality terror skiesp ptwo decades later tsa 54000 employees budget 8 billion dollars long track record harassing passengers good reason far contributing actual safety tsa stunning example government failure absurd travel restrictions air travel safer deprive passengers civil liberties process flying costly timeconsuming inconvenient unenjoyable agency created 20th birthday good time abolish itp pfor starters tsa routinely fails main purpose preventing passengers carrying deadly weapons airplanes tsa agents constantly miss weapons drugs illicit items government agents try smuggle testingp pquottsa screeners failed detect weapons drugs explosivesa dataexternalyes hrefhttpabcnewsgocomustsafailstestslatestundercoveroperationusairportsstoryid51022188almost 80 percenta timequot hrefhttpswwwheritageorgtransportationcommentaryhereshowbadthetsafailingairportsecurityitstimeprivatizationnoteda heritage foundation 2017 quotwhile exact failure rate classified dataexternalyes hrefhttpswwwforbescomsitesmichaelgoldstein20171109tsamisses70offakeweaponsbutthatsanimprovement56f9f1972a38multiple sourcesa indicate greater 70 percentquot test minneapolissaint paul international airport tsas failure rate hrefhttpswwwyahoocomlifestyletsaagentsminneapolisairportfailed164139315htmlwas 95 percentap pthe 911 terror attacks small number men able use crude simple weapons hijack airplanes crash important buildings scarring moment nation government vowed vigilant truth matter preventing hijackings trivially easy pilots lock cockpit doors hrefhttpswwwthestarcomnewsworld20150326jetcockpitdoorsnearlyimpossibletoopenbyintrudershtmlalmost impossible intruders breacha prior 911 airplane hijackings involved detours different locations hijackers intend crash planes crews passengers reason fight calculus forever changed wouldbe plane hijackers face insurmountable difficulties theyve received aggressive patdowns tsap pmeanwhile tsas security theater air travel grueling process ritualistic humiliation having remove belts shoes backpacks suitcases submit fullbody scanners tsa agents frequently caught hrefhttpswwwcnncom20150413usairportluggagetheftindexhtmlstealing passengersa hrefhttpswwwcnncom20200211ustsagropinggroinsearchallegationindexhtmlgroping thema delaying reason point people safer makes usemlessemsafe likely people choose drive destination deal hassle car travel emfaremmore dangerous air travelmany people die car crashes plane crashes year covid19 tip scales airplanes favor hrefhttpswwwwashingtonpostcomopinions20210315flyingsaferthandrivingpandemicaccording emthe washington postemap penough single good reason americans endure misery hands utterly pointless bureaucracy best time abolish tsa right created hrefhttpsifunnycopicturethebesttimetodeletethispostwasimmediatelyafteroncmsqhi6the secondbest time nowap hr h1free mindsh1 pemnew york timesemcolumnist david brooks hrefhttpswwwtheatlanticcomideasarchive202111scaryfutureamericanrightnationalconservatismconference620746written terrific recapa recent national conservatism conference orlando florida emthe atlanticem article makes criticisms emreasonems stephanie slade hrefhttpsreasoncom20210926stealthilywieldingcaesarsswordleveleda rights latest hrefhttpsreasoncom20210902jdvancesurrenderstothepoliticsofhateintellectual trendap blockquote pthe natcons wrong think unified thing called quotthe leftquot hates america apocalyptic menace invent order justify decision vote donald trumpp pthey wrong think wokeist anschluss taking institutions american life people spend time railing evils social media sure spend awful lot lives twitter ninety percent discourse discourse anecdotalism rampant conferencegeneralizing anecdotes people got canceled conclude american life woke hellscape need morep pfinally extremely offputting natcon public pose person find charming warm friendly public posture dominated psychology threat menace expression sympathy kindness grace uttered podium orlando hear hear callousness invocations combat whiffs brutalityp psitting orlando hotel found thinking seeing kind new theme park natcon world hermetically sealed dystopian universe confected thrills chills illiberal rides tried console noting natcon theme park brainchild isolated intellectuals screwy view american politics history disconcerting reality americas rarified natcon world piece larger illiberal populist revolt strong risingp blockquote pread article hrefhttpswwwtheatlanticcomideasarchive202111scaryfutureamericanrightnationalconservatismconference620746hereap hr h1free marketsh1 ppresident joe biden nominated gigi sohn attorney progressive foe conservative media organizations serve federal communications commission fcc sohn previously cofounded public knowledge advocacy group encouraged cable providers stop airing rightwing channels previously called fcc rescind sinclair broadcast groups broadcast license channels conservative biasp blockquote datawidth500 classtwittertweet datadnttrue p langen dirltrthis lack candor failed merger tribune calls question sinclairs fitness broadcast licensee hrefhttpstwittercomfccref_srctwsrc5etfwfcca sinclairs licenses renewal hrefhttpstcoepnexbfxs0httpstcoepnexbfxs0ap p gigi sohn gigibsohn hrefhttpstwittercomgigibsohnstatus1053982573813264384ref_srctwsrc5etfwoctober 21 2018apblockquote pp pshe said fox news far dangerous democracy facebookembreitbartems tech reporter allum bokhari described quotprocensorship partisan leftistquot hrefhttpswwwbreitbartcomtech20211112bidenpushesprocensorshippartisanleftistgigisohnforfcccommissionerwarneda confirmation fcc terrible conservative news channelsp pbut conservative channel disagrees specifically america news network oann network quotworking scenes rally conservative support gigi sohnquot hrefhttpsfreebeaconcommediaconservativecablenetworkgetsbehindbidensfccnomineeaccording toemthe washington free beaconema wellp blockquotepconservative political operative bradley blakeman told theemwashington free beaconemthat oanns president personally arranged appear prosohn segment network oann executives believe sohn ally networks fight wrest market share away fox newsp pthe belief rooted sohns criticism fox news sohn hasa relnoopener hrefhttpstwittercomgigibsohnstatus1321456221740847106s20 target_blankquestionedawhether fox news investigated quotstatesponsored propaganda opposing viewpointsquot fox news oann compete viewers president donald trumpa relnoopener hrefhttpswwwwashingtonpostcommedia20201227foxnewsviewersswitchtonewsmax target_blankencouragedahis voters leave fox news oann rightwing outlet newsmaxp psohn called fcc intervene disputes major cable companies smaller content providers like oann 2018 oann newsmax sohna relnoopener hrefhttpstwittercomgigibsohnstatus974354580111790080s20 target_blankfound themselvesafighting powerful conservative network sinclair according blakeman oann executives believe confirmed sohn support quotcarriage disputesquot carriers like atampt comcastp poann president charles herringa relnoopener hrefhttpswwwoanncomstatementbycharlesherringpresidentofoneamericanewsnetworkendorsingtheconfirmationofgigisohnasfcccommissioner target_blankendorseda sohn letter week praising quotstrong belief advocacy diversityin programming lineupquot source knowledge situation said herring meeting republican senators capitol hill advance sohns nomination arranged blakeman adviser george w bush praise sohn airp pin interview aired friday oann blakeman noted approvingly sohn quotdisagrees withquot cancel culture touted regulatory credentialspblockquote pa conservative news network supporting confirmation progressive government bureaucrat management believes bureaucrat life worse competitors principlesp hr h1quick hitsh1 psen rand paul rky hrefhttpswwwwashingtonpostcompoliticsmarijuanademocratslegalize2021111761dd37b447b311ec95dc5f2a96e00fa3_storyhtmlbegginga democrats reform marijuana laws gop retakes control congress quotif republicans charge think bills going happen leadership doesnt like themquotp pvice president kamala harris communications director hrefhttpswwwfoxnewscompoliticskamalaharriscommsdirectorresignsgrowingcriticismvpresignedap pthe college democrats america collapsing amid different cancel culture scandals young leader asked hrefhttpswwwpoliticocomnews20211117collegedemocratsofamericadnc522864denouncea bad tweet sent 13p pan analysis national science foundation grants 1990 2020 found hrefhttpscspicenterorgreportsincreasingpoliticizationandhomogeneityinscientificfundingananalysisofnsfgrants19902020increasing leftward slantap pquotfuturists heads cloudsquot hrefhttpserikhoelsubstackcompfuturistshavetheirheadsinthepredictionsa year 2050p pearly midterm preference republicans reached alltime highp blockquote datawidth500 classtwittertweet datadnttrue p langen dirltrjesus christp pstrongest preference republicans 1981p pif doesnt change soon enormous red wave 2022 hrefhttpstcocytexzdiocpictwittercomcytexzdiocap p noah smith noahpinion hrefhttpstwittercomnoahpinionstatus1461410804650053632ref_srctwsrc5etfwnovember 18 2021apblockquote pp pthe post relnofollow hrefhttpsreasoncom20211119tsa20thbirthdayabolishairportsecurityterrorthe tsas 20th birthday lasta appeared relnofollow hrefhttpsreasoncomreasoncomap |
61982740e3c4ba27c852d106 | Milton Friedman has become underrated, but is being vindicated | pthat is the topic of a relnoopener hrefhttpswwwbloombergcomopinionarticles20211118miltonfriedmanismorerelevantthaneverutm_mediumsocialutm_sourcetwittercmpid3dsocialflowtwittereconomicsutm_contenteconomicsutm_campaignsocialfloworganicsrefhtohjx5y target_blankmy latest bloomberg columna here is one excerpt of some supersimple but neglected argumentsp
blockquotepeducation is another area where friedmans ideas seem newly relevant friedman was a strong supporter of a relnoopener hrefhttpswwwbloombergcomopinionarticles20211118edchoiceorgwhoweareourlegacy target_blankschool choicea but over time the movement stalled as a variety of a relnoopener hrefhttpswwwaeaweborgarticlesid101257jel20150679 target_blankstudiesa showed scholastic gains from schoolvoucher programs that were either modest zero or negative advocates for school choice then moved on to the argument that vouchers allow parents to choose the kind of education they want for their children whether or not test scores go up that argument too went nowherep
pthen came the pandemic when millions of american parents encountered a public school system that didnt seem to care too much about educating their children schools stayed closed or offered inferior remote instruction and generally followed their own bureaucratic imperatives all of a sudden a relnoopener hrefhttpswwwcensusgovlibrarystories202103homeschoolingontheriseduringcovid19pandemichtml target_blankhome schoolinga charter schools private schools microschools in short an entire host of school choice alternatives rose in popularity it remains to be seen how much those trends will stick but friedman may yet win this intellectual battle at least partiallyp
pand its not just the bureaucracy its whats taught in the classroom consider critical race theory and other instructional practices affiliated with a relnoopener hrefhttpswwwbloombergcomopinionarticles20210919wokemovementisglobalandamericashouldbemostlyproudsrefep6bv7cs target_blankwokeisma whatever your views on this movement it seems clear that it provokes strong and perhaps irresolvable differences among parents teachers and administrators within a single public school district those matters will probably never be settled to everyones satisfaction rather than pursuing a polarizing fight to the death perhaps all sides can see that the case for school choice is stronger and more compelling than they had thoughtp
pthere are periodic a relnoopener hrefhttpswwweconliborgzacharydcartershatchetjobonmiltonfriedman target_blankattemptsa to knock milton friedman off his pedestal for the most part however his legacy remains strongp
blockquote
pand who was the guy who predicted the recent problems with the fdap
pthe post a relnofollow hrefhttpmarginalrevolutioncommarginalrevolution202111miltonfriedmanhasbecomeunderratedbutisbeingvindicatedhtmlmilton friedman has become underrated but is being vindicateda appeared first on a relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap | pthat topic relnoopener hrefhttpswwwbloombergcomopinionarticles20211118miltonfriedmanismorerelevantthaneverutm_mediumsocialutm_sourcetwittercmpid3dsocialflowtwittereconomicsutm_contenteconomicsutm_campaignsocialfloworganicsrefhtohjx5y target_blankmy latest bloomberg columna excerpt supersimple neglected argumentsp blockquotepeducation area friedmans ideas newly relevant friedman strong supporter ofa relnoopener hrefhttpswwwbloombergcomopinionarticles20211118edchoiceorgwhoweareourlegacy target_blankschool choicea time movement stalled variety ofa relnoopener hrefhttpswwwaeaweborgarticlesid101257jel20150679 target_blankstudiesashowed scholastic gains schoolvoucher programs modest zero negative advocates school choice moved argument vouchers allow parents choose kind education want children test scores argument went nowherep pthen came pandemic millions american parents encountered public school system didnt care educating children schools stayed closed offered inferior remote instruction generally followed bureaucratic imperatives suddena relnoopener hrefhttpswwwcensusgovlibrarystories202103homeschoolingontheriseduringcovid19pandemichtml target_blankhome schoolinga charter schools private schools microschools short entire host school choice alternatives rose popularity remains seen trends stick friedman win intellectual battle partiallyp pand bureaucracy whats taught classroom consider critical race theory instructional practices affiliated witha relnoopener hrefhttpswwwbloombergcomopinionarticles20210919wokemovementisglobalandamericashouldbemostlyproudsrefep6bv7cs target_blankwokeisma views movement clear provokes strong irresolvable differences parents teachers administrators single public school district matters probably settled everyones satisfaction pursuing polarizing fight death sides case school choice stronger compelling thoughtp pthere periodica relnoopener hrefhttpswwweconliborgzacharydcartershatchetjobonmiltonfriedman target_blankattemptsato knock milton friedman pedestal legacy remains strongp blockquote pand guy predicted recent problems fdap pthe post relnofollow hrefhttpmarginalrevolutioncommarginalrevolution202111miltonfriedmanhasbecomeunderratedbutisbeingvindicatedhtmlmilton friedman underrated vindicateda appeared relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap |
619827a6e3c4ba27c852d112 | I am a political journalist. But to understand this government you need psychology, not politics | pafter another chaotic week at westminster the best way to understand the dysfunction in downing street is not from the perspective of politics but through the prism of psychology despite the hours spent in number 10 discussing political strategy and the column inches devoted to parliamentary plots the truth is that the machinations at the highest levels of government could best be analysed on the therapists couch i am a political journalist so my first instinct is to look at the recent shenanigans in terms of who is up who is down and what it means for the political fortunes of boris johnson but the way to gain the greatest insight into both the government and its supporters is in fact to consider the underlying psychology p
pthis is true of the prime minister himself of course johnson is a man who according to his late mother decided at an early age that he wanted to be world king in order to make himself unhurtable invincible somehow safe from the pains of her disappearance for eight months after she was admitted to a psychiatric hospital p
pthe conservative leader wears his beliefs lightly because he is motivated more by being in power than by changing the country through policies his ambition is for himself rather than for othersp
phe knows better than most how to weaponise chaos having had dysfunction thrust upon him as a boy he now embraces it and tries to turn it to his advantage as dominic cummings claims johnson once told him i am more frightened of you having the power to stop the chaos than i am of the chaos the chaos means everyone will look to me as the man in charge it was a fascinating and revealing insight p
pthe psychological dimension goes beyond one individual however in order to grasp why things have unravelled so fast in whitehall it is also important to understand the mindset of the brexiteers the leavers still see themselves as the plucky outsiders the guerrilla revolutionaries who are trying to topple a liberal metropolitan remain establishmentp
pthis mentality explains the many misjudgments in number 10 because there is a mismatch between this selfimage and the fact that the brexiteers are now in power they are no longer tweaking the tail of the establishment they are the establishment and so the guerrilla moves look like the strongarm tactics of an overbearing statep
pwhen owen paterson was found guilty of breaking the rules johnson instinctively wanted to stand up for a member of his band of brothers against the system he crashed the car into the ditch because he thought he was trying to help the little guy stand up to a big bad bureaucratic machine when in fact he was attempting to bend the rules to fit his own party political interestp
pkwasi kwarteng the business secretary even suggested that kathryn stone the parliamentary standards commissioner should resign the extraordinary attack by a cabinet minister on an independent watchdogfor which kwarteng has since had to apologiseonly makes sense as part of a narrative of noble warriors being thwarted by an oppressive regime some conservatives had convinced themselves that stone was out to get them for political reasons a conspiracy theory for which there is absolutely no evidence and so they thought it was acceptable to brief against herp
pthere is a bizarre victim mentality at the top of an administration with an 80seat commons majority the prime minister stood by priti patel because he thought the home secretary was under attack from the blob of the civil service in written submissions to the high court this week lawyers representing the senior civil servants union the fda compared the prime minister to lewis carrolls humpty dumpty who says when i use a word it means just what i choose it to meanneither more nor lessp
blockquote classwpblockquotepinstead of being david firing pebbles from a slingshot they are goliath with all the power that comes with being in governmentpblockquote
pit appears johnson has created his own parallel universe in which it is fine to lose the independent adviser on ministerial standards alex allan but keep the cabinet minister who broke the rules because the watchdog is part of the elitep
pthe attacks on the bbc the threats to privatise channel 4 the sabrerattling at the judiciary and the attempts to bypass parliament all derive from the sense the brexiteers have that they are the freedom fighters taking on the institutional forces which really run the country they see a conspiracy around every corner when in fact they are running up against the democratic checks and balances on untrammelled powerp
pits the same mindset driving international policy the brexiteers think its acceptable to ignore international law because they are standing up for the will of the people against the overpowerful eup
ptheyve lost sight of the fact that instead of being david firing pebbles from a slingshot they are goliath with all the weight and power that comes with being in government the attempts to bend the rules crush their opponents or stamp on the institutions therefore look increasingly authoritarian rather than alternativep
pthe us against them mindset has led to many of the mistakes made by johnson and his team they think they are right and others are wrongthat the means justify the ends but the fantasy is running up against reality the prime minister and his circle are now themselves the arrogant and out of touch metropolitan elite that they think they are trying to topple p
pif psychology is as important as politics in number 10 then that is also true in the house of commons a prime minister depends on retaining the trust and confidence of his or her mps if that evaporates it is hard for a leader to cling on for long johnson has never been loved among his parliamentary colleagues but he was respected as a winneras soon as he no longer looks like one support for him will evaporate perhaps suddenly because the support is extremely shallowp
pconfidence is like a vapourit hangs in the air but is impossible to grasp an emotional rather than a rational thing it may have been the case when he was strong that as johnson put it to cummings the chaos means everyone will look to me as the man in charge but as soon as mps conclude that the chaos means he is not in fact in charge they will turn on him all politics is psychology in the endp
pthe post a relnofollow hrefhttpswwwprospectmagazinecoukpoliticsiamapoliticaljournalistbuttounderstandthisgovernmentyouneedpsychologynotpoliticsi am a political journalist but to understand this government you need psychology not politicsa appeared first on a relnofollow hrefhttpswwwprospectmagazinecoukprospect magazineap | pafter chaotic week westminster best way understand dysfunction downing street perspective politics prism psychology despite hours spent number 10 discussing political strategy column inches devoted parliamentary plots truth machinations highest levels government best analysed therapists couch political journalist instinct look recent shenanigans terms means political fortunes boris johnson way gain greatest insight government supporters fact consider underlying psychologyp pthis true prime minister course johnson man according late mother decided early age wanted world king order unhurtable invincible safe pains disappearance months admitted psychiatric hospital p pthe conservative leader wears beliefs lightly motivated power changing country policies ambition othersp phe knows better weaponise chaos having dysfunction thrust boy embraces tries turn advantage dominic cummings claims johnson told frightened having power stop chaos chaos chaos means look man charge fascinating revealing insightp pthe psychological dimension goes individual order grasp things unravelled fast whitehall important understand mindset brexiteers leavers plucky outsiders guerrilla revolutionaries trying topple liberal metropolitan remain establishmentp pthis mentality explains misjudgments number 10 mismatch selfimage fact brexiteers power longer tweaking tail establishment establishment guerrilla moves look like strongarm tactics overbearing statep pwhen owen paterson found guilty breaking rules johnson instinctively wanted stand member band brothers system crashed car ditch thought trying help little guy stand big bad bureaucratic machine fact attempting bend rules fit party political interestp pkwasi kwarteng business secretary suggested kathryn stone parliamentary standards commissioner resign extraordinary attack cabinet minister independent watchdogfor kwarteng apologiseonly makes sense narrative noble warriors thwarted oppressive regime conservatives convinced stone political reasons conspiracy theory absolutely evidence thought acceptable brief herp pthere bizarre victim mentality administration 80seat commons majority prime minister stood priti patel thought home secretary attack blob civil service written submissions high court week lawyers representing senior civil servants union fda compared prime minister lewis carrolls humpty dumpty says use word means choose meanneither lessp blockquote classwpblockquotepinstead david firing pebbles slingshot goliath power comes governmentpblockquote pit appears johnson created parallel universe fine lose independent adviser ministerial standards alex allan cabinet minister broke rules watchdog elitep pthe attacks bbc threats privatise channel 4 sabrerattling judiciary attempts bypass parliament derive sense brexiteers freedom fighters taking institutional forces run country conspiracy corner fact running democratic checks balances untrammelled powerp pits mindset driving international policy brexiteers think acceptable ignore international law standing people overpowerful eup ptheyve lost sight fact instead david firing pebbles slingshot goliath weight power comes governmentthe attempts bend rules crush opponents stamp institutions look increasingly authoritarian alternativep pthe mindset led mistakes johnson team think right wrongthat means justify ends fantasy running reality prime minister circle arrogant touch metropolitan elite think trying topple p pif psychology important politics number 10 true house commons prime minister depends retaining trust confidence mps evaporates hard leader cling long johnson loved parliamentary colleagues respected winneras soon longer looks like support evaporate suddenly support extremely shallowp pconfidence like vapourit hangs air impossible grasp emotional rational thing case strong johnson cummings chaos means look man charge soon mps conclude chaos means fact charge turn politics psychology endp pthe post relnofollow hrefhttpswwwprospectmagazinecoukpoliticsiamapoliticaljournalistbuttounderstandthisgovernmentyouneedpsychologynotpoliticsi political journalist understand government need psychology politicsa appeared relnofollow hrefhttpswwwprospectmagazinecoukprospect magazineap |
619827b6e3c4ba27c852d114 | John Cochrane, Niall Ferguson, and H.R. McMaster interview me | pa relnoopener hrefhttpswwwyoutubecomwatchvf5skuomzpkk target_blankgoodfellows podcasta from hoover and of course i interview them back a bit too crypto and ethiopia are among the topics we covera very good time was had by allp
pthe post a relnofollow hrefhttpmarginalrevolutioncommarginalrevolution202111johncochraneniallfergusonandhrmcmasterinterviewmehtmljohn cochrane niall ferguson and hr mcmaster interview mea appeared first on a relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap | pa relnoopener hrefhttpswwwyoutubecomwatchvf5skuomzpkk target_blankgoodfellows podcasta hoover course interview bit crypto ethiopia topics covera good time allp pthe post relnofollow hrefhttpmarginalrevolutioncommarginalrevolution202111johncochraneniallfergusonandhrmcmasterinterviewmehtmljohn cochrane niall ferguson hr mcmaster interview mea appeared relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap |
619827b9e3c4ba27c852d116 | Returns to lockdown in Europe are a sign of lazy 2020 thinking | p dirltrfaced with a wave of covid19 cases eu countries are reintroducing significant restrictions belgium has made workingfromhome compulsory four days per week austria has imposed a lockdown on the unvaccinated and looks set for a a relnoopener hrefhttpswwwreuterscomworldeuropeaustriancovid19caseskeeprisingprovincespreparefulllockdown20211118 datasaferedirecturlhttpswwwgooglecomurlqhttpswwwreuterscomworldeuropeaustriancovid19caseskeeprisingprovincespreparefulllockdown20211118ampsourcegmailampust1637393057023000ampusgaovvaw1bljs3wabj1whlhw7ehwo target_blankfull one in certain areasa of the country the netherlands has forced early closure of shops and restaurants and even banned spectators from attending large outdoor sporting eventsbbp
p dirltrhere we go again you might think another winter wave bringing fresh threats that if these measures dont alleviate cases fuller shutdowns could result despite having vaccines for nearly a year better testing technologies than before and new treatments policies once deemed emergency measures seem have become unnervingly routinebbp
p dirltrwhat exactly is the thinking here as i explain in my book ema relnoopener hrefhttpswwwamazoncomeconomicsonevirusintroductionreasoningdp1952223067 target_blankeconomics in one virusa emcovid19 was a thorny externality problem initially because any persons behaviour risked having extremely damaging effects on others health nobody knew who was infectious so to protect the most vulnerable and avoid the prospect of overcrowded hospitals politicians made us act as if everyone might be infected lives were saved but the costs of such crude shutdowns were huge business closures lost schooling and lost liberties clearly brought big net harms to most peoples wellbeing whether or not the value of lives saved outweighed these effects across society as a wholebbp
p dirltrnotice though the most robust argument for mandates that if wed had no lockdowns too much unnecessary death would have resulted stop the spread was at best about buying time for building more hospital capacity producing effective treatments and ultimately vaccines to mitigate the worst human costs of this disease killing people in the future as economist alex tabarrok explained at a relnoopener hrefhttpswwwcatoorgeventseconomicsoneviruswhathavewelearned datasaferedirecturlhttpswwwgooglecomurlqhttpswwwcatoorgeventseconomicsoneviruswhathavewelearnedampsourcegmailampust1637393057023000ampusgaovvaw3umxvwmq4owhpeewakiirv titlehttpswwwcatoorgeventseconomicsoneviruswhathavewelearned target_blanka cato event in aprila as a precautionary measure in spring 2020 or when vaccines were imminent such extreme measures to save lives were most defensible they are far less sensible as an ongoing tool for managing the pandemicbbp
p dirltrhow on earth then are such restrictive measures back on the agenda today its clear covid19 is here to stay with a more transmissible variant cases might rise very acutely in winter months of normal behaviour even though vaccines do mitigate the risk of symptomatic disease but what the vaccines are particularly good at is reducing the risk of hospitalisation and death theres still an externality risk but the worst costs have been severely dented and to put it bluntly personalised the best thing anyone can do to mitigate their own risk is get vaccinated or boosted if they dont the biggest risks fall primarily on themselves so long as others have the possibility of vaccination toobbp
p dirltrcovid19 for the vaccinated now appears to produce death risks similar in magnitude to seasonal flu whereas in a susceptible population it was thought to have an infection fatality rate perhaps a relnoopener hrefhttpswwwcovidfaqcoclaimitsonlyasdeadlyastheflu024fc5546bc14806a4f402c9ee28316c datasaferedirecturlhttpswwwgooglecomurlqhttpswwwcovidfaqcoclaimitsonlyasdeadlyastheflu024fc5546bc14806a4f402c9ee28316campsourcegmailampust1637393057023000ampusgaovvaw3azgatrgmtygpokzp61rwn target_blank14 times highera yet the us a relnoopener hrefhttpscovidcdcgovcoviddatatrackerratesbyvaccinestatus datasaferedirecturlhttpswwwgooglecomurlqhttpscovidcdcgovcoviddatatracker23ratesbyvaccinestatusampsourcegmailampust1637393057023000ampusgaovvaw0wveovhrhzbyuup1nwt1l target_blankcdc now saysa the unvaccinated are 61 times more likely to catch covid19 and 113 times more likely to die than the vaccinated a relnoopener hrefhttpswwwgovukgovernmentpublicationscovid19vaccineweeklysurveillancereports datasaferedirecturlhttpswwwgooglecomurlqhttpswwwgovukgovernmentpublicationscovid19vaccineweeklysurveillancereportsampsourcegmailampust1637393057023000ampusgaovvaw31bdnxfovdj6ggvwh0faua target_blankthe uk governmenta likewise believes its vaccines are 6590 effective against symptomatic disease and that even among known cases in the oldest age groups after this protection has been breached death rates for the unvaccinated are almost three times higherbbp
p dirltrgiven we dont impose lockdowns for these flu risks then why are governments contemplating such restrictions in heavily vaccinated populations the netherlands has a relnoopener hrefhttpscoronadashboardgovernmentnllandelijkvaccinaties datasaferedirecturlhttpswwwgooglecomurlqhttpscoronadashboardgovernmentnllandelijkvaccinatiesampsourcegmailampust1637393057023000ampusgaovvaw35be5jcitwwe09ghqqmadq target_blankvaccinated 85 of adultsa and the figure a relnoopener hrefhttpscovidvaccinatiebeeninteractivedashboardregion5bbrussels5d1region5bflanders5d1region5bostbelgien5d1region5bwallonia5d1age5b18345d1age5b35445d1age5b45545d1age5b55645d1age5b65745d1age5b75845d1age5b852b5d1gender5bm5d1gender5bf5d1end20211117 datasaferedirecturlhttpswwwgooglecomurlqhttpscovidvaccinatiebeeninteractivedashboardregion255bbrussels255d3d126region255bflanders255d3d126region255bostbelgien255d3d126region255bwallonia255d3d126age255b1834255d3d126age255b3544255d3d126age255b4554255d3d126age255b5564255d3d126age255b6574255d3d126age255b7584255d3d126age255b85252b255d3d126gender255bm255d3d126gender255bf255d3d126end3d20211117ampsourcegmailampust1637393057023000ampusgaovvaw3spegpmm3qfdwo0apw0ce0 target_blankis higher still in belgiumabbp
p dirltrone argument is that with modest proportions of populations still unvaccinated a very large outbreak will still cause needless illness and high numbers of unnecessary deaths yet this raises an impolitic question what burdens in the form of coercive mandates and indefinite suspensions of normal life should large groups bear to protect the unvaccinated the overly neurotic very lowrisk children or the much smaller proportion of the population left immunocompromised or unable to get vaccinations bbp
aside
h1get more from capxh1
ul
li
a hrefhttpstwittercomcapx target_blankiifollow us on twittera
li
li
a hrefhttpswwwfacebookcomcapxco target_blankiijoin us on facebooka
li
li
a hrefhttpswwwcapxcosubscribe target_blankiisign up to our email bulletinsa
li
li
a hrefhttpsitunesapplecomgbpodcastcapxpresentsfreeexchangeid1220313938 target_blankiisubscribe to free exchange the capx podcasta
li
ul
aside
p dirltrthe unvaccinated can get vaccinated and front the consequences of not taking the shots pandering to the neurotic offers no path to normality and intolerable costs kids surely stand to suffer more on average from ongoing life disruption given their risks of death are tiny those still at severe risk are most deserving of some protection but in a vaccinated world are more identifiable and smaller in number indeed vaccines make genuine focused protection of the most immunocompromised and vulnerable more achievable whatever you thought about it last year that approach of protecting care homes and those at highest risk is surely more costeffective todaybbp
p dirltra second argument is that absent new restrictions hospitals still risk being overwhelmed with another big surge if true though this is a shocking indictment of government planning covid19 has now been with us for nearly 20 months the more highly transmissible delta variant has been known for almost a year that seems plenty of time to have built or at least adjusted facilities beefed up icu capacity and expanded hospital staffing to manage them are our continental neighbours expected to live partial lives each winter because of this gross mismanagementbbp
p dirltrin reaction to the baffling dutch measures its football federation and top two professional leagues described the new restrictions as policy poverty its difficult to disagree just as europe failed to learn quickly the east asian lessons last year about lower cost ways to reduce risks it has failed to adjust its thinking about when to intervene to the new context today and so we get the lazy 2020 playbook of shutting things down on repeatp
pemstronga relnoopener hrefhttpscapxcosubscribe datasaferedirecturlhttpswwwgooglecomurlqhttpscapxcosubscribeampsourcegmailampust1637351555676000ampusgaovvaw2od_pxiwupdnqx_dmp9g6d target_blankclick here to subscribe to our daily briefingastrong the best pieces from capx and across the webemp
pemcapx depends on the generosity of its readers if you value what we do please consider making a donationemp
div
div
divdiv
div
div
pthe post a relnofollow hrefhttpscapxcoreturnstolockdownineuropeareasignoflazy2020thinkingreturns to lockdown in europe are a sign of lazy 2020 thinkinga appeared first on a relnofollow hrefhttpscapxcocapxap | p dirltrfaced wave covid19 cases eu countries reintroducing significant restrictions belgium workingfromhome compulsory days week austria imposed lockdown unvaccinated looks set relnoopener hrefhttpswwwreuterscomworldeuropeaustriancovid19caseskeeprisingprovincespreparefulllockdown20211118 datasaferedirecturlhttpswwwgooglecomurlqhttpswwwreuterscomworldeuropeaustriancovid19caseskeeprisingprovincespreparefulllockdown20211118ampsourcegmailampust1637393057023000ampusgaovvaw1bljs3wabj1whlhw7ehwo target_blankfull certain areasaof country netherlands forced early closure shops restaurants banned spectators attending large outdoor sporting eventsbbp p dirltrhere think winter wave bringing fresh threats measures dont alleviate cases fuller shutdowns result despite having vaccines nearly year better testing technologies new treatments policies deemed emergency measures unnervingly routinebbp p dirltrwhat exactly thinking explain book ema relnoopener hrefhttpswwwamazoncomeconomicsonevirusintroductionreasoningdp1952223067 target_blankeconomics virusa emcovid19 thorny externality probleminitially persons behaviour risked having extremely damaging effects health knew infectious protect vulnerable avoid prospect overcrowded hospitals politicians act infected lives saved costs crude shutdowns huge business closures lost schooling lost liberties clearly brought big net harms peoples wellbeing value lives saved outweighed effects society wholebbp p dirltrnotice robust argument mandates wed lockdowns unnecessary death resulted stop spread best buying time building hospital capacity producing effective treatments ultimately vaccines mitigate worst human costs disease killing people future economist alex tabarrok explained relnoopener hrefhttpswwwcatoorgeventseconomicsoneviruswhathavewelearned datasaferedirecturlhttpswwwgooglecomurlqhttpswwwcatoorgeventseconomicsoneviruswhathavewelearnedampsourcegmailampust1637393057023000ampusgaovvaw3umxvwmq4owhpeewakiirv titlehttpswwwcatoorgeventseconomicsoneviruswhathavewelearned target_blanka cato event aprila precautionary measure spring 2020 vaccines imminent extreme measures save lives defensible far sensible ongoing tool managing pandemicbbp p dirltrhow earth restrictive measures agenda today clear covid19 stay transmissible variant cases rise acutely winter months normal behaviour vaccines mitigate risk symptomatic disease vaccines particularly good reducing risk hospitalisation death theres externality risk worst costs severely dented bluntly personalised best thing mitigate risk vaccinated boosted dont biggest risks fall primarily long possibility vaccination toobbp p dirltrcovid19 vaccinated appears produce death risks similar magnitude seasonal flu susceptible population thought infection fatality rate relnoopener hrefhttpswwwcovidfaqcoclaimitsonlyasdeadlyastheflu024fc5546bc14806a4f402c9ee28316c datasaferedirecturlhttpswwwgooglecomurlqhttpswwwcovidfaqcoclaimitsonlyasdeadlyastheflu024fc5546bc14806a4f402c9ee28316campsourcegmailampust1637393057023000ampusgaovvaw3azgatrgmtygpokzp61rwn target_blank14 times highera relnoopener hrefhttpscovidcdcgovcoviddatatrackerratesbyvaccinestatus datasaferedirecturlhttpswwwgooglecomurlqhttpscovidcdcgovcoviddatatracker23ratesbyvaccinestatusampsourcegmailampust1637393057023000ampusgaovvaw0wveovhrhzbyuup1nwt1l target_blankcdc saysa unvaccinated 61 times likely catch covid19 113 times likely die vaccinated relnoopener hrefhttpswwwgovukgovernmentpublicationscovid19vaccineweeklysurveillancereports datasaferedirecturlhttpswwwgooglecomurlqhttpswwwgovukgovernmentpublicationscovid19vaccineweeklysurveillancereportsampsourcegmailampust1637393057023000ampusgaovvaw31bdnxfovdj6ggvwh0faua target_blankthe uk governmenta likewise believes vaccines 6590 effective symptomatic disease known cases oldest age groups protection breached death rates unvaccinated times higherbbp p dirltrgiven dont impose lockdowns flu risks governments contemplating restrictions heavily vaccinated populations netherlands relnoopener hrefhttpscoronadashboardgovernmentnllandelijkvaccinaties datasaferedirecturlhttpswwwgooglecomurlqhttpscoronadashboardgovernmentnllandelijkvaccinatiesampsourcegmailampust1637393057023000ampusgaovvaw35be5jcitwwe09ghqqmadq target_blankvaccinated 85 adultsa figure relnoopener hrefhttpscovidvaccinatiebeeninteractivedashboardregion5bbrussels5d1region5bflanders5d1region5bostbelgien5d1region5bwallonia5d1age5b18345d1age5b35445d1age5b45545d1age5b55645d1age5b65745d1age5b75845d1age5b852b5d1gender5bm5d1gender5bf5d1end20211117 datasaferedirecturlhttpswwwgooglecomurlqhttpscovidvaccinatiebeeninteractivedashboardregion255bbrussels255d3d126region255bflanders255d3d126region255bostbelgien255d3d126region255bwallonia255d3d126age255b1834255d3d126age255b3544255d3d126age255b4554255d3d126age255b5564255d3d126age255b6574255d3d126age255b7584255d3d126age255b85252b255d3d126gender255bm255d3d126gender255bf255d3d126end3d20211117ampsourcegmailampust1637393057023000ampusgaovvaw3spegpmm3qfdwo0apw0ce0 target_blankis higher belgiumabbp p dirltrone argument modest proportions populations unvaccinated large outbreak cause needless illness high numbers unnecessary deaths raises impolitic question burdens form coercive mandates indefinite suspensions normal life large groups bear protect unvaccinated overly neurotic lowrisk children smaller proportion population left immunocompromised unable vaccinationsbbp aside h1get capxh1 ul li hrefhttpstwittercomcapx target_blankiifollow twittera li li hrefhttpswwwfacebookcomcapxco target_blankiijoin facebooka li li hrefhttpswwwcapxcosubscribe target_blankiisign email bulletinsa li li hrefhttpsitunesapplecomgbpodcastcapxpresentsfreeexchangeid1220313938 target_blankiisubscribe free exchange capx podcasta li ul aside p dirltrthe unvaccinated vaccinated consequences taking shots pandering neurotic offers path normality intolerable costs kids surely stand suffer average ongoing life disruption given risks death tiny severe risk deserving protection vaccinated world identifiable smaller number vaccines genuine focused protection immunocompromised vulnerable achievable thought year approach protecting care homes highest risk surely costeffective todaybbp p dirltra second argument absent new restrictions hospitals risk overwhelmed big surge true shocking indictment government planning covid19 nearly 20 months highly transmissible delta variant known year plenty time built adjusted facilities beefed icu capacity expanded hospital staffing manage continental neighbours expected live partial lives winter gross mismanagementbbp p dirltrin reaction baffling dutch measures football federation professional leagues described new restrictions policy poverty difficult disagree europe failed learn quickly east asian lessons year lower cost ways reduce risks failed adjust thinking intervene new context today lazy 2020 playbook shutting things repeatp pemstronga relnoopener hrefhttpscapxcosubscribe datasaferedirecturlhttpswwwgooglecomurlqhttpscapxcosubscribeampsourcegmailampust1637351555676000ampusgaovvaw2od_pxiwupdnqx_dmp9g6d target_blankclick subscribe daily briefingastrong best pieces capx webemp pemcapx depends generosity readers value consider making donationemp div div divdiv div div pthe post relnofollow hrefhttpscapxcoreturnstolockdownineuropeareasignoflazy2020thinkingreturns lockdown europe sign lazy 2020 thinkinga appeared relnofollow hrefhttpscapxcocapxap |
619827d3e3c4ba27c852d11a | Oops…. | blockquote
pthe biden administration a hrefhttpswwwnytimescom20211111businesseconomybideninflationhtmlactionclickmodulewellpgtypehomepagesectionbusiness titlehas rebrandeda its build back better plan as part of a strategy to fight inflation by subsidizing essential services like child care the argument goes american families and the broader economy will experience relief from the rapidly rising cost of livingp
pyet something doesnt add up consider that the current proposal would also dramatically shift the cost structure of child care upward with regulations mandating higher salaries greater credentials and compliance with federal quality standards having made child care more expensive it then proposes socializing over 90 percent of the cost for a subset of middle and lowerincome households this wont reduce rising prices so much as mask them and with informal child care providers a hrefhttpswwwnytimescom20211114uspoliticsreligiousgroupschildcarehtml titleincluding religious organizationsa at risk of being crowdedout the true availability of lowcost child care could even contractp
pthis is an extreme example of what we call a relnoopener noreferrer hrefhttpswwwniskanencenterorgcostdiseasesocialismhowsubsidizingcostswhilerestrictingsupplydrivesamericasfiscalimbalance title target_blankcost disease socialisma addressing the increasing costs of supplyconstrained goods and services by spreading the price among american taxpayers while leaving the cause of the underlying costs unaddressedp
blockquote
pthat is from a relnoopener hrefhttpswwwnytimescom20211118opiniondemocratsbuildbackbetterregulationshtml target_blankan excellent piecea by sam hammond daniel takash and steve teles nytp
pthe post a relnofollow hrefhttpmarginalrevolutioncommarginalrevolution202111oops2htmloopsa appeared first on a relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap | blockquote pthe biden administration hrefhttpswwwnytimescom20211111businesseconomybideninflationhtmlactionclickmodulewellpgtypehomepagesectionbusiness titlehas rebrandeda build better plan strategy fight inflation subsidizing essential services like child care argument goes american families broader economy experience relief rapidly rising cost livingp pyet doesnt add consider current proposal dramatically shift cost structure child care upward regulations mandating higher salaries greater credentials compliance federal quality standards having child care expensive proposes socializing 90 percent cost subset middle lowerincome households wont reduce rising prices mask informal child care providers hrefhttpswwwnytimescom20211114uspoliticsreligiousgroupschildcarehtml titleincluding religious organizationsa risk crowdedout true availability lowcost child care contractp pthis extreme example relnoopener noreferrer hrefhttpswwwniskanencenterorgcostdiseasesocialismhowsubsidizingcostswhilerestrictingsupplydrivesamericasfiscalimbalance title target_blankcost disease socialisma addressing increasing costs supplyconstrained goods services spreading price american taxpayers leaving cause underlying costs unaddressedp blockquote pthat relnoopener hrefhttpswwwnytimescom20211118opiniondemocratsbuildbackbetterregulationshtml target_blankan excellent piecea sam hammond daniel takash steve teles nytp pthe post relnofollow hrefhttpmarginalrevolutioncommarginalrevolution202111oops2htmloopsa appeared relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap |
61982829e3c4ba27c852d122 | There’s nothing woke about crypto | pwho would have thought information technology could kill millions but between 1618 and 1648 thats exactly what happenedp
pits estimated that a relnoopener hrefhttpsblogsicrcorglawandpolicy20170523thirtyyearswarfirstmodernwar target_blankabout 20a of the population of europe died in the thirty years war the culmination of some 150 years of religious conflict triggered by the protestant reformation and the reformation was in turn a relnoopener hrefhttpswwwcrfusaorgbillofrightsinactionbria243bgutenbergandtheprintingrevolutionineurope target_blankpowereda by a radical new means of disseminating information the printing pressp
phistory doesnt repeat itself but as mark twain said it does rhyme its not original to suggest that the internet is as transformative as the printing press less library in your pocket and more as david bowie a relnoopener hrefhttpswwwgoldradioukcomartistsdavidbowiepredictsfutureofinternetvideo1999 target_blankput ita in 1999 an alien life form but less often asked is if revolutionising how we view store exchange and crossreference our knowledge set off violent religious convulsions 500 years ago that a relnoopener hrefhttpswwwhistorycomthisdayinhistorythirtyyearswarends target_blankrewrote the political map of europea how long before the internet does the same thingp
pthe usual response to this suggestion tends to be wild gesturing at the nowcommon a relnoopener hrefhttpswwwnationalaffairscompublicationsdetailwokenessandthenewreligiousestablishment target_blankwokeness is a religiona take accompanied by well look its happeningp
divdiv
pbut this has it backwards wokeness isnt an upstart faith its a secularised a relnoopener hrefhttpsthecriticcoukwokeismislatterdaypuritanism target_blankmutant form of the protestantisma that began with luther its the creed of our current elite establishment with nearhegemonic power and its subject to many of the same critiques as the thenhegemonic catholic church was in luthers time down to a relnoopener hrefhttpsnymagcomintelligencer201701guiltywhiteliberalsarepurchasingracialindulgenceshtml target_blankthe selling of indulgencesa in this story wokeness isnt the schism its the established churchp
pfor schismatics look to a hrefhttpsunherdcom202111theamericanrightscivilwarthe emerging coalitiona of dissenters from woke hegemony and if this coalition increasingly replaces the right in covidera politics its most actionoriented and potentially disruptive faction is also perhaps the least wellunderstood the crypto brosp
poften fiercely antiwoke this loosely rightaligned subculture blends tech futurism with a desire to preserve elements of the past and sometimes unsettlingly strong views on facets of human nature they see as immutable and hence not amenable to progressive social engineeringp
pthe mainstream right mostly doesnt really know what to make of this faction and largely ignores them meanwhile theyre busy building and what theyre building has the potential to transform not just the internet but our most fundamental political structures as dramatically as the reformation and its aftermathp
pthinking of the reformation as a religious schism driven partly by new information technology isnt to trivialise it the shift in mindset it drove was so radical it pushed some to opt out altogether from a regime they found intolerable and one form this took was the puritans leaving europe for americap
pthe political scientist albert hirschman a relnoopener hrefhttpwwwhupharvardeducatalogphpisbn9780674276604contentreviews target_blankarguesa that for this historical reason optingout or exit has an extraordinarily privileged position in the american traditionp
diva hrefhttpsunherdcom202111theamericanrightscivilwarrefinnara hrefhttpsunherdcom202111theamericanrightscivilwarrefinnarimg srchttpsunherdcomwpcontentuploads2021112gettyimages1210373372scalede1636131367730300x182jpgadiva hrefhttpsunherdcom202111theamericanrightscivilwarrefinnarspanmore from this authorspanaa hrefhttpsunherdcom202111theamericanrightscivilwarrefinnarh5the american rights civil warh5apa hrefhttpsunherdcom202111theamericanrightscivilwarrefinnarspanbyspan mary harringtonapdivadiv
phirschmans influential book a relnoopener hrefhttpswwwhupharvardeducatalogphpisbn9780674276604 target_blankemexit voice and loyaltyema looks at what happens when things start to go wrong in an organisation or polity as he sees it citizens can choose to remain loyal to exercise their voice ie protest or to exit and as hirschman points out americas origin story has contributed to an especially robust american political tradition of people voting with their feet when they dont like how things are goingp
pthose a relnoopener hrefhttpswwwexitgroupus target_blanktalking about exit todaya in america arent the modernday puritans but their opponents many prominent figures associated with the subculture ill call the exit right are determinedly anonymous of those who write or speak under their own name one key thinker is the neoreactionary writer a relnoopener hrefhttpswwwunqualifiedreservationsorg target_blankcurtis yarvina yarvins a relnoopener hrefhttpsjournalssagepubcomdoipdf1011770263276421999439 target_blankpatchwork theorya offers a model for what exit might look like he argues that nationstates should be replaced by proliferating competing autocratic citystates each with its own ceo in effect this would then institute a market for governance in which citizens could exit for a different polity if an existing one didnt suitp
pbut perhaps its most wellknown powerhouse is peter thiel thiel is influenced by libertarian individualism and aversion to big government but he doesnt just dislike the current woke kind he seems averse to all largescale political systems in a 2009 a relnoopener hrefhttpswwwcatounboundorg20090413peterthieleducationlibertarian target_blankessaya published at the libertarian cato institute thiel took aim at totalitarian and fundamentalist politics alike and also the unthinking demos that powers socalled social democracyp
pa relnoopener hrefhttpsnationalconservatismorgnatcon22021presenterspeterthiel target_blankthiels natcon addressa took aim at institutional wokeness but also the fundamental structures of web 20 that power this creed he denounced the way a relnoopener hrefhttpswwwpenguinrandomhousecombooks175380thewisdomofcrowdsbyjamessurowiecki target_blankthe wisdom of crowdsa has shaded into a relnoopener hrefhttpswwwbloomsburycomusmadnessofcrowds9781635579987 target_blankthe madness of crowdsa he railed against the epistemic closure around approved scientific consensus and fiat currency warning against a globalist future in which individuals will not exist he hinted at his preferred solution to this predicament when he went on to say his biggest regret was not buying enough crypto while it was cheap and he called for satoshi nakamoto the pseudonymous inventor of the bitcoin protocol to be lauded with a tickertape paradep
diva hrefhttpsunherdcom202110britainisbecomingmorecruelrefinnara hrefhttpsunherdcom202110britainisbecomingmorecruelrefinnarimg srchttpsunherdcomwpcontentuploads2021102gettyimages481683581scaled1300x200jpgadiva hrefhttpsunherdcom202110britainisbecomingmorecruelrefinnarspanmore from this authorspanaa hrefhttpsunherdcom202110britainisbecomingmorecruelrefinnarh5the death of britains dignityh5apa hrefhttpsunherdcom202110britainisbecomingmorecruelrefinnarspanbyspan mary harringtonapdivadiv
pmany looked baffled but for the tech bros talking about political models and talking about tech models is the same conversation because the one enables the other and when even a sitting president is a relnoopener hrefhttpstechcrunchcom20210109thedeplatformingofapresidentguccounter1guce_referrerahr0chm6ly93d3cuz29vz2xllmnvbs8guce_referrer_sigaqaaamtqtfeg46aq05im4q_kokixnzfgnnhbzjwjfki58arj265odpuejpp36kiv8q6pbbmtkl_j5u5rcsptxqvmaksez6tqfrfgzxda9adxykxxebfwwlszc0cykwga6cyw58kk8ob91ymrivtuiacotz73umysanib6yfclxzk target_blankvulnerable to deplatforminga if they fall foul of consensus on proper behaviour perhaps they have a pointp
pits not just about freedom of speech or association because as the exit right sees it the problems inherent in big centralised tech infrastructures are also there in big centralised and increasingly big techenabled financial infrastructures and the a relnoopener hrefhttpswwwinvestopediacomtermsffiatmoneyasp target_blankfiat currenciesa they use the exit right argues that the only way to protect any measure of freedom for dissenters is to abandon fiat currency altogether in favour of cryptop
pmeanwhile the stories keep coming about tech converging with government a relnoopener hrefhttpswwwforbescomsitesthomasbrewster20211004googlekeywordwarrantsgiveusgovernmentdataonsearchuserssh2daeed097c97 target_blankgoogle passing search histories to the governmenta for example or a relnoopener hrefhttpswwwftcomcontent74782def10464ea5b7960802cfb90260 target_blankamazon hosting uk spy agencies dataa with every story the drumbeat grows louder from the exit right to escape the convergence of government and big tech for salvation in the decentralising power of the blockchainp
pthe tech bros a relnoopener hrefhttpstwittercomrdnxyzstatus1460744024457895942s21 target_blanksuggesta the mainstream right merely carps about wokeness from the sidelines while assenting to every framework that gives this brittle badfaith faith its realworld power notably finance and the overcentralised internetp
ptheir proposed solution is leaning into new tech to escape an increasingly totalitarian present tech the theorist james poulos argues in the forthcoming a relnoopener hrefhttpshumanforeverus target_blankemhuman foreverema that the only way out of this bind is to embrace decentralised tech and create parallel institutions and secure robust networks of mature and culturally healthy people online and offp
pthis means building thiel is a prolific funder of projects in the exit right ecosystem yarvin hasnt just contributed dissenting theory but also dissenting tech he was a founding developer of a relnoopener hrefhttpsurbitorg target_blankurbita which aims to replace the centralised big tech model with a peertopeer network of web services in which identities and data are always owned by the user and not by big tech urbit was a relnoopener hrefhttpswwwthevergecom201722114671978altrightmenciusmoldbugurbitcurtisyarvintlon target_blankpartfunded by thielap
panother example is a relnoopener hrefhttpsnewfoundingcom target_blanknew foundinga which aims to connect dissident conservative american individuals and businesses with new media technology and commerce that serves and supports the american people poulos also practises what he preaches his book will launch initially as an nft on a relnoopener hrefhttpscanonicxyz target_blankcanonica a blockchainbased selfpublishing platform that sells books denominated in bitcoin and also recently a relnoopener hrefhttpscanonicxyzbooks1alanpz69xpefhbhfkwcdanympabrsl62olimited target_blankpublisheda zero hp lovecraftp
diva hrefhttpsunherdcom202109thecryptorevolutionhasfailedrefinnara hrefhttpsunherdcom202109thecryptorevolutionhasfailedrefinnarimg srchttpsunherdcomwpcontentuploads202109gettyimages1230577642scalede16305994102881300x183jpgadiva hrefhttpsunherdcom202109thecryptorevolutionhasfailedrefinnarspanmore from this authorspanaa hrefhttpsunherdcom202109thecryptorevolutionhasfailedrefinnarh5the crypto revolution is failingh5apa hrefhttpsunherdcom202109thecryptorevolutionhasfailedrefinnarspanbyspan greg barkerapdivadiv
pif the internet does drive serious worldshattering schisms my moneys not on wokeness as their source its on these decentralising visionaries because for all that many of them see their task as freeing the world of big techs now rapidlyconsolidating woke priesthood their own tech vision will in turn inevitably develop its own priest class or rather priest emclassesem pluralp
pright now the exit right is a heavily maledominated almost exclusively nerdonly subculture full of exceptionally clever techies a group that to a man wildly underestimates the ability or willingness of normal people to get their heads around tech innovations but in order to go mainstream the tech that powers the exit rights vision will need explaining for nonnerds and that means roping in writers in other words arts graduates people with the right mindset to simplify prettify explain and popularisep
pbut as well as bringing an ability to explain when you get arts graduates involved theyre guaranteed to bring their moral viewpoints with them arguably a key reason why tech is currently so creepily uniform in moral outlook is because its heavily centralised and its explainers and popularisers its priest class are recruited mostly from a small set of elite american universities with a fairly homogenous worldviewp
ppeter thiel and the exit right argue that the only way to give teeth to the emerging antiwoke consensus is to decentralise finance tech and even governance but popularising this wont create one new priest class instead every exiting faction will need its own if they succeed the upshot wont be liberation from techadjacent priesthoods but competition between moral outlooksp
pand a measure of their success will be that this happens not in an otherwise neutral unified marketplace of ideas itll happen in a world where each competing worldview potentially has its own infrastructures currencies and perhaps even citystates lets hope they can all get along because zerosum disagreement between moral worldviews with their own infrastructures has a name just like the last time our information technology changed this radically think culture war but without the prefixp
pthere may come a time when even those of us who dislike our current stifling woke hegemony look back on it with nostalgia as the lastditch effort of a fading age to save us from the oncoming stormp
a hrefhttpsunherdcom202111theresnothingwokeaboutcryptoappcommentsview 12 commentsa | pwho thought information technology kill millions 1618 1648 thats exactly happenedp pits estimated relnoopener hrefhttpsblogsicrcorglawandpolicy20170523thirtyyearswarfirstmodernwar target_blankabout 20a population europe died thirty years war culmination 150 years religious conflict triggered protestant reformation reformation turn relnoopener hrefhttpswwwcrfusaorgbillofrightsinactionbria243bgutenbergandtheprintingrevolutionineurope target_blankpowereda radical new means disseminating information printing pressp phistory doesnt repeat mark twain said rhyme original suggest internet transformative printing press library pocket david bowie relnoopener hrefhttpswwwgoldradioukcomartistsdavidbowiepredictsfutureofinternetvideo1999 target_blankput ita 1999 alien life form asked revolutionising view store exchange crossreference knowledge set violent religious convulsions 500 years ago relnoopener hrefhttpswwwhistorycomthisdayinhistorythirtyyearswarends target_blankrewrote political map europea long internet thingp pthe usual response suggestion tends wild gesturing nowcommon relnoopener hrefhttpswwwnationalaffairscompublicationsdetailwokenessandthenewreligiousestablishment target_blankwokeness religiona accompanied look happeningp divdiv pbut backwards wokeness isnt upstart faith secularised relnoopener hrefhttpsthecriticcoukwokeismislatterdaypuritanism target_blankmutant form protestantisma began luther creed current elite establishment nearhegemonic power subject critiques thenhegemonic catholic church luthers time relnoopener hrefhttpsnymagcomintelligencer201701guiltywhiteliberalsarepurchasingracialindulgenceshtml target_blankthe selling indulgencesa story wokeness isnt schism established churchp pfor schismatics look hrefhttpsunherdcom202111theamericanrightscivilwarthe emerging coalitiona dissenters woke hegemony coalition increasingly replaces right covidera politics actionoriented potentially disruptive faction wellunderstood crypto brosp poften fiercely antiwoke loosely rightaligned subculture blends tech futurism desire preserve elements past unsettlingly strong views facets human nature immutable amenable progressive social engineeringp pthe mainstream right doesnt know faction largely ignores theyre busy building theyre building potential transform internet fundamental political structures dramatically reformation aftermathp pthinking reformation religious schism driven partly new information technology isnt trivialise shift mindset drove radical pushed opt altogether regime found intolerable form took puritans leaving europe americap pthe political scientist albert hirschman relnoopener hrefhttpwwwhupharvardeducatalogphpisbn9780674276604contentreviews target_blankarguesa historical reason optingout exit extraordinarily privileged position american traditionp diva hrefhttpsunherdcom202111theamericanrightscivilwarrefinnara hrefhttpsunherdcom202111theamericanrightscivilwarrefinnarimg srchttpsunherdcomwpcontentuploads2021112gettyimages1210373372scalede1636131367730300x182jpgadiva hrefhttpsunherdcom202111theamericanrightscivilwarrefinnarspanmore authorspanaa hrefhttpsunherdcom202111theamericanrightscivilwarrefinnarh5the american rights civil warh5apa hrefhttpsunherdcom202111theamericanrightscivilwarrefinnarspanbyspan mary harringtonapdivadiv phirschmans influential book relnoopener hrefhttpswwwhupharvardeducatalogphpisbn9780674276604 target_blankemexit voice loyaltyema looks happens things start wrong organisation polity sees citizens choose remain loyal exercise voice ie protest exit hirschman points americas origin story contributed especially robust american political tradition people voting feet dont like things goingp pthose relnoopener hrefhttpswwwexitgroupus target_blanktalking exit todaya america arent modernday puritans opponents prominent figures associated subculture ill exit right determinedly anonymous write speak key thinker neoreactionary writer relnoopener hrefhttpswwwunqualifiedreservationsorg target_blankcurtis yarvina yarvins relnoopener hrefhttpsjournalssagepubcomdoipdf1011770263276421999439 target_blankpatchwork theorya offers model exit look like argues nationstates replaced proliferating competing autocratic citystates ceo effect institute market governance citizens exit different polity existing didnt suitp pbut wellknown powerhouse peter thiel thiel influenced libertarian individualism aversion big government doesnt dislike current woke kind averse largescale political systems 2009 relnoopener hrefhttpswwwcatounboundorg20090413peterthieleducationlibertarian target_blankessaya published libertarian cato institute thiel took aim totalitarian fundamentalist politics alike unthinking demos powers socalled social democracyp pa relnoopener hrefhttpsnationalconservatismorgnatcon22021presenterspeterthiel target_blankthiels natcon addressa took aim institutional wokeness fundamental structures web 20 power creed denounced way relnoopener hrefhttpswwwpenguinrandomhousecombooks175380thewisdomofcrowdsbyjamessurowiecki target_blankthe wisdom crowdsahas shaded relnoopener hrefhttpswwwbloomsburycomusmadnessofcrowds9781635579987 target_blankthe madness crowdsahe railed epistemic closure approved scientific consensus fiat currency warning globalist future individuals exist hinted preferred solution predicament went biggest regret buying crypto cheap called satoshi nakamoto pseudonymous inventor bitcoin protocol lauded tickertape paradep diva hrefhttpsunherdcom202110britainisbecomingmorecruelrefinnara hrefhttpsunherdcom202110britainisbecomingmorecruelrefinnarimg srchttpsunherdcomwpcontentuploads2021102gettyimages481683581scaled1300x200jpgadiva hrefhttpsunherdcom202110britainisbecomingmorecruelrefinnarspanmore authorspanaa hrefhttpsunherdcom202110britainisbecomingmorecruelrefinnarh5the death britains dignityh5apa hrefhttpsunherdcom202110britainisbecomingmorecruelrefinnarspanbyspan mary harringtonapdivadiv pmany looked baffled tech bros talking political models talking tech models conversation enables sitting president relnoopener hrefhttpstechcrunchcom20210109thedeplatformingofapresidentguccounter1guce_referrerahr0chm6ly93d3cuz29vz2xllmnvbs8guce_referrer_sigaqaaamtqtfeg46aq05im4q_kokixnzfgnnhbzjwjfki58arj265odpuejpp36kiv8q6pbbmtkl_j5u5rcsptxqvmaksez6tqfrfgzxda9adxykxxebfwwlszc0cykwga6cyw58kk8ob91ymrivtuiacotz73umysanib6yfclxzk target_blankvulnerable deplatforminga fall foul consensus proper behaviour pointp pits freedom speech association exit right sees problems inherent big centralised tech infrastructures big centralised increasingly big techenabled financial infrastructures relnoopener hrefhttpswwwinvestopediacomtermsffiatmoneyasp target_blankfiat currenciesa use exit right argues way protect measure freedom dissenters abandon fiat currency altogether favour cryptop pmeanwhile stories coming tech converging government relnoopener hrefhttpswwwforbescomsitesthomasbrewster20211004googlekeywordwarrantsgiveusgovernmentdataonsearchuserssh2daeed097c97 target_blankgoogle passing search histories governmenta example relnoopener hrefhttpswwwftcomcontent74782def10464ea5b7960802cfb90260 target_blankamazon hosting uk spy agencies dataa story drumbeat grows louder exit right escape convergence government big tech salvation decentralising power blockchainp pthe tech bros relnoopener hrefhttpstwittercomrdnxyzstatus1460744024457895942s21 target_blanksuggesta mainstream right merely carps wokeness sidelines assenting framework gives brittle badfaith faith realworld power notably finance overcentralised internetp ptheir proposed solution leaning new tech escape increasingly totalitarian present tech theorist james poulos argues forthcoming relnoopener hrefhttpshumanforeverus target_blankemhuman foreverema way bind embrace decentralised tech create parallel institutions secure robust networks mature culturally healthy people online offp pthis means building thiel prolific funder projects exit right ecosystem yarvin hasnt contributed dissenting theory dissenting tech founding developer relnoopener hrefhttpsurbitorg target_blankurbita aims replace centralised big tech model peertopeer network web services identities data owned user big tech urbit relnoopener hrefhttpswwwthevergecom201722114671978altrightmenciusmoldbugurbitcurtisyarvintlon target_blankpartfunded thielap panother example relnoopener hrefhttpsnewfoundingcom target_blanknew foundinga aims connect dissident conservative american individuals businesses new media technology commerce serves supports american peoplepoulos practises preaches book launch initially nft relnoopener hrefhttpscanonicxyz target_blankcanonica blockchainbased selfpublishing platform sells books denominated bitcoin recently relnoopener hrefhttpscanonicxyzbooks1alanpz69xpefhbhfkwcdanympabrsl62olimited target_blankpublisheda zero hp lovecraftp diva hrefhttpsunherdcom202109thecryptorevolutionhasfailedrefinnara hrefhttpsunherdcom202109thecryptorevolutionhasfailedrefinnarimg srchttpsunherdcomwpcontentuploads202109gettyimages1230577642scalede16305994102881300x183jpgadiva hrefhttpsunherdcom202109thecryptorevolutionhasfailedrefinnarspanmore authorspanaa hrefhttpsunherdcom202109thecryptorevolutionhasfailedrefinnarh5the crypto revolution failingh5apa hrefhttpsunherdcom202109thecryptorevolutionhasfailedrefinnarspanbyspan greg barkerapdivadiv pif internet drive worldshattering schisms moneys wokeness source decentralising visionaries task freeing world big techs rapidlyconsolidating woke priesthood tech vision turn inevitably develop priest class priest emclassesempluralp pright exit right heavily maledominated exclusively nerdonly subculture exceptionally clever techies group manwildly underestimates ability willingness normal people heads tech innovationsbut order mainstream tech powers exit rights vision need explaining nonnerds means roping writers words arts graduates people right mindset simplify prettify explain popularisep pbut bringing ability explain arts graduates involved theyre guaranteed bring moral viewpoints arguably key reason tech currently creepily uniform moral outlook heavily centralised explainers popularisers priest class recruited small set elite american universities fairly homogenous worldviewp ppeter thiel exit right argue way teeth emerging antiwoke consensus decentralise finance tech governance popularising wont create new priest class instead exiting faction need succeed upshot wont liberation techadjacent priesthoods competition moral outlooksp pand measure success happens neutral unified marketplace ideas itll happen world competing worldview potentially infrastructures currencies citystateslets hope zerosum disagreement moral worldviews infrastructures like time information technology changed radically think culture war prefixp pthere come time dislike current stifling woke hegemony look nostalgia lastditch effort fading age save oncoming stormp hrefhttpsunherdcom202111theresnothingwokeaboutcryptoappcommentsview 12 commentsa |
6198284be3c4ba27c852d126 | Politics Podcast: What 44 Days In Las Vegas Taught Nate Silver | div datahrefhttpsfivethirtyeightcomfeaturespoliticspodcastwhat44daysinlasvegastaughtnatesilver
div datapodcasttitlepolitics podcast what 44 days in las vegas taught nate silver datapodcastid321090 datapodcastduration0
spanspanfivethirtyeightspanspan
div
div
div
divdiv
div
div div
audio preloadnone
source srchttpswwwpodtraccomptsredirectmp3trafficmegaphonefmesp4861412368mp3updated1637274619
audio
div
div
div
div
aside
div
more a hrefhttpsitunesapplecomuspodcastfivethirtyeightelectionsid1077418457apple podcastsa
spana dataandroidurl hrefhttpmespncomgeneralcastid14554755espn appa span
a hrefhttpswwwespncomespnradiofeedsrsspodcastxmlid14554755rssa
div
aside
p dataparagraphmainnate silver is back from his book researchpoker trip to las vegas and in this installment of the a relnoopener hrefhttpsfivethirtyeightcomtagpoliticspodcast target_blankfivethirtyeight politicsa podcast he sits down with galen druke to answer listener questions and talk about what he learned on the strip on the topic of vegas he discusses the importance of being observant while engaging in risky behavior like poker and shares tips for latenight food on politics he answers questions about the role policy plays in voters decisions and whether people become more conservative as they agep
p dataparagraphmainemyou can listen to the episode by clicking the play button in the audio player above or by ema relnoopener hrefhttpsitunesapplecomuspodcastfivethirtyeightelectionsid1077418457mt2 target_blankemdownloading it in itunesemaem the ema relnoopener hrefhttpwwwespncomespnmobileproductsproducts_id6857590 target_blankemespn appemaem or your favorite podcast platform if you are new to podcasts ema relnoopener hrefhttpsfivethirtyeightcomhowtolistentofivethirtyeightpodcasts target_blankemlearn how to listenemaememp
p dataparagraphmainemthe fivethirtyeight politics podcast is recorded mondays and thursdays help new listeners discover the show by ema relnoopener hrefhttpsitunesapplecomuspodcastfivethirtyeightelectionsid1077418457mt2 target_blankemleaving us a rating and review on itunesemaem have a comment question or suggestion for good polling vs bad polling get in touch by email ema relnoopener hrefhttpstwittercomfivethirtyeight target_blankemon twitteremaem or in the commentsemp
pwatch httpsabcnewsgocomfivethirtyeightvideoeconomistslonghighinflation81192953p
pwatch httpsabcnewsgocomfivethirtyeightvideoamericanstalkingpoliticsthanksgivingtablefivethirtyeight81117079p | div datahrefhttpsfivethirtyeightcomfeaturespoliticspodcastwhat44daysinlasvegastaughtnatesilver div datapodcasttitlepolitics podcast 44 days las vegas taught nate silver datapodcastid321090 datapodcastduration0 spanspanfivethirtyeightspanspan div div div divdiv div divdiv audio preloadnone source srchttpswwwpodtraccomptsredirectmp3trafficmegaphonefmesp4861412368mp3updated1637274619 audio div div div div aside div hrefhttpsitunesapplecomuspodcastfivethirtyeightelectionsid1077418457apple podcastsa spana dataandroidurl hrefhttpmespncomgeneralcastid14554755espn appa span hrefhttpswwwespncomespnradiofeedsrsspodcastxmlid14554755rssa div aside p dataparagraphmainnate silver book researchpoker trip las vegas installment relnoopener hrefhttpsfivethirtyeightcomtagpoliticspodcast target_blankfivethirtyeight politicsa podcast sits galen druke answer listener questions talk learned strip topic vegas discusses importance observant engaging risky behavior like poker shares tips latenight food politics answers questions role policy plays voters decisions people conservative agep p dataparagraphmainemyou listen episode clicking play button audio player byema relnoopener hrefhttpsitunesapplecomuspodcastfivethirtyeightelectionsid1077418457mt2 target_blankemdownloading itunesemaem theema relnoopener hrefhttpwwwespncomespnmobileproductsproducts_id6857590 target_blankemespn appemaemor favorite podcast platform new podcastsema relnoopener hrefhttpsfivethirtyeightcomhowtolistentofivethirtyeightpodcasts target_blankemlearn listenemaememp p dataparagraphmainemthe fivethirtyeight politics podcast recorded mondays thursdays help new listeners discover ema relnoopener hrefhttpsitunesapplecomuspodcastfivethirtyeightelectionsid1077418457mt2 target_blankemleaving rating review itunesemaem comment question suggestion good polling vs bad polling touch email ema relnoopener hrefhttpstwittercomfivethirtyeight target_blankemon twitteremaem commentsemp pwatch httpsabcnewsgocomfivethirtyeightvideoeconomistslonghighinflation81192953p pwatch httpsabcnewsgocomfivethirtyeightvideoamericanstalkingpoliticsthanksgivingtablefivethirtyeight81117079p |
619829b9e3c4ba27c852d128 | 'QAnon Shaman' Jacob Chansley Gets 41 Months in Prison | div
picture
source sizesminwidth 600px 331px 100vw typeimagewebp srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202111zumaamericastwentynine7269222400x1350jpgwebp 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202111zumaamericastwentynine7269221200x675jpgwebp 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202111zumaamericastwentynine726922800x450jpgwebp 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202111zumaamericastwentynine726922600x338jpgwebp 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202111zumaamericastwentynine726922331x186jpgwebp 331w
source sizesminwidth 600px 331px 100vw typeimagejpeg srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202111zumaamericastwentynine7269222400x1350jpg 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202111zumaamericastwentynine7269221200x675jpg 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202111zumaamericastwentynine726922800x450jpg 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202111zumaamericastwentynine726922600x338jpg 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202111zumaamericastwentynine726922331x186jpg 331w
img width1200 altzumaamericastwentynine726922 srchttpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202111zumaamericastwentynine726922800x450jpg height675
picture
div
pjacob chansley the horned shirtless figure known as the qanon shaman who participated in the mob storming the capitol on january 6 was sentenced to 41 months in prison for his part in the riotp
pif a 35year sentence sounds harsh for what was ultimately a nonviolent chargeobstructing an official proceeding in congressconsider that chansley has already spent the past several months in jail in solitary confinementp
blockquote datawidth500 classtwittertweet datadnttrue
p langen dirltrhe got 41 months in prison after already spending 10 months in solitary confinementp
ponly a sick punitive society imprisons nonviolent protesters for years in harsh conditions or one that regards particular ideologies as inherently criminal a hrefhttpstcogvyytq07mkhttpstcogvyytq07mkap
p glenn greenwald ggreenwald a hrefhttpstwittercomggreenwaldstatus1461033177569546242ref_srctwsrc5etfwnovember 17 2021apblockquote
pp
paccording to a hrefhttpswwwnprorg202111171056225488selfstyledqanonshamanissentencedto41monthsincapitolriotnprap
blockquotepbefore announcing his sentence judge lamberth told chansley he believes that his remorse is genuine and heartfelt but he also told chansley that quotwhat you did was terriblequotp
phe said chansley had made the right decision to plead guilty and take responsibility for his actions instead of going to trial where he faced a much longer possible sentencep
pquotyou were facing 20 years mr chansley the one advantage you get here is youre only facing now 41 monthsquot lamberth said quotit may not feel it today but let me guarantee you you were smart and did the right thingquotp
pthe sentenced handed down was less than the 51 months the justice department had recommended for chansley whom prosecutors described as the quotflag bearerquot of the capitol riotp
passistant us attorney kimberly paschall told the court at the start of the hearing that such a sentence was necessary quotto send a strong messagequot to chansley and anyone who would wish to do harm to the countrypblockquote
pchansley felt he had no choice but to accept the plea deal that came with that 41month sentence of course because he couldnt risk a trial that could send him to prison for em20 yearsem this is the sad reality of the criminal justice system defendants often plead guilty in order to avoid absurdly long mandatory sentences and are thus denied the opportunity to actually attempt to prove their innocence before a jury of their peersp
pthe people who entered and defaced the capitol on january 6 are not political prisoners and they are certainly not heroes they committed trespassing and broke other laws and its legitimate for the government to prosecute them but this sentence is too harsh chansley did not commit a violent crime and is certainly unlikely to reoffend if prosecutors disagree they should have to prove that to a jury unfortunately the threat of an even lengthier sentence prompts most defendants to fall in linep
hr
h1free mindsh1
pscott alexander has a hrefhttpsastralcodextensubstackcompivermectinmuchmorethanyouwantedpenned the definitive summarya of the available evidence on ivermectin as an effective covid19 therapeutic writing for his substack emastral codex tenem alexander argues that many of the ivermectin studies involved unreliable methodologies or should be dismissed for other reasons but others appear to hold up and his ultimate conclusion is that ivermectin does seem to provide a very very small but measurable benefit for patients infected with covid19p
palexander notes however that the studies where ivermectin appeared to do the most good seem to be concentrated in certain parts of the worldindia bangladeshwith higherthanaverage intestinal worm problems his theoryand its a very good oneis that ivermectin doesnt directly improve covid19 outcomes rather these studies were disproportionately likely to include patients suffering from worms which had rendered their immune systems less able to fight off other infections since ivermectin is highly effective at fighting worms it indirectly resulted in an improvement over the placebo group by helping patients overcome their intestinal wormsa not insignificant boon in their simultaneous battles against covid19 alexander explainsp
blockquoteptreatment of worm infections might reduce the negative effect of covid19 and ivermectin is a deworming drug you can see where this is goingp
pthe most relevant species of worm here is the roundworm emstrongyloides stercoralisem among the commonest treatments for covid19 is corticosteroids a type of immunosuppresant drug the types of immune responses it suppresses do more harm than good in coronavirus so turning them off limits collateral damage and makes patients better on net but these are also the types of immune responses that control emstrongyloidesem if you turn them off even very briefly the worms multiply out of control you get whats called quotemstrongyloides emhyperinfectionquot and pretty often you die according to a rel hrefhttpswwwwhointnewsitem17122020aparasiticinfectionthatcanturnfatalwithadministrationofcorticosteroidsthe whoap
pthe current covid19 pandemic serves to highlight the risk of using systemic corticosteroids and to a lesser extent other immunosuppressive therapy in populations with significant risk of underlying strongyloidiasis cases of strongyloidiasis hyperinfection in the setting of corticosteroid use as covid19 therapy have been described and draw attention to the necessity of addressing the risk of iatrogenic strongyloidiasis hyperinfection syndromeem emin infected individuals prior to corticosteroid administrationp
palthough this has gained importance in the midst of a pandemic where corticosteroids are one of few therapies shown to improve mortality its relevance is much broader given that corticosteroids and other immunosuppressive therapies have become increasingly common in treatment of chronic diseases eg asthma or certain rheumatologic conditionsp
pso you need to quotaddress the riskquot of emstrongyloidesem infection during covid treatment in roundwormendemic areas and how might you address this whop
ptreatment of chronic strongyloidiasis with ivermectin 200 gkg per day orally x 12 days is considered safe with potential contraindications including possible emloa loaem infection endemic in west and central africa pregnancy and weight lt15kgp
pgiven ivermectins safety profile the united states has utilized presumptive treatment with ivermectin for strongyloidiasis in refugees resettling from endemic areas and both canada and the european centre for disease prevention and control have issued guidance on presumptive treatment to avoid hyperinfection in at risk populations screening and treatment or where not available addition of ivermectin to mass drug administration programs should be studied and consideredp
pthis is serious and common enough that if youre not going to screen for it it might be worth quotadd[ing] ivermectin to mass drug administration programsquot in affected areasp
pthe good ivermectin trials in areas with low emstrongyloidesem prevalence like vallejos in argentina are mostly negative the good ivermectin trials in areas with high emstrongyloidesem prevalence like mahmud in bangladesh are mostly positivepblockquote
palexander notes that hes only about 50 percent confident in his hypothesis he could be wrong of course but its quite an elegant solution to the ivermectin riddlep
pemreasonems ronald bailey has a hrefhttpsreasoncom20210902unfortunatelyivermectinisnotamiraclecureforcovid19writtena that ivermectin is clearly quotnot a miracle curequot though it might have some marginal efficacyp
hr
h1free marketsh1
pdetroits public school district will move to virtual education on fridays in december in part because administrators think additional time to clean the buildings will help slow the spread of covid19 according to a hrefhttpsdetroitchalkbeatorg2021111722788007detroitpublicschoolsremotelearningfridaydecembercovidspreadchalkbeatap
blockquote
pthe detroit school district is moving to remote instruction for three fridays in december in an effort to slow the spread of covid and give the staff time to deep clean schoolsp
pthe move was announced wednesday on the districts a hrefhttpswwwdetroitk12orgsitedefaultaspxpagetype3domainid4moduleinstanceid7278viewid6446ee88d30c497e93163f8874b3e108renderloc0flexdataid60580pageid1web sitea it comes as the state is leading the nation in a hrefhttpswwwdetroitnewscomstorynewslocalmichigan20211116michiganleadsnationnewcovidcasesaccordingcdcdata8639213002new covid casesap
psuperintendent nikolai vitti said in that statement that he and the school board made the decision quotafter listening and reflecting on the concerns of schoolbased leaders teachers support staff students and families regarding the need for mental health relief rising covid cases and time to more thoroughly clean schoolsquotp
plearning will move online on dec 3 dec 10 and dec 17p
blockquote
pcleaning schools more thoroughlya hrefhttpsreasoncom20210210schoolscoronavirusrandiweingartencovid19reopening will not slow the spreada of covid19 no matter how desperate some education officials are to pretend otherwise scrubbing down surfaces is a component of covid19 hygiene theater the disease primarily spreads via people expelling respiratory droplets at each other virus particles do not survive on surfaces for longp
pmoreover the extremely small benefit of more cleaning is more than canceled out by the massive drawback of additional school closures students who had to deal with virtual school for a year are suffering significant a hrefhttpsloudounnowcom20211112datashowsstudentlearninggrowthstagnatingpandemicrelated learning lossesa at this point given that covid19 poses very little threat to kids schools must fight to stay open as much as possiblep
punfortunately some schools would sooner close than deal with reality a middle school in oregon has a hrefhttpswwworegonlivecomnews202111reynoldsmiddleschoolisshuttingdowninpersonlearningfor3weekstoaddressstudentfightsmisbehaviorhtmldecideda to shut down for three weeks quotto address student fights and misbehaviorsquot emthe new york timesem michelle goldberg a hrefhttpstwittercommichelleinbklynstatus1461013339241435137correctlya characterized this as a school quotclosing to deal with the catastrophic fallout of school closuresquotp
pdetroits public schools arent the only ones closing either a hrefhttpswwwfox2detroitcomnewssouthfieldschoolsadd1remotelearningdayaweekin southfielda a suburb of detroit students will be virtual on fridays through januaryp
blockquote datawidth500 classtwittertweet datadnttrue
p langen dirltrchildren in the detroit public schools whose 50k enrollment is 3 white will attend school only 4 daysweek next month this follows a similar move in the heavily black suburb of southfield striking to see such inequity become normalized after the yearplus of remote learning a hrefhttpstcotjkdmygivuhttpstcotjkdmygivuap
p alec macgillis alecmacgillis a hrefhttpstwittercomalecmacgillisstatus1461090352497102851ref_srctwsrc5etfwnovember 17 2021apblockquote
pp
pif public schools refuse to actually do the job of educating children and providing day care services for working parents then families should be able to withdraw their perpupil funds and spend these education dollars where they would actually do some goodp
hr
h1strongquick hitsstrongh1
p the judge in the kyle rittenhouse trial a hrefhttpstwittercomvmsalamastatus1461050271916859402doesnt likea the way he was covered in the media and is turning against courtroom camerasp
p two men convicted of killing malcolm x in 1965 have been a hrefhttpswwwnytimescom20211117nyregionmalcolmxkillingexoneratedhtmlsmtypcursmidtwnytimesexoneratedap
p the house of representatives a hrefhttpswwwwashingtonpostcompoliticsrepublicanshousegosarocasiocortez202111174e012bb447b911ecb8d9232f4afe4d9b_storyhtmlvoted to censurea rep paul gosar rariz for sharing an edited anime video in which a figure with his face slays a monster with the face of rep alexandria ocasiocortez dnyp
p steven pinker and robert zimmer are a hrefhttpswwwpoliticocomnewsmagazine20211117universityaustinbariweisspinkerculturepolitics522800no longer involveda in the university of austinp
p the hbo max special celebrating the 20th anniversary of the first emharry potter emmovie a hrefhttpswwwhollywoodreportercomtvtvnewsharrypotterretrospectivetofeaturecastbutnojkrowling1235048570will not include jk rowlingap
pthe post a relnofollow hrefhttpsreasoncom20211118jacobchansleyqanonshaman41monthsjanuary6capitolqanon shaman jacob chansley gets 41 months in prisona appeared first on a relnofollow hrefhttpsreasoncomreasoncomap | div picture source sizesminwidth 600px 331px 100vw typeimagewebp srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202111zumaamericastwentynine7269222400x1350jpgwebp 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202111zumaamericastwentynine7269221200x675jpgwebp 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202111zumaamericastwentynine726922800x450jpgwebp 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202111zumaamericastwentynine726922600x338jpgwebp 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202111zumaamericastwentynine726922331x186jpgwebp 331w source sizesminwidth 600px 331px 100vw typeimagejpeg srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202111zumaamericastwentynine7269222400x1350jpg 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202111zumaamericastwentynine7269221200x675jpg 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202111zumaamericastwentynine726922800x450jpg 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202111zumaamericastwentynine726922600x338jpg 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202111zumaamericastwentynine726922331x186jpg 331w img width1200 altzumaamericastwentynine726922 srchttpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202111zumaamericastwentynine726922800x450jpg height675 picture div pjacob chansley horned shirtless figure known qanon shaman participated mob storming capitol january 6 sentenced 41 months prison riotp pif 35year sentence sounds harsh ultimately nonviolent chargeobstructing official proceeding congressconsider chansley spent past months jail solitary confinementp blockquote datawidth500 classtwittertweet datadnttrue p langen dirltrhe got 41 months prison spending 10 months solitary confinementp ponly sick punitive society imprisons nonviolent protesters years harsh conditions regards particular ideologies inherently criminal hrefhttpstcogvyytq07mkhttpstcogvyytq07mkap p glenn greenwald ggreenwald hrefhttpstwittercomggreenwaldstatus1461033177569546242ref_srctwsrc5etfwnovember 17 2021apblockquote pp paccording hrefhttpswwwnprorg202111171056225488selfstyledqanonshamanissentencedto41monthsincapitolriotnprap blockquotepbefore announcing sentence judge lamberth told chansley believes remorse genuine heartfelt told chansley quotwhat terriblequotp phe said chansley right decision plead guilty responsibility actions instead going trial faced longer possible sentencep pquotyou facing 20 years mr chansley advantage youre facing 41 monthsquot lamberth said quotit feel today let guarantee smart right thingquotp pthe sentenced handed 51 months justice department recommended chansley prosecutors described quotflag bearerquot capitol riotp passistant attorney kimberly paschall told court start hearing sentence necessary quotto send strong messagequot chansley wish harm countrypblockquote pchansley felt choice accept plea deal came 41month sentence course couldnt risk trial send prison forem20 yearsem sad reality criminal justice system defendants plead guilty order avoid absurdly long mandatory sentences denied opportunity actually attempt prove innocence jury peersp pthe people entered defaced capitol january 6 political prisoners certainly heroes committed trespassing broke laws legitimate government prosecute sentence harsh chansley commit violent crime certainly unlikely reoffend prosecutors disagree prove jury unfortunately threat lengthier sentence prompts defendants fall linep hr h1free mindsh1 pscott alexander hrefhttpsastralcodextensubstackcompivermectinmuchmorethanyouwantedpenned definitive summarya available evidence ivermectin effective covid19 therapeutic writing substackemastral codex tenem alexander argues ivermectin studies involved unreliable methodologies dismissed reasons appear hold ultimate conclusion ivermectin provide small measurable benefit patients infected covid19p palexander notes studies ivermectin appeared good concentrated certain parts worldindia bangladeshwith higherthanaverage intestinal worm problems theoryand good oneis ivermectin doesnt directly improve covid19 outcomes studies disproportionately likely include patients suffering worms rendered immune systems able fight infections ivermectin highly effective fighting worms indirectly resulted improvement placebo group helping patients overcome intestinal wormsa insignificant boon simultaneous battles covid19 alexander explainsp blockquoteptreatment worm infections reduce negative effect covid19 ivermectin deworming drug goingp pthe relevant species worm roundwormemstrongyloides stercoralisem commonest treatments covid19 corticosteroids type immunosuppresant drug types immune responses suppresses harm good coronavirus turning limits collateral damage makes patients better net types immune responses controlemstrongyloidesem turn briefly worms multiply control whats called quotemstrongyloidesemhyperinfectionquot pretty die according toa rel hrefhttpswwwwhointnewsitem17122020aparasiticinfectionthatcanturnfatalwithadministrationofcorticosteroidsthe whoap pthe current covid19 pandemic serves highlight risk systemic corticosteroids lesser extent immunosuppressive therapy populations significant risk underlying strongyloidiasis cases strongyloidiasis hyperinfection setting corticosteroid use covid19 therapy described draw attention necessity addressing risk iatrogenic strongyloidiasis hyperinfection syndromeememin infected individuals prior corticosteroid administrationp palthough gained importance midst pandemic corticosteroids therapies shown improve mortality relevance broader given corticosteroids immunosuppressive therapies increasingly common treatment chronic diseases eg asthma certain rheumatologic conditionsp pso need quotaddress riskquot ofemstrongyloideseminfection covid treatment roundwormendemic areas address whop ptreatment chronic strongyloidiasis ivermectin 200 gkg day orally x 12 days considered safe potential contraindications including possibleemloa loaeminfection endemic west central africa pregnancy weight lt15kgp pgiven ivermectins safety profile united states utilized presumptive treatment ivermectin strongyloidiasis refugees resettling endemic areas canada european centre disease prevention control issued guidance presumptive treatment avoid hyperinfection risk populations screening treatment available addition ivermectin mass drug administration programs studied consideredp pthis common youre going screen worth quotadd[ing] ivermectin mass drug administration programsquot affected areasp pthe good ivermectin trials areas lowemstrongyloidesemprevalence like vallejos argentina negative good ivermectin trials areas highemstrongyloidesemprevalence like mahmud bangladesh positivepblockquote palexander notes hes 50 percent confident hypothesis wrong course elegant solution ivermectin riddlep pemreasonems ronald bailey hrefhttpsreasoncom20210902unfortunatelyivermectinisnotamiraclecureforcovid19writtena ivermectin clearly quotnot miracle curequot marginal efficacyp hr h1free marketsh1 pdetroits public school district virtual education fridays december administrators think additional time clean buildings help slow spread covid19 according toa hrefhttpsdetroitchalkbeatorg2021111722788007detroitpublicschoolsremotelearningfridaydecembercovidspreadchalkbeatap blockquote pthe detroit school district moving remote instruction fridays december effort slow spread covid staff time deep clean schoolsp pthe announced wednesday districtsa hrefhttpswwwdetroitk12orgsitedefaultaspxpagetype3domainid4moduleinstanceid7278viewid6446ee88d30c497e93163f8874b3e108renderloc0flexdataid60580pageid1web sitea comes state leading nation ina hrefhttpswwwdetroitnewscomstorynewslocalmichigan20211116michiganleadsnationnewcovidcasesaccordingcdcdata8639213002new covid casesap psuperintendent nikolai vitti said statement school board decision quotafter listening reflecting concerns schoolbased leaders teachers support staff students families need mental health relief rising covid cases time thoroughly clean schoolsquotp plearning online dec 3 dec 10 dec 17p blockquote pcleaning schools thoroughlya hrefhttpsreasoncom20210210schoolscoronavirusrandiweingartencovid19reopening slow spreada covid19 matter desperate education officials pretend scrubbing surfaces component covid19 hygiene theater disease primarily spreads people expelling respiratory droplets virus particles survive surfaces longp pmoreover extremely small benefit cleaning canceled massive drawback additional school closures students deal virtual school year suffering significant hrefhttpsloudounnowcom20211112datashowsstudentlearninggrowthstagnatingpandemicrelated learning lossesa point given covid19 poses little threat kids schools fight stay open possiblep punfortunately schools sooner close deal reality middle school oregon hrefhttpswwworegonlivecomnews202111reynoldsmiddleschoolisshuttingdowninpersonlearningfor3weekstoaddressstudentfightsmisbehaviorhtmldecideda shut weeks quotto address student fights misbehaviorsquotemthe new york timesem michelle goldberg hrefhttpstwittercommichelleinbklynstatus1461013339241435137correctlya characterized school quotclosing deal catastrophic fallout school closuresquotp pdetroits public schools arent ones closing hrefhttpswwwfox2detroitcomnewssouthfieldschoolsadd1remotelearningdayaweekin southfielda suburb detroit students virtual fridays januaryp blockquote datawidth500 classtwittertweet datadnttrue p langen dirltrchildren detroit public schools 50k enrollment 3 white attend school 4 daysweek month follows similar heavily black suburb southfield striking inequity normalized yearplus remote learning hrefhttpstcotjkdmygivuhttpstcotjkdmygivuap p alec macgillis alecmacgillis hrefhttpstwittercomalecmacgillisstatus1461090352497102851ref_srctwsrc5etfwnovember 17 2021apblockquote pp pif public schools refuse actually job educating children providing day care services working parents families able withdraw perpupil funds spend education dollars actually goodp hr h1strongquick hitsstrongh1 pthe judge kyle rittenhouse trial hrefhttpstwittercomvmsalamastatus1461050271916859402doesnt likea way covered media turning courtroom camerasp p men convicted killing malcolm x 1965 hrefhttpswwwnytimescom20211117nyregionmalcolmxkillingexoneratedhtmlsmtypcursmidtwnytimesexoneratedap pthe house representatives hrefhttpswwwwashingtonpostcompoliticsrepublicanshousegosarocasiocortez202111174e012bb447b911ecb8d9232f4afe4d9b_storyhtmlvoted censurea rep paul gosar rariz sharing edited anime video figure face slays monster face rep alexandria ocasiocortez dnyp p steven pinker robert zimmer hrefhttpswwwpoliticocomnewsmagazine20211117universityaustinbariweisspinkerculturepolitics522800no longer involveda university austinp p hbo max special celebrating 20th anniversary emharry potteremmovie hrefhttpswwwhollywoodreportercomtvtvnewsharrypotterretrospectivetofeaturecastbutnojkrowling1235048570will include jk rowlingap pthe post relnofollow hrefhttpsreasoncom20211118jacobchansleyqanonshaman41monthsjanuary6capitolqanon shaman jacob chansley gets 41 months prisona appeared relnofollow hrefhttpsreasoncomreasoncomap |
61982b57e3c4ba27c852d12a | OSHA Halts Enforcement of Biden Vaccine Mandate, Pending Litigation | div
picture
source sizesminwidth 600px 331px 100vw typeimagewebp srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202111zumaglobaleleven3166912400x1350jpgwebp 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202111zumaglobaleleven3166911200x675jpgwebp 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202111zumaglobaleleven316691800x450jpgwebp 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202111zumaglobaleleven316691600x338jpgwebp 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202111zumaglobaleleven316691331x186jpgwebp 331w
source sizesminwidth 600px 331px 100vw typeimagejpeg srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202111zumaglobaleleven3166912400x1350jpg 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202111zumaglobaleleven3166911200x675jpg 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202111zumaglobaleleven316691800x450jpg 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202111zumaglobaleleven316691600x338jpg 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202111zumaglobaleleven316691331x186jpg 331w
img width1200 altzumaglobaleleven316691 srchttpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202111zumaglobaleleven316691800x450jpg height675
picture
div
pthe occupational safety and health administration osha will not enforce the biden administrations covid19 vaccine mandate at least until the mandates legal status is resolvedp
pthe announcement came on wednesday oshas website now stipulates that while the agency quotremains confident in its authority to protect workers in emergencies osha has suspended activities related to the implementation and enforcement of the [covid19 vaccination and testing emergency temporary standard] pending future developments in the litigationquotp
pthe us court of appeals for the 5th circuit halted bidens vaccine mandate which applies to all private businesses that employ at least 100 people last week a threejudge panel a hrefhttpsreasoncom20211114extendingitsstaythe5thcircuitsaysoshasvaccinemandateisfatallyflaweddescribeda the mandate as quotfatally flawedquot and quotstaggeringly broadquot emreasonem senior editor jacob sullum dove into the legal arguments against the mandate a hrefhttpsreasoncom20211107herearetheargumentsthatpersuadedthe5thcircuittoblockoshasvaccinemandateforprivateemployersherea while i tackled some of the broader philosophical objections a hrefhttpswwwnytimescom20210910opinionpoliticsbidenvaccinemandatehtmlhereap
pdespite oshas certainty that the mandate falls under its authority to keep workplaces safe it remains to be seen whether the us supreme court will agree this mandate after all extends to remote workers who might rarely come into contact with their coworkers and thus be at little risk of encountering covid19 as a workplace hazard if the disease can even be classified as suchp
pits not completely clear that the biden administration expects the vaccine mandate to hold up in court but the federal government is clearly keen to push businesses to require vaccination for as long as it possibly can at least ohsa is standing downfor nowp
pthe post a relnofollow hrefhttpsreasoncom20211117oshabidenvaccinemandatehaltlitigationosha halts enforcement of biden vaccine mandate pending litigationa appeared first on a relnofollow hrefhttpsreasoncomreasoncomap | div picture source sizesminwidth 600px 331px 100vw typeimagewebp srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202111zumaglobaleleven3166912400x1350jpgwebp 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202111zumaglobaleleven3166911200x675jpgwebp 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202111zumaglobaleleven316691800x450jpgwebp 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202111zumaglobaleleven316691600x338jpgwebp 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202111zumaglobaleleven316691331x186jpgwebp 331w source sizesminwidth 600px 331px 100vw typeimagejpeg srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202111zumaglobaleleven3166912400x1350jpg 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202111zumaglobaleleven3166911200x675jpg 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202111zumaglobaleleven316691800x450jpg 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202111zumaglobaleleven316691600x338jpg 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202111zumaglobaleleven316691331x186jpg 331w img width1200 altzumaglobaleleven316691 srchttpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202111zumaglobaleleven316691800x450jpg height675 picture div pthe occupational safety health administration osha enforce biden administrations covid19 vaccine mandate mandates legal status resolvedp pthe announcement came wednesday oshas website stipulates agency quotremains confident authority protect workers emergencies osha suspended activities related implementation enforcement [covid19 vaccination testing emergency temporary standard] pending future developments litigationquotp pthe court appeals 5th circuit halted bidens vaccine mandate applies private businesses employ 100 people week threejudge panel hrefhttpsreasoncom20211114extendingitsstaythe5thcircuitsaysoshasvaccinemandateisfatallyflaweddescribeda mandate quotfatally flawedquot quotstaggeringly broadquotemreasonem senior editor jacob sullum dove legal arguments mandate hrefhttpsreasoncom20211107herearetheargumentsthatpersuadedthe5thcircuittoblockoshasvaccinemandateforprivateemployersherea tackled broader philosophical objections hrefhttpswwwnytimescom20210910opinionpoliticsbidenvaccinemandatehtmlhereap pdespite oshas certainty mandate falls authority workplaces safe remains seen supreme court agree mandate extends remote workers rarely come contact coworkers little risk encountering covid19 workplace hazard disease classified suchp pits completely clear biden administration expects vaccine mandate hold court federal government clearly keen push businesses require vaccination long possibly ohsa standing downfor nowp pthe post relnofollow hrefhttpsreasoncom20211117oshabidenvaccinemandatehaltlitigationosha halts enforcement biden vaccine mandate pending litigationa appeared relnofollow hrefhttpsreasoncomreasoncomap |
61982c81e3c4ba27c852d12e | Prosecution Rests in Ahmaud Arbery Murder Trial | div
picture
source sizesminwidth 600px 331px 100vw typeimagewebp srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202111sipaphotosten9805152400x1350jpgwebp 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202111sipaphotosten9805151200x675jpgwebp 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202111sipaphotosten980515800x450jpgwebp 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202111sipaphotosten980515600x338jpgwebp 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202111sipaphotosten980515331x186jpgwebp 331w
source sizesminwidth 600px 331px 100vw typeimagejpeg srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202111sipaphotosten9805152400x1350jpg 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202111sipaphotosten9805151200x675jpg 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202111sipaphotosten980515800x450jpg 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202111sipaphotosten980515600x338jpg 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202111sipaphotosten980515331x186jpg 331w
img width1200 altsipaphotosten980515 srchttpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202111sipaphotosten980515800x450jpg height675
picture
div
pwhile the kyle rittenhouse trial has largely captured the medias attention for the last few weeks another murder trial of significant public interest has been happening at the same timep
pahmaud arbery a 25yearold black man a hrefhttpsreasoncom20200508ittookgeorgiaofficials2monthstoarrestandchargefatherandsonwithahmaudarberysmurderwas shot and killeda by gregory and travis mcmichael a father and son pair in brunswick georgia back in february 2020 their neighbor william bryan jr has also been charged the trio of white men is accused of chasing down and murdering arbery who was jogging through the neighborhoodp
pthe prosecution rested its case on tuesday cnn a hrefhttpswwwcnncom20211116usahmaudarberykillingtrialday8tuesdayindexhtmlreportsap
blockquote
p dataparagraphidparagraph_12808e9868d9993c093b2a2e18475d07 dataactidparagraph_8on tuesday georgia bureau of investigation forensic pathologist dr edmund donoghuethe man who performed arberys autopsydetailed arberys injuries as jurors saw graphic photos from the examinationp
p dataparagraphidparagraph_e23feec858af030319652a00dcb64a99 dataactidparagraph_9donoghues a relnoopener hrefhttpswwwcnncom20200512usahmaudarberyvideowilliambryanindexhtml target_blankautopsy reporta from april 2020 did not detail the order in which arberys gunshot wounds happened but he testified tuesday that he could do so now combining the autopsy with widely seen cell phone video taken by bryan arbery and travis mcmichael can be seen in the video wrestling over the firearm before the shootingp
p dataparagraphidparagraph_e74ee326e7d148469d822a00dd61479a dataactidparagraph_10though three shots were fired only the first and third struck arbery donoghue testified the first not only grazed his right wristhitting an artery and causing severe bleedingbut also struck his center chest he saidstrongstrongp
p dataparagraphidparagraph_06b830633990aad34a4c2a0b43e4ab5c dataactidparagraph_11the third shot struck his left chest and armpit hitting his axillary vein and axillary artery donoghue testifiedp
p dataparagraphidparagraph_afd1dd3a871604c826802a0b9d5ff2f7 dataactidparagraph_12while a tourniquet could have remedied the wrist injury nothing could be done on scene to save arberys life after either of the torso wounds donoghue saidp
p dataparagraphidparagraph_614c3900e0197cf1c9132a0e79e1f53d dataactidparagraph_13prosecuting attorney linda dunikoski asked whether arberys first set of injuriesthe wrist and chest being hit by the same shotcould be quotconsistent with someone pushing a shotgun away from themquot or quotconsistent with someone maybe grabbing the shotgunquotp
p dataparagraphidparagraph_936d3c1924ce519626ed2a1473c326c3 dataactidparagraph_14quotit could be yesquot donoghue answered to both questionsp
blockquote
pemthe washington post emhas morep
div
div dataqadropcapletter
blockquote
p dataeltextattorneys for travis mcmichael say their client sought first to scare off arbery and quotdeescalatequot firing as arbery got close and fearing that the unarmed man would take mcmichaels weapon prosecutors contendb bthat mcmichael cannot claim selfdefense because he his father and their neighbor were the aggressorspursuing arbery in their trucks and then confronting him in their coastal georgia neighborhood of satilla shores in february 2020p
blockquote
div
div
div
div dataqadropcapletterdiv
div
pthe defense previously tried to bar al sharpton from sitting with the family of the victim arguing unsuccessfully that this a hrefhttpsnewsyahoocomattorneysaysalsharptonmay204112363htmlamounted to jury intimidationap
pwhile the rittenhouse trial a hrefhttpsreasoncom20211109theprosecutionhadaverybaddayinthekylerittenhousetrialwhich increasingly looks like it may result in an acquittala has been wrongly framed by some in the media as an issue of racial animus the arbery case is much more straightforward three white men chased down a black man who had done nothing wrong and killed him he didnt have a gun and he wasnt threatening them its much easier to argue that the mcmichaels were the aggressorsthough ultimately the jury will decidep
hr
h1free mindsh1
pjedediah bila is a fox news pundit and a former host of emthe view emon tuesday she appeared on her old program as a remote guest to plug her new book the conversation went south very quickly when host joy behar brought up the fact that bila is unvaccinated which necessitated the remote setupp
pbila explained that she did not get the vaccine because she has a quotmedical exemption to the vaccinequot cosigned by three different doctors quoti am not a candidate for this vaccinequot she said she further clarified that she was not antivaccine in general but because of her own health issuesand her natural immunity from a prior covid19 infectionit did not make sense for her to get the vaccinep
pthis perfectly sensible statement did not seem to alarm the hosts but when bila brought up the unfortunately true fact that the vaccines do not prevent transmission of covid19 behar and the audience lost itp
blockquote datawidth500 classtwittertweet datadnttrue
p langen dirltrjedediah bila was just on a hrefhttpstwittercomhashtagtheviewsrchashref_srctwsrc5etfwtheviewa to promote her new book and things just went south like way south past the mexico border south the cohosts basically said she was too dangerous to be on air a hrefhttpstcokt8nfkzid2pictwittercomkt8nfkzid2ap
p the chat liveonthechat a hrefhttpstwittercomliveonthechatstatus1460648832023281669ref_srctwsrc5etfwnovember 16 2021apblockquote
pp
psunny hostin accused bila of prioritizing quotyour personal freedom over the health and safety of othersquot and stated that emthe view emshould not even allow bila to voice such quotdisinformationquot this was a remarkable claim since nothing bila said was emremotely false emneverthelessem daily beastem columnist wajahat ali celebrated hostin for shutting down bilap
blockquote datawidth500 classtwittertweet datadnttrue
p langen dirltrwell done a hrefhttpstwittercomsunnyref_srctwsrc5etfwsunnya anti vaxxers and others who peddle dangerous disinformation dont have a right to mainstream platforms this is how it gets normalized glad it was shut down jedediah bila is neither a victim nor martyr p
p a hrefhttpstcokwkd7hpcgqhttpstcokwkd7hpcgqa via a hrefhttpstwittercomthedailybeastref_srctwsrc5etfwthedailybeastap
p wajahat ali wajahatali a hrefhttpstwittercomwajahatalistatus1460713583210283009ref_srctwsrc5etfwnovember 16 2021apblockquote
pp
pagain bila did not make any false claims her claim that natural immunity from a prior infection gives her robust protection from covid19 was true her claim that the vaccineswhile terrific at reducing severe hospitalization and deathdo not prevent the spread of covid19 was also truep
hr
h1free marketsh1
pnpr americas governmentfunded media outlet a hrefhttpswwwnprorg202111161055972179bostonfirstblackmayorutm_campaignnprutm_termnprnewsutm_mediumsocialutm_sourcetwittercompublished a storya on monday that sounded a negative note about incoming boston mayor michelle wus historic winshes the citys first asian american mayorbecause she beat out several black candidates heres a screenshot of the tweetp
pimg datacredittwitter sizesmaxwidth 1146px 100vw 1146px srchttpsd2eehagpk5cl65cloudfrontnetimgq60uploads202111screenshot20211116at121036pmpng alt width1146 srcsethttpsd2eehagpk5cl65cloudfrontnetimgq60uploads202111screenshot20211116at121036pmpng 1146w httpsd2eehagpk5cl65cloudfrontnetimgq60uploads202111screenshot20211116at121036pm300x263png 300w httpsd2eehagpk5cl65cloudfrontnetimgq60uploads202111screenshot20211116at121036pm1024x897png 1024w httpsd2eehagpk5cl65cloudfrontnetimgq60uploads202111screenshot20211116at121036pm768x673png 768w classwpimage8139232 height1004p
pnpr subsequently deleted the tweet after receiving muchdeserved criticismp
pquotwe realize we dont always get things right the first time and our previous tweetheadline misrepresented the storyquot wrote npr quotwe deleted the previous tweet which was causing harm and have updated the storyquotp
pthe replacement tweet was a hrefhttpstwittercomnprstatus1460678038442622977only marginally bettera and the real issue was that the entire premise of the story itself was hopelessly flawed the initial tweet did not misrepresent the story at all it was an unending parade of outrage from social justice activists of color that bostonians had dared to elect an asian woman this weird obsession with race is tokenizing and insulting yet unfortunately has come to dominate nprs coverage as noted by journalist and podcaster katie herzogp
blockquote datawidth500 classtwittertweet datadnttrue
p langen dirltrit doesnt bother me that npr talks about race it bothers me than npr talks about race to the exclusion of everything else and that they have one acceptable narrative about race that no one ever deviates from a hrefhttpstcoi9svo9jf2jhttpstcoi9svo9jf2jap
p katie herzog kittypurrzog a hrefhttpstwittercomkittypurrzogstatus1356654262567063554ref_srctwsrc5etfwfebruary 2 2021apblockquote
pp
hr
h1quick hitsh1
ul
lifor emthe atlanticem david french a hrefhttpswwwtheatlanticcomideasarchive202111kylerittenhouserightselfdefenserolemodel620715explainsa that while kyle rittenhouse is plausibly innocent that does not make his actions heroic or praiseworthyli
liwhite house chief medical adviser anthony fauci is a hrefhttpswwwcnbccom20211116drfaucisaysuscovidcasesneedtofallbelow10000adaytogettoadegreeofnormalityhtmlmoving the goalposts againa saying that in order to get to prepandemic normal life cases in the us must fall below quotwell below 10000quot a dayli
lisome democratic strategists want to a hrefhttpsarchivemdajsx0defenda critical race theory and accuse republicans of putting quotwhite supremacistsquot in charge of the curriculumli
librad polumbo of the foundation for economic education raises a valid pointli
ul
blockquote datawidth500 classtwittertweet datadnttrue
p langen dirltri oppose vaccine mandates but i am individualist who believes in limited government p
phow can natcon conservatives oppose these mandates p
parent they just using the state to assert the quotcommon goodquot above individual autonomyaka what yall clamor forp
p brad polumbo img alt srchttpssworgimagescoreemoji131072x7226bdpng classwpsmiley brad_polumbo a hrefhttpstwittercombrad_polumbostatus1460636958959542275ref_srctwsrc5etfwnovember 16 2021apblockquote
pp
pthe post a relnofollow hrefhttpsreasoncom20211117ahmaudarberymurdertrialkylerittenhouseprosecution rests in ahmaud arbery murder triala appeared first on a relnofollow hrefhttpsreasoncomreasoncomap | div picture source sizesminwidth 600px 331px 100vw typeimagewebp srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202111sipaphotosten9805152400x1350jpgwebp 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202111sipaphotosten9805151200x675jpgwebp 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202111sipaphotosten980515800x450jpgwebp 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202111sipaphotosten980515600x338jpgwebp 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202111sipaphotosten980515331x186jpgwebp 331w source sizesminwidth 600px 331px 100vw typeimagejpeg srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202111sipaphotosten9805152400x1350jpg 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202111sipaphotosten9805151200x675jpg 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202111sipaphotosten980515800x450jpg 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202111sipaphotosten980515600x338jpg 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202111sipaphotosten980515331x186jpg 331w img width1200 altsipaphotosten980515 srchttpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202111sipaphotosten980515800x450jpg height675 picture div pwhile kyle rittenhouse trial largely captured medias attention weeks murder trial significant public interest happening timep pahmaud arbery 25yearold black man hrefhttpsreasoncom20200508ittookgeorgiaofficials2monthstoarrestandchargefatherandsonwithahmaudarberysmurderwas shot killeda gregory travis mcmichael father son pair brunswick georgia february 2020 neighbor william bryan jr charged trio white men accused chasing murdering arbery jogging neighborhoodp pthe prosecution rested case tuesday cnn hrefhttpswwwcnncom20211116usahmaudarberykillingtrialday8tuesdayindexhtmlreportsap blockquote p dataparagraphidparagraph_12808e9868d9993c093b2a2e18475d07 dataactidparagraph_8on tuesday georgia bureau investigation forensic pathologist dr edmund donoghuethe man performed arberys autopsydetailed arberys injuries jurors saw graphic photos examinationp p dataparagraphidparagraph_e23feec858af030319652a00dcb64a99 dataactidparagraph_9donoghuesa relnoopener hrefhttpswwwcnncom20200512usahmaudarberyvideowilliambryanindexhtml target_blankautopsy reportafrom april 2020 detail order arberys gunshot wounds happened testified tuesday combining autopsy widely seen cell phone video taken bryan arbery travis mcmichael seen video wrestling firearm shootingp p dataparagraphidparagraph_e74ee326e7d148469d822a00dd61479a dataactidparagraph_10though shots fired struck arbery donoghue testified grazed right wristhitting artery causing severe bleedingbut struck center chest saidstrongstrongp p dataparagraphidparagraph_06b830633990aad34a4c2a0b43e4ab5c dataactidparagraph_11the shot struck left chest armpit hitting axillary vein axillary artery donoghue testifiedp p dataparagraphidparagraph_afd1dd3a871604c826802a0b9d5ff2f7 dataactidparagraph_12while tourniquet remedied wrist injury scene save arberys life torso wounds donoghue saidp p dataparagraphidparagraph_614c3900e0197cf1c9132a0e79e1f53d dataactidparagraph_13prosecuting attorney linda dunikoski asked arberys set injuriesthe wrist chest hit shotcould quotconsistent pushing shotgun away themquot quotconsistent maybe grabbing shotgunquotp p dataparagraphidparagraph_936d3c1924ce519626ed2a1473c326c3 dataactidparagraph_14quotit yesquot donoghue answered questionsp blockquote pemthe washington postemhas morep div div dataqadropcapletter blockquote p dataeltextattorneys travis mcmichael client sought scare arbery quotdeescalatequot firing arbery got close fearing unarmed man mcmichaels weapon prosecutors contendbbthat mcmichael claim selfdefense father neighbor aggressorspursuing arbery trucks confronting coastal georgia neighborhood satilla shores february 2020p blockquote div div div div dataqadropcapletterdiv div pthe defense previously tried bar al sharpton sitting family victim arguing unsuccessfully hrefhttpsnewsyahoocomattorneysaysalsharptonmay204112363htmlamounted jury intimidationap pwhile rittenhouse trial hrefhttpsreasoncom20211109theprosecutionhadaverybaddayinthekylerittenhousetrialwhich increasingly looks like result acquittala wrongly framed media issue racial animus arbery case straightforward white men chased black man wrong killed didnt gun wasnt threatening easier argue mcmichaels aggressorsthough ultimately jury decidep hr h1free mindsh1 pjedediah bila fox news pundit host emthe viewemon tuesday appeared old program remote guest plug new book conversation went south quickly host joy behar brought fact bila unvaccinated necessitated remote setupp pbila explained vaccine quotmedical exemption vaccinequot cosigned different doctors quoti candidate vaccinequot said clarified antivaccine general health issuesand natural immunity prior covid19 infectionit sense vaccinep pthis perfectly sensible statement alarm hosts bila brought unfortunately true fact vaccines prevent transmission covid19 behar audience lost itp blockquote datawidth500 classtwittertweet datadnttrue p langen dirltrjedediah bila hrefhttpstwittercomhashtagtheviewsrchashref_srctwsrc5etfwtheviewa promote new book things went south like way south past mexico border south cohosts basically said dangerous air hrefhttpstcokt8nfkzid2pictwittercomkt8nfkzid2ap p chat liveonthechat hrefhttpstwittercomliveonthechatstatus1460648832023281669ref_srctwsrc5etfwnovember 16 2021apblockquote pp psunny hostin accused bila prioritizing quotyour personal freedom health safety othersquot stated thatemthe viewemshould allow bila voice quotdisinformationquot remarkable claim bila said emremotely falseemneverthelessemdaily beastem columnist wajahat ali celebrated hostin shutting bilap blockquote datawidth500 classtwittertweet datadnttrue p langen dirltrwell hrefhttpstwittercomsunnyref_srctwsrc5etfwsunnya anti vaxxers peddle dangerous disinformation dont right mainstream platforms gets normalized glad shut jedediah bila victim martyr p p hrefhttpstcokwkd7hpcgqhttpstcokwkd7hpcgqa hrefhttpstwittercomthedailybeastref_srctwsrc5etfwthedailybeastap p wajahat ali wajahatali hrefhttpstwittercomwajahatalistatus1460713583210283009ref_srctwsrc5etfwnovember 16 2021apblockquote pp pagain bila false claims claim natural immunity prior infection gives robust protection covid19 true claim vaccineswhile terrific reducing severe hospitalization deathdo prevent spread covid19 truep hr h1free marketsh1 pnpr americas governmentfunded media outlet hrefhttpswwwnprorg202111161055972179bostonfirstblackmayorutm_campaignnprutm_termnprnewsutm_mediumsocialutm_sourcetwittercompublished storya monday sounded negative note incoming boston mayor michelle wus historic winshes citys asian american mayorbecause beat black candidates heres screenshot tweetp pimg datacredittwitter sizesmaxwidth 1146px 100vw 1146px srchttpsd2eehagpk5cl65cloudfrontnetimgq60uploads202111screenshot20211116at121036pmpng alt width1146 srcsethttpsd2eehagpk5cl65cloudfrontnetimgq60uploads202111screenshot20211116at121036pmpng 1146w httpsd2eehagpk5cl65cloudfrontnetimgq60uploads202111screenshot20211116at121036pm300x263png 300w httpsd2eehagpk5cl65cloudfrontnetimgq60uploads202111screenshot20211116at121036pm1024x897png 1024w httpsd2eehagpk5cl65cloudfrontnetimgq60uploads202111screenshot20211116at121036pm768x673png 768w classwpimage8139232 height1004p pnpr subsequently deleted tweet receiving muchdeserved criticismp pquotwe realize dont things right time previous tweetheadline misrepresented storyquot wrote npr quotwe deleted previous tweet causing harm updated storyquotp pthe replacement tweet hrefhttpstwittercomnprstatus1460678038442622977only marginally bettera real issue entire premise story hopelessly flawed initial tweet misrepresent story unending parade outrage social justice activists color bostonians dared elect asian woman weird obsession race tokenizing insulting unfortunately come dominate nprs coverage noted journalist podcaster katie herzogp blockquote datawidth500 classtwittertweet datadnttrue p langen dirltrit doesnt bother npr talks race bothers npr talks race exclusion acceptable narrative race deviates hrefhttpstcoi9svo9jf2jhttpstcoi9svo9jf2jap p katie herzog kittypurrzog hrefhttpstwittercomkittypurrzogstatus1356654262567063554ref_srctwsrc5etfwfebruary 2 2021apblockquote pp hr h1quick hitsh1 ul liforemthe atlanticem david french hrefhttpswwwtheatlanticcomideasarchive202111kylerittenhouserightselfdefenserolemodel620715explainsa kyle rittenhouse plausibly innocent actions heroic praiseworthyli liwhite house chief medical adviser anthony fauci hrefhttpswwwcnbccom20211116drfaucisaysuscovidcasesneedtofallbelow10000adaytogettoadegreeofnormalityhtmlmoving goalposts againa saying order prepandemic normal life cases fall quotwell 10000quot dayli lisome democratic strategists want hrefhttpsarchivemdajsx0defenda critical race theory accuse republicans putting quotwhite supremacistsquot charge curriculumli librad polumbo foundation economic education raises valid pointli ul blockquote datawidth500 classtwittertweet datadnttrue p langen dirltri oppose vaccine mandates individualist believes limited government p phow natcon conservatives oppose mandates p parent state assert quotcommon goodquot individual autonomyaka yall clamor forp p brad polumbo img alt srchttpssworgimagescoreemoji131072x7226bdpng classwpsmiley brad_polumbo hrefhttpstwittercombrad_polumbostatus1460636958959542275ref_srctwsrc5etfwnovember 16 2021apblockquote pp pthe post relnofollow hrefhttpsreasoncom20211117ahmaudarberymurdertrialkylerittenhouseprosecution rests ahmaud arbery murder triala appeared relnofollow hrefhttpsreasoncomreasoncomap |
61982e6ce3c4ba27c852d132 | Washington Mayor Muriel Bowser Will Finally Relax D.C.'s Stubborn Mask Mandate | div
picture
source sizesminwidth 600px 331px 100vw typeimagewebp srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202111zumaglobaleleven2556612400x1350jpgwebp 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202111zumaglobaleleven2556611200x675jpgwebp 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202111zumaglobaleleven255661800x450jpgwebp 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202111zumaglobaleleven255661600x338jpgwebp 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202111zumaglobaleleven255661331x186jpgwebp 331w
source sizesminwidth 600px 331px 100vw typeimagejpeg srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202111zumaglobaleleven2556612400x1350jpg 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202111zumaglobaleleven2556611200x675jpg 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202111zumaglobaleleven255661800x450jpg 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202111zumaglobaleleven255661600x338jpg 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202111zumaglobaleleven255661331x186jpg 331w
img width1200 altzumaglobaleleven255661 srchttpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202111zumaglobaleleven255661800x450jpg height675
picture
div
pwashington dc mayor muriel bowser will finally relax the citys mask mandate she announced on tuesdayp
pon monday november 22 many indoor spaces will once again be allowed to forgo masks for customers visitors employees and residents notable exceptions include public schools public transportation and government buildingsp
blockquote datawidth500 classtwittertweet datadnttrue
p langen dirltrhere are the details of where masks will continue to be required in dc also businesses will still be able to set their own rules on indoor masking a hrefhttpstcoagm5mjeytnpictwittercomagm5mjeytnap
p martin austermuhle maustermuhle a hrefhttpstwittercommaustermuhlestatus1460647953518022656ref_srctwsrc5etfwnovember 16 2021apblockquote
pp
pquotwe are encouraged by the numbers that have opted into vaccination now some of them encouraged by mandatesquot a hrefhttpswwwwashingtonpostcomdcmdva20211116dcmaskmandateendssaida bowser according to emthe washington postem quotthere may even be an increase in casesbut what we havent seen is an increase in hospitalizations and deaths that is the promise of vaccinationquotp
pbowser previously rescinded the mask mandate then brought it back in july when covid19 cases began to increase due to the delta variant taking hold unlike the actions of local officials in nearby counties including in montgomery county maryland who linked the mandate to a certain case threshold bowser never gave any indication what metrics would be used to determine when to relax the mandate and while the delta wave did cause an increase in covid19 cases in washington it had no effect whatsoever on dcs death rate the citys sevenday death average has hovered at one or below the entire time that delta has been a serious issue it was last above one on may 24 2021p
pimg datacreditnew york times sizesmaxwidth 1186px 100vw 1186px srchttpsd2eehagpk5cl65cloudfrontnetimgq60uploads202111screenshot20211116at10128pm1png alt width1186 srcsethttpsd2eehagpk5cl65cloudfrontnetimgq60uploads202111screenshot20211116at10128pm1png 1186w httpsd2eehagpk5cl65cloudfrontnetimgq60uploads202111screenshot20211116at10128pm1300x170png 300w httpsd2eehagpk5cl65cloudfrontnetimgq60uploads202111screenshot20211116at10128pm11024x580png 1024w httpsd2eehagpk5cl65cloudfrontnetimgq60uploads202111screenshot20211116at10128pm1768x435png 768w classwpimage8139161 height672p
pit would be hard to argue that the mask mandate was what kept delta deaths at bay since all those masks failed to prevent cases from increasing widespread vaccinationwhich dramatically reduces severe disease and deathis the public health initiative thats working well not the mask mandatep
pyet bowsers administration leaned hard on mask mandates as a pandemic prevention tool even prioritizing them over vaccination in some curious cases when dc gyms petitioned the city government to allow them to require their customers to be vaccinated rather than masked for example a hrefhttpsreasoncom20210809washingtondcgymsmasksvaccinesbowsermandatecity health officials said noap
pbowsers decision to keep the mask mandate in place for schools is a perfect example of the governments incoherent thinking about covid19 risks while many schoolaged children remain unvaccinated they are at very low risk of a negative coronavirus health outcomea hrefhttpswwwvoxcom22699019covid19childrenkidsriskhospitalizationdeathwhether they are vaccinated or nota elderly americans who are vaccinated have much more to fear from covid19 than kids do so it makes little sense to link the withdrawal of mask mandates to the degree of vaccination among the kinds of people who congregate in a given locationp
pit is long past time to accept that covid19 is endemic and that there will always be some level of risk associated with it people can drastically reduce their risk by getting vaccinated getting booster shots or even practicing greater caution if they so choose it is not the governments responsibility to assign the correct level of risk to each individual american and local officials like bowser should not get to reimpose mask mandates just because they feel like itp
pthe post a relnofollow hrefhttpsreasoncom20211116murielbowsermaskmandatewashingtondccovid19washington mayor muriel bowser will finally relax dcs stubborn mask mandatea appeared first on a relnofollow hrefhttpsreasoncomreasoncomap | div picture source sizesminwidth 600px 331px 100vw typeimagewebp srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202111zumaglobaleleven2556612400x1350jpgwebp 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202111zumaglobaleleven2556611200x675jpgwebp 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202111zumaglobaleleven255661800x450jpgwebp 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202111zumaglobaleleven255661600x338jpgwebp 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202111zumaglobaleleven255661331x186jpgwebp 331w source sizesminwidth 600px 331px 100vw typeimagejpeg srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202111zumaglobaleleven2556612400x1350jpg 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202111zumaglobaleleven2556611200x675jpg 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202111zumaglobaleleven255661800x450jpg 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202111zumaglobaleleven255661600x338jpg 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202111zumaglobaleleven255661331x186jpg 331w img width1200 altzumaglobaleleven255661 srchttpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202111zumaglobaleleven255661800x450jpg height675 picture div pwashington dc mayor muriel bowser finally relax citys mask mandate announced tuesdayp pon monday november 22 indoor spaces allowed forgo masks customers visitors employees residents notable exceptions include public schools public transportation government buildingsp blockquote datawidth500 classtwittertweet datadnttrue p langen dirltrhere details masks continue required dc businesses able set rules indoor masking hrefhttpstcoagm5mjeytnpictwittercomagm5mjeytnap p martin austermuhle maustermuhle hrefhttpstwittercommaustermuhlestatus1460647953518022656ref_srctwsrc5etfwnovember 16 2021apblockquote pp pquotwe encouraged numbers opted vaccination encouraged mandatesquot hrefhttpswwwwashingtonpostcomdcmdva20211116dcmaskmandateendssaida bowser according toemthe washington postem quotthere increase casesbut havent seen increase hospitalizations deaths promise vaccinationquotp pbowser previously rescinded mask mandate brought july covid19 cases began increase delta variant taking hold unlike actions local officials nearby counties including montgomery county maryland linked mandate certain case threshold bowser gave indication metrics determine relax mandate delta wave cause increase covid19 cases washington effect whatsoever dcs death rate citys sevenday death average hovered entire time delta issue 24 2021p pimg datacreditnew york times sizesmaxwidth 1186px 100vw 1186px srchttpsd2eehagpk5cl65cloudfrontnetimgq60uploads202111screenshot20211116at10128pm1png alt width1186 srcsethttpsd2eehagpk5cl65cloudfrontnetimgq60uploads202111screenshot20211116at10128pm1png 1186w httpsd2eehagpk5cl65cloudfrontnetimgq60uploads202111screenshot20211116at10128pm1300x170png 300w httpsd2eehagpk5cl65cloudfrontnetimgq60uploads202111screenshot20211116at10128pm11024x580png 1024w httpsd2eehagpk5cl65cloudfrontnetimgq60uploads202111screenshot20211116at10128pm1768x435png 768w classwpimage8139161 height672p pit hard argue mask mandate kept delta deaths bay masks failed prevent cases increasing widespread vaccinationwhich dramatically reduces severe disease deathis public health initiative thats working mask mandatep pyet bowsers administration leaned hard mask mandates pandemic prevention tool prioritizing vaccination curious cases dc gyms petitioned city government allow require customers vaccinated masked example hrefhttpsreasoncom20210809washingtondcgymsmasksvaccinesbowsermandatecity health officials said noap pbowsers decision mask mandate place schools perfect example governments incoherent thinking covid19 risks schoolaged children remain unvaccinated low risk negative coronavirus health outcomea hrefhttpswwwvoxcom22699019covid19childrenkidsriskhospitalizationdeathwhether vaccinated nota elderly americans vaccinated fear covid19 kids makes little sense link withdrawal mask mandates degree vaccination kinds people congregate given locationp pit long past time accept covid19 endemic level risk associated people drastically reduce risk getting vaccinated getting booster shots practicing greater caution choose governments responsibility assign correct level risk individual american local officials like bowser reimpose mask mandates feel like itp pthe post relnofollow hrefhttpsreasoncom20211116murielbowsermaskmandatewashingtondccovid19washington mayor muriel bowser finally relax dcs stubborn mask mandatea appeared relnofollow hrefhttpsreasoncomreasoncomap |
619a8916ff41b25bdf59c97e | Scenes from the Supply Chain | pimg width768 alt srchttpss1freebeaconcomup202111santireviewbookcover768x536jpg height536ppspanin spanispanarriving today from factory to front doorwhy everything has changed about how and what we buyspanispan christopher mims announces his goal up front to convince you of quotthis astonishing fact you live inside a factory we all do and you are also a worker inside that factoryquot although spanispanarriving todayspanispan doesnt quite end up making that argument it paints a compelling picture of the elephantine supply chain that delivers products to our doorsteps needless to say its publication is timelyspanp
pspanmims who by day is a columnist at the spanispanwall street journalspanispan maintains a healthy skepticism of the supply chains mechanization and the ways in which the interchangeability of the systems components have made jobs in the industry more punishing and alienating his chapter on the cargo ship sailors who were trapped at sea for the better part of a year during covid is especially eyeopening but he balances skepticism with an infectious awe at the scale of the system quot90 percent of the worlds goods travel by shipquot he explains and as those ships cross the pacific they sit quot12 miles higher above the surface of earth than the peak of mt everestquot similar factoids dot the text along with insights into the humanmachine melding required to make the system work mims describes a ship as quota giant suit worn by its humansquot at another point he rides along as a harbor pilot takes quottotal command of the largest mobile manmade object on earthquot guiding it into its port resting place with inches to sparespanp
pspanbut spanispanarriving today spanispanalso manages to capture the quirky inefficient and deeply human parts of the supply chain as containers full of goods arrive in the los angeles port theyre unloaded onto land by massive cranes and then spend several days being quotgroomedquot or shuffled around into more accessible stacks by smaller cranes after a local trucker transports the container to another distribution center the goods are unpacked and enter americas longdistance trucking ecosystemspanp
pspanthis world is riddled with strange structural inefficiencies despite being essential and in high demand truckers are worked to the bone and paid little barely onethird of the 10 million americans with a commercial drivers license are working as truckers a sign of the industrys high turnover mims leads readers through the neon world of roadside truck stops and ably describes the murky regulations meant to protect truckers that indirectly endanger them logging devices introduced to track hours and stop truckers from driving sleepy end up increasing speeding from drivers without affecting the number of total crashesspanp
pspanalthough trucking is a messy business things change dramatically when we arrive at amazons warehouses over the course of the pandemic amazon increased its quotfrontline workforcequot by half crossing the millionemployee mark before mimss eyes the author describes the quotfundamental darwinianquot workplace culture where warehouse employees are constantly surveilled and compared with their compatriots mims argues that this system of quotstack rankingquot contributes to the high rates of injury in some warehouses four times higher than the industry average spanispanarriving today spanispanis at its most winsome when mims attempts to perform the physical exertions of warehouse and delivery workers and finds that quotindustrial athletesquot display levels of strength agility and endurance far beyond the typical office workers capacityspanp
pspanmims got lucky with his timing his narrative starting with a tour of vietnamese ports begins right as covid breaks out in china in 2020 as a result he gets to interweave the usual workings of the supply chain with the distended turmoil of the pandemic mims is an able chronicler of the changes and keeps one eye on the broader historical context quotwhat americas rust belt once was that swath of productive enterprise stretching from baltimore to the great lakes places like vietnam have becomeonly for the whole worldquotspanp
pspanif spanispanarriving today spanispanmerits a complaint its that its not long enough and thus misses the chance to break down the world of policy around global shipping and trade he hints at a number of fascinating rabbit holes without leading us down them for instance that the 11 major shipping companies are really just three quotocean alliancesquot that each share ships and containers internally the timespan covered in the book ends just before the long beach bottlenecks that made national newsspanp
pspanthere are a couple points where spanispanarriving today spanispanbreaks down hitler and fdr are included in a list of quotpeople whom history has mostly forgottenquot while crossing the pacific is quota study in contrastsquot mostly though mims keeps his prose tight and focused on the people who knit the world of goods together the filipino and ukrainian sailors flying panamanian flags weary american truckers and amazon warehouse workers ground down by quotdespotic taylorismquot those human cogs in the great machine enable a level of consumer convenience unthinkable to our ancestors mims leaves it to the reader to judge whether that convenience is worth the costspanp
pemarriving today from factory to front doorwhy everything has changed about how and what we buyembr
by christopher mimsbr
harper business 336 pp 2999p
pthe post a relnofollow hrefhttpsfreebeaconcomculturescenesfromthesupplychainscenes from the supply chaina appeared first on a relnofollow hrefhttpsfreebeaconcomwashington free beaconap | pimg width768 alt srchttpss1freebeaconcomup202111santireviewbookcover768x536jpg height536ppspanin spanispanarriving today factory doorwhy changed buyspanispan christopher mims announces goal convince quotthis astonishing fact live inside factory worker inside factoryquot spanispanarriving todayspanispan doesnt end making argument paints compelling picture elephantine supply chain delivers products doorsteps needless publication timelyspanp pspanmims day columnist spanispanwall street journalspanispan maintains healthy skepticism supply chains mechanization ways interchangeability systems components jobs industry punishing alienating chapter cargo ship sailors trapped sea better year covid especially eyeopening balances skepticism infectious awe scale system quot90 percent worlds goods travel shipquot explains ships cross pacific sit quot12 miles higher surface earth peak mt everestquot similar factoids dot text insights humanmachine melding required system work mims describes ship quota giant suit worn humansquot point rides harbor pilot takes quottotal command largest mobile manmade object earthquot guiding port resting place inches sparespanp pspanbut spanispanarriving today spanispanalso manages capture quirky inefficient deeply human parts supply chain containers goods arrive los angeles port theyre unloaded land massive cranes spend days quotgroomedquot shuffled accessible stacks smaller cranes local trucker transports container distribution center goods unpacked enter americas longdistance trucking ecosystemspanp pspanthis world riddled strange structural inefficiencies despite essential high demand truckers worked bone paid little barely onethird 10 million americans commercial drivers license working truckers sign industrys high turnover mims leads readers neon world roadside truck stops ably describes murky regulations meant protect truckers indirectly endanger logging devices introduced track hours stop truckers driving sleepy end increasing speeding drivers affecting number total crashesspanp pspanalthough trucking messy business things change dramatically arrive amazons warehouses course pandemic amazon increased quotfrontline workforcequot half crossing millionemployee mark mimss eyes author describes quotfundamental darwinianquot workplace culture warehouse employees constantly surveilled compared compatriots mims argues system quotstack rankingquot contributes high rates injury warehouses times higher industry average spanispanarriving today spanispanis winsome mims attempts perform physical exertions warehouse delivery workers finds quotindustrial athletesquot display levels strength agility endurance far typical office workers capacityspanp pspanmims got lucky timing narrative starting tour vietnamese ports begins right covid breaks china 2020 result gets interweave usual workings supply chain distended turmoil pandemic mims able chronicler changes keeps eye broader historical context quotwhat americas rust belt swath productive enterprise stretching baltimore great lakes places like vietnam becomeonly worldquotspanp pspanif spanispanarriving today spanispanmerits complaint long misses chance break world policy global shipping trade hints number fascinating rabbit holes leading instance 11 major shipping companies quotocean alliancesquot share ships containers internally timespan covered book ends long beach bottlenecks national newsspanp pspanthere couple points spanispanarriving today spanispanbreaks hitler fdr included list quotpeople history forgottenquot crossing pacific quota study contrastsquot mims keeps prose tight focused people knit world goods filipino ukrainian sailors flying panamanian flags weary american truckers amazon warehouse workers ground quotdespotic taylorismquot human cogs great machine enable level consumer convenience unthinkable ancestors mims leaves reader judge convenience worth costspanp pemarriving today factory doorwhy changed buyembr christopher mimsbr harper business 336 pp 2999p pthe post relnofollow hrefhttpsfreebeaconcomculturescenesfromthesupplychainscenes supply chaina appeared relnofollow hrefhttpsfreebeaconcomwashington free beaconap |
619a892bff41b25bdf59c980 | Monetary theory and crypto | pno i dont mean moneymacro such as debates over ngdp targeting or transitory inflation i mean oldfashioned a relnoopener hrefhttpswwwjstororgstablepdf2117496pdfcasa_tokenm4dictjcqisaaaaagqqtbbugdhvsazal6erdxrxri_f49xoifnd3z3qjddjxwyyhteq7r5czgkpdbdkaqyk_gaok6vl8vbxjv7wwnujnx8qmpiyqycc1vut5g1n1ydpg target_blankmonetary emtheoryema try all a relnoopener hrefhttpsscholargooglecomscholarcites6092007535456340217as_sdt544sciodt044hlen target_blankthese piecesa obviously many of those particular authors are now deceased or retired but take the field in general has it had emanythingem interesting to say about crypto developments i dont expect it to have empredictedem crypto or its price any more than i expect macroeconomists to have predicted recessions see scott sumner on that one but surely monetary theory should be able to help us better emunderstandem crypto and its pricep
phow much has it succeeded in that endeavor i have read and on strongmrstrong cited a number of nber and other academic working papers on crypto over the years or are you better off reading amateur pieces on medium and other sources cited on twitterp
pwhat should we infer from your answer to these questionsp
psurely any failings here are restricted to monetary theory alonep
pthe post a relnofollow hrefhttpmarginalrevolutioncommarginalrevolution202111monetarytheoryandcryptohtmlmonetary theory and cryptoa appeared first on a relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap | pno dont mean moneymacro debates ngdp targeting transitory inflation mean oldfashioned relnoopener hrefhttpswwwjstororgstablepdf2117496pdfcasa_tokenm4dictjcqisaaaaagqqtbbugdhvsazal6erdxrxri_f49xoifnd3z3qjddjxwyyhteq7r5czgkpdbdkaqyk_gaok6vl8vbxjv7wwnujnx8qmpiyqycc1vut5g1n1ydpg target_blankmonetary emtheoryema try relnoopener hrefhttpsscholargooglecomscholarcites6092007535456340217as_sdt544sciodt044hlen target_blankthese piecesa obviously particular authors deceased retired field general emanythingem interesting crypto developments dont expect empredictedem crypto price expect macroeconomists predicted recessions scott sumner surely monetary theory able help better emunderstandem crypto pricep phow succeeded endeavor read strongmrstrong cited number nber academic working papers crypto years better reading amateur pieces medium sources cited twitterp pwhat infer answer questionsp psurely failings restricted monetary theory alonep pthe post relnofollow hrefhttpmarginalrevolutioncommarginalrevolution202111monetarytheoryandcryptohtmlmonetary theory cryptoa appeared relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap |
619a893fff41b25bdf59c982 | The political risks of Big Data dominance | pbig data has big things in store for us the burgeoning industry devoted to collecting and analysing our every digital emission no matter how minute or mundane believes it has discovered the key to reading us and predicting if not prompting our behaviourp
psuch ambitions are not new political leaders and researchers throughout human history have thought they cracked the human code and could program us at will so what is different now why should we believe big data has figured us out and even if the data analysts are wrong what should we make of their hopes and designs and what should we fearp
pdata analysis is an esoteric science whose methods and conclusions are inscrutable to usa ato cite aa aa hrefhttpswwwnytimescom20120219magazineshoppinghabitshtmlfamous examplea data analysts working for the us retailer target deduced that particular female customers were pregnant by analysing their purchases of specific goods including vitamins lotions and cotton balls targets analysts were so astute that they could predict the womans due date to within a weekp
pfacebooks data analysts meanwhile know when we are falling in love or breaking up through careful study they a hrefhttpswwwforbescomsitesianmorris20161231facebookknowswhenyoufallinloveandthatsprettycreepysh41328e0c6f52determineda that couples about to be official will post167 times per day in the 12 days before they publicly change their profile to in a relationship the number of posts then falls to 153 posts per day in the next 85 days [while] the number of interactions drops as the relationship starts theres also an uptick in the level of positivity this includes the use of the words like love nice happy and[subtracting] negative words like hate hurt and badp
pin another alarming example surveillance scholar a hrefhttpswwwnewstatesmancomencounter202103shoshanazuboffwhybigtechbiggestthreatdemocracyshoshana zuboffa explains in ema hrefhttpswwwpublicaffairsbookscomtitlesshoshanazubofftheageofsurveillancecapitalism9781610395694the age of surveillance capitalisma emhow online lenders deploy data analysis to determine creditworthiness through detailed mining of an individuals smartphone and other online behaviours they extract salient data which includes the frequency with which you charge your phone battery the number of incoming messages you receive if and when you return phone calls how many contacts you have listed in your phone how you fill out online forms or how many miles you travel each day how do they make sense of this data its hard to sayp
pit is clear however that data analysts aim to uncover our vulnerabilities why else would facebook want to know if we are falling in love or breaking up we are especially irrational or pliable in those states and advertisers facebooks real clients would love to be aware of that and when armed with our intimate information analytically savvy advertisers may influence our behaviour and turn us into the customers they have always wanted us to bep
pzuboff suggests that big data is enamoured with the thinking of 20thcentury behavioural psychologist bf skinnera askinner harboured controversial views such as the notion that knowledge and freedom are contrary to one another our actions only seem free so long as their causes and motivations are not understood when we are fully understood we will see that our actions are perfectly predictable and our freedom illusory in fact skinner a hrefhttpswwwgooglecombookseditionbeyond_freedom_and_dignity78pgdwaaqbajhlengbpv1dqskinnerbeyondfreedomanddignityprintsecfrontcoverbelieveda that the notion of an autonomous man obstructs our rational future and stifles our progress the rational future is technocracy where choice in key matters is taken out of the hands of errant individuals and vested in experts who know us read us and understand what we truly needp
pskinners convictions and aspirations are reminiscent of a distinctive strain of rationalism that the conservative philosopher michael oakeshott detected in 20thcentury political thinking this rationalism a hrefhttpswwwlibertyfundorgbooksrationalisminpoliticsandotheressaysoakeshott explainsa combines a politics of perfection and a politics of uniformity specifically rationalists believe that political problems can be solved by ensuring that political institutions correspond with an ideal form of government and instead of drawing on history and experience to deal with political conflicts rationalists rely on their technical understanding of human nature and societyp
pstrongem[see also a hrefhttpswwwnewstatesmancomlongreads202110whowantstoliveforeverbigtechandthequestforeternalyouthwho wants to live forever big tech and the quest for eternal youtha]emstrongp
paccording to the rationalist approach humans ultimately need to be purged of the habits that hold them back and then reprogrammed to achieve the model political community oakeshotts account of rationalism captures the mindset behind stalins industrial policies and a hrefhttpswwwnewstatesmancompolitics201605wereach50thanniversarychinasculturalrevolutionareweseeingechoesmaomaos cultural revolutiona and tellingly the ussr and the chinese communist party each sought to erase tradition and radically renew society by forcing their citizens and institutions to conform with a political idealp
phistory however has shown that the search for and supposed implementation of human perfection and uniformity is a recipe for bloodshed as the eminent intellectual historian isaiah berlin famously put it humanity is made of a hrefhttpspressprincetonedubookspaperback9780691155937thecrookedtimberofhumanitycrooked timbera we diverge in countless ways some remarkable some minute and s forc[ing] people into the neat uniforms demanded by dogmatically believedin schemes is almost always the road to inhumanityp
pwhats more presuming to understand humanity is itself a violent act it is a kind of conquest that indicates the hubris and danger of political rationalists to a hrefhttpswwwwashingtonpostcomlifestylestylerumsfelddeadwordsknownunknowns20210701831175c2d9df11ebbb9e70fda8c37057_storyhtmlcitea the late donald rumsfeld defence secretary under george w bush there are unknown unknowns in the human psyche and when leaders claim to grasp the human condition freedom and diversity are easily sacrificed for the sake of a greater vision in fact it is this kind of sacrifice that stalin and mao demanded packaged under the seemingly benign bureaucratic title of central planning and their technocratic social experiments caused untold sufferingp
pwhat does this tell us about big data what does its dubious intellectual lineage portend with the help of artificial intelligence ai data analysts lay claim to ever more of your soul researchers have deployed ai for diagnosing mental health for example by listening to the human voice and analysing its tone pitch and volume this is ingenious and very helpful for people who dont have the option of visiting a therapistp
pbut if you are as predictable as the data analysts claim and if data analysts are vested with great power they may be tempted to use this technology for less admirable ends in fact one company now a hrefhttpsventurebeatcom20201118cogitoraises25milliontoanalyzephonecallswithaioffersa ai mental health technology to telemarketers ostensibly so that they can better empathise with customers but it could also be used to help lure them in this would be a devious use of a technology designed to detect when people are at their most vulnerablep
pdata analysts enamoured by their own talents expand the bounds of experimentation facebook which knows when we are falling in love has developed techniques for influencing our moods by exposing us to select posts and ads it has also a hrefhttpswwwnaturecomarticlesnature201211401deployeda its algorithms to boost voter turnout a feat that was subsequently a hrefhttpswwwnprorg20180320595338116whatdidcambridgeanalyticadoduringthe2016electionemulateda by cambridge analytica in 2016p
pfundamentally data analysis is focused on detecting our every need and want before were even aware of them ourselves analysts have become very good at this and thus have enabled advertisers to serve us better but there is a danger in the science of big datap
plike political rationalists data analysts may think they know best when we are presented as a set of data points that can be pushed and prodded by the expert analyst we run the risk of being objectified and having our autonomy undermined and this means big data opens the door to gross inhumanityp
pyet despite this worrisome similarity there is a key difference between rationalism in politics and big data unlike the technocrats who served under stalin and mao data analysts do not have a monopoly on political power this means we have an opportunity to enact government legislation to limit the power of big data and mitigate its potential for abusep
pwe can for example restrict the uses to which analysts apply their insights sensitive information such as whether we suffer from anxiety or depression should be revealed to medical professionals only privacy regulations which inform consumers about the data sought and how it will be used may be helpful tech firms that meddle in elections should be severely punished and antitrust legislation targeting the tech industry a hrefhttpswwwnewstatesmancomsciencetech202106whylinakhancouldbebigtechsnewworstenemycould dismantle big data companiesa and whittle them down to a more manageable sizep
pone thing however is clear we cannot count on big data to admit its own fallibility and hold its ambitions in check p
pemfirmin debrabander is professor of philosophy at the maryland institute college of art he is the author of ema hrefhttpswwwcambridgeorgcorebookslifeafterprivacyaea24bf45f6a4e959e467eb3299f705aemlife after privacyema cambridge university pressp
pemthis article is part of the ema hrefhttpswwwnewstatesmancompolitics202105agoraamarketplaceofideasemagoraemaem series a collaboration between the new statesman and aaron james wendland wendland is vision fellow in public philosophy at kings college london and a senior research fellow at massey college toronto he tweets ema hrefhttpstwittercomaj_wendlandemaj_wendlandemaememememp | pbig data big things store burgeoning industry devoted collecting analysing digital emission matter minute mundane believes discovered key reading predicting prompting behaviourp psuch ambitions new political leaders researchers human history thought cracked human code program different believe big data figured data analysts wrong hopes designs fearp pdata analysis esoteric science methods conclusions inscrutable usa ato cite aa aa hrefhttpswwwnytimescom20120219magazineshoppinghabitshtmlfamous examplea data analysts working retailer target deduced particular female customers pregnant analysing purchases specific goods including vitamins lotions cotton balls targets analysts astute predict womans date weekp pfacebooks data analysts know falling love breaking careful study hrefhttpswwwforbescomsitesianmorris20161231facebookknowswhenyoufallinloveandthatsprettycreepysh41328e0c6f52determineda couples official post167 times day 12 days publicly change profile relationship number posts falls 153 posts day 85 days [while] number interactions drops relationship starts theres uptick level positivity includes use words like love nice happy and[subtracting] negative words like hate hurt badp pin alarming example surveillance scholar hrefhttpswwwnewstatesmancomencounter202103shoshanazuboffwhybigtechbiggestthreatdemocracyshoshana zuboffa explains ema hrefhttpswwwpublicaffairsbookscomtitlesshoshanazubofftheageofsurveillancecapitalism9781610395694the age surveillance capitalisma emhow online lenders deploy data analysis determine creditworthiness detailed mining individuals smartphone online behaviours extract salient data includes frequency charge phone battery number incoming messages receive return phone calls contacts listed phone fill online forms miles travel day sense data hard sayp pit clear data analysts aim uncover vulnerabilities facebook want know falling love breaking especially irrational pliable states advertisers facebooks real clients love aware armed intimate information analytically savvy advertisers influence behaviour turn customers wanted bep pzuboff suggests big data enamoured thinking 20thcentury behavioural psychologist bf skinnera askinner harboured controversial views notion knowledge freedom contrary actions free long causes motivations understood fully understood actions perfectly predictable freedom illusory fact skinner hrefhttpswwwgooglecombookseditionbeyond_freedom_and_dignity78pgdwaaqbajhlengbpv1dqskinnerbeyondfreedomanddignityprintsecfrontcoverbelieveda notion autonomous man obstructs rational future stifles progress rational future technocracy choice key matters taken hands errant individuals vested experts know read understand truly needp pskinners convictions aspirations reminiscent distinctive strain rationalism conservative philosopher michael oakeshott detected 20thcentury political thinking rationalism hrefhttpswwwlibertyfundorgbooksrationalisminpoliticsandotheressaysoakeshott explainsa combines politics perfection politics uniformity specifically rationalists believe political problems solved ensuring political institutions correspond ideal form government instead drawing history experience deal political conflicts rationalists rely technical understanding human nature societyp pstrongem[see hrefhttpswwwnewstatesmancomlongreads202110whowantstoliveforeverbigtechandthequestforeternalyouthwho wants live forever big tech quest eternal youtha]emstrongp paccording rationalist approach humans ultimately need purged habits hold reprogrammed achieve model political community oakeshotts account rationalism captures mindset stalins industrial policies hrefhttpswwwnewstatesmancompolitics201605wereach50thanniversarychinasculturalrevolutionareweseeingechoesmaomaos cultural revolutiona tellingly ussr chinese communist party sought erase tradition radically renew society forcing citizens institutions conform political idealp phistory shown search supposed implementation human perfection uniformity recipe bloodshed eminent intellectual historian isaiah berlin famously humanity hrefhttpspressprincetonedubookspaperback9780691155937thecrookedtimberofhumanitycrooked timbera diverge countless ways remarkable minute s forc[ing] people neat uniforms demanded dogmatically believedin schemes road inhumanityp pwhats presuming understand humanity violent act kind conquest indicates hubris danger political rationalists hrefhttpswwwwashingtonpostcomlifestylestylerumsfelddeadwordsknownunknowns20210701831175c2d9df11ebbb9e70fda8c37057_storyhtmlcitea late donald rumsfeld defence secretary george w bush unknown unknowns human psyche leaders claim grasp human condition freedom diversity easily sacrificed sake greater vision fact kind sacrifice stalin mao demanded packaged seemingly benign bureaucratic title central planning technocratic social experiments caused untold sufferingp pwhat tell big data dubious intellectual lineage portend help artificial intelligence ai data analysts lay claim soul researchers deployed ai diagnosing mental health example listening human voice analysing tone pitch volume ingenious helpful people dont option visiting therapistp pbut predictable data analysts claim data analysts vested great power tempted use technology admirable ends fact company hrefhttpsventurebeatcom20201118cogitoraises25milliontoanalyzephonecallswithaioffersa ai mental health technology telemarketers ostensibly better empathise customers help lure devious use technology designed detect people vulnerablep pdata analysts enamoured talents expand bounds experimentation facebook knows falling love developed techniques influencing moods exposing select posts ads hrefhttpswwwnaturecomarticlesnature201211401deployeda algorithms boost voter turnout feat subsequently hrefhttpswwwnprorg20180320595338116whatdidcambridgeanalyticadoduringthe2016electionemulateda cambridge analytica 2016p pfundamentally data analysis focused detecting need want aware analysts good enabled advertisers serve better danger science big datap plike political rationalists data analysts think know best presented set data points pushed prodded expert analyst run risk objectified having autonomy undermined means big data opens door gross inhumanityp pyet despite worrisome similarity key difference rationalism politics big data unlike technocrats served stalin mao data analysts monopoly political power means opportunity enact government legislation limit power big data mitigate potential abusep pwe example restrict uses analysts apply insights sensitive information suffer anxiety depression revealed medical professionals privacy regulations inform consumers data sought helpful tech firms meddle elections severely punished antitrust legislation targeting tech industry hrefhttpswwwnewstatesmancomsciencetech202106whylinakhancouldbebigtechsnewworstenemycould dismantle big data companiesa whittle manageable sizep pone thing clear count big data admit fallibility hold ambitions checkp pemfirmin debrabander professor philosophy maryland institute college art author ema hrefhttpswwwcambridgeorgcorebookslifeafterprivacyaea24bf45f6a4e959e467eb3299f705aemlife privacyema cambridge university pressp pemthis article ema hrefhttpswwwnewstatesmancompolitics202105agoraamarketplaceofideasemagoraemaem series collaboration new statesman aaron james wendland wendland vision fellow public philosophy kings college london senior research fellow massey college toronto tweets ema hrefhttpstwittercomaj_wendlandemaj_wendlandemaememememp |
619a8944ff41b25bdf59c984 | The weirdness of government variation in Covid-19 responses | pthat is the a relnoopener hrefhttpsrichardhananiasubstackcomptheweirdnessofgovernmentvariationtokeneyj1c2vyx2lkijo0nzyxlcjwb3n0x2lkijo0ndi4nta2nswixyi6ilfetmxhiiwiawf0ijoxnjm3ndq3nzgwlcjlehaioje2mzc0ntezodasimlzcyi6inb1yi05odewmiisinn1yii6inbvc3qtcmvhy3rpb24ifqz94pl3jjojsr9h9zojlz8d4doh0yn8ovhldlsd3kc target_blanknew substack post from richard hananiaa here is one excerptp
blockquotepbut imagine at the start of the pandemic someone had said to you everyone will face the existence of the same disease and have access to the exact same tools to fight it but in some eu countries or us states people wont be allowed to leave their house and have to cover their faces in public in other places government will just leave people alone vast differences of this sort will exist across jurisdictions that are similar on objective metrics of how bad the pandemic is at any particular momentp
pi wouldve found this to be a very unlikely outcome you couldve convinced me eu states would do very little on covid19 or that they would do lockdowns everywhere i would not have believed that you could have two neighboring countries that have similar numbers but one of them forces everyone to stay home while the other doesnt this is the kind of extreme variation in policy we dont see in other areasp
pits similar when you look at american jurisdictionspblockquote
pandp
blockquotepas the political reaction to covid19 has surprised me im still trying to figure it out but for now i can say its shifted my priors in a few wayspblockquote
ol
lipeople are more conformist than i would have thought being willing to put up with a lot more than i expected at least in europe and the blue parts of the usli
liamericans in red states are more instinctively antielite than i would have thought and can be outliers on all kinds of policy issues relative to the rest of the developed world i guess i knew that alreadyli
lipartisanship is much stronger than i thought when i saw polls on antivax sentiment early in the pandemic i actually said it would disappear when people would have to make decisions about their own lives and everyone could see vaccines work this largely a rel hrefhttpswwwnytimescom20210927briefingcovidredstatesvaccinationshtmldidnt happena liberals in blue states masking their kids outdoors is the other side of this coin most redblue team go behavior has little influence on peoples lives for example deciding to vote d or r or watch msnbc or fox really doesnt matter for your personal wellbeing not getting vaccinated or never letting your children leave the house does and i dont recall many cases where partisanship has been such a strong predictor of behavior that has such radical effects on peoples livesli
ligovernment measures that once seemed extreme can become normalized very quicklyli
lithe kinds of issues that actually matter electorally are a lot more sticky than i would have expected issues like masks and lockdowns though objectively much more important than the things people vote on are not as politically salient as i would have thought a mask mandate for children eight hours a day strikes me as a lot more important than inflation but it seems not to be for electoral purposes if an asteroid was about to destroy earth and democrats and republicans had different views on how to stop it people would just unthinkingly believe whatever their own side told them and it would not change our politics at allli
lidemocratically elected governments have a lot more freedom than i thought before especially if elites claim that they are outsourcing decisions to the science moreover the science doesnt even have to be that convincing and nobody will ask obvious questions like how the science can allow for radically different policy responses in neighboring jurisdictions without much of a difference in results this appears true everywhere in the developed world but in red state america where people really hate experts regardless of whether theyre right or wrongli
ol
pyou should all be getting a relnoopener hrefhttpsrichardhananiasubstackcomsubscribeutm_mediumwebutm_sourcepostendctautm_content44285065 target_blankrichards substacka of all the new thinkers on the right he is the one who most combines extreme smarts and firstrate work ethic with nonconformism thrown in to boot read himp
pthe post a relnofollow hrefhttpmarginalrevolutioncommarginalrevolution202111theweirdnessofgovernmentvariationincovid19responseshtmlthe weirdness of government variation in covid19 responsesa appeared first on a relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap | pthat relnoopener hrefhttpsrichardhananiasubstackcomptheweirdnessofgovernmentvariationtokeneyj1c2vyx2lkijo0nzyxlcjwb3n0x2lkijo0ndi4nta2nswixyi6ilfetmxhiiwiawf0ijoxnjm3ndq3nzgwlcjlehaioje2mzc0ntezodasimlzcyi6inb1yi05odewmiisinn1yii6inbvc3qtcmvhy3rpb24ifqz94pl3jjojsr9h9zojlz8d4doh0yn8ovhldlsd3kc target_blanknew substack post richard hananiaa excerptp blockquotepbut imagine start pandemic said face existence disease access exact tools fight eu countries states people wont allowed leave house cover faces public places government leave people vast differences sort exist jurisdictions similar objective metrics bad pandemic particular momentp pi wouldve found unlikely outcome couldve convinced eu states little covid19 lockdowns believed neighboring countries similar numbers forces stay home doesnt kind extreme variation policy dont areasp pits similar look american jurisdictionspblockquote pandp blockquotepas political reaction covid19 surprised im trying figure shifted priors wayspblockquote ol lipeople conformist thought willing lot expected europe blue parts usli liamericans red states instinctively antielite thought outliers kinds policy issues relative rest developed world guess knew alreadyli lipartisanship stronger thought saw polls antivax sentiment early pandemic actually said disappear people decisions lives vaccines work largelya rel hrefhttpswwwnytimescom20210927briefingcovidredstatesvaccinationshtmldidnt happenaliberals blue states masking kids outdoors coin redblue team behavior little influence peoples lives example deciding vote d r watch msnbc fox doesnt matter personal wellbeing getting vaccinated letting children leave house dont recall cases partisanship strong predictor behavior radical effects peoples livesli ligovernment measures extreme normalized quicklyli lithe kinds issues actually matter electorally lot sticky expected issues like masks lockdowns objectively important things people vote politically salient thought mask mandate children hours day strikes lot important inflation electoral purposes asteroid destroy earth democrats republicans different views stop people unthinkingly believe told change politics allli lidemocratically elected governments lot freedom thought especially elites claim outsourcing decisions science science doesnt convincing ask obvious questions like science allow radically different policy responses neighboring jurisdictions difference results appears true developed world red state america people hate experts regardless theyre right wrongli ol pyou getting relnoopener hrefhttpsrichardhananiasubstackcomsubscribeutm_mediumwebutm_sourcepostendctautm_content44285065 target_blankrichards substacka new thinkers right combines extreme smarts firstrate work ethic nonconformism thrown boot read himp pthe post relnofollow hrefhttpmarginalrevolutioncommarginalrevolution202111theweirdnessofgovernmentvariationincovid19responseshtmlthe weirdness government variation covid19 responsesa appeared relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap |
619a896eff41b25bdf59c986 | Richard Stroup alas has passed away | phere is a relnoopener hrefhttpsenwikipediaorgwikirichard_l_stroup target_blankhis wikipedia pagea among his other contributions he coauthored an excellent economics textbook with gwartney and he was a founding father of free market environmentalism ripp
pthe post a relnofollow hrefhttpmarginalrevolutioncommarginalrevolution202111richardstroupalashaspassedawayhtmlrichard stroup alas has passed awaya appeared first on a relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap | phere relnoopener hrefhttpsenwikipediaorgwikirichard_l_stroup target_blankhis wikipedia pagea contributions coauthored excellent economics textbook gwartney founding father free market environmentalism ripp pthe post relnofollow hrefhttpmarginalrevolutioncommarginalrevolution202111richardstroupalashaspassedawayhtmlrichard stroup alas passed awaya appeared relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap |
619a89f6ff41b25bdf59c99a | The Great Resignation: Health Care Workers | pimg sizesmaxwidth 768px 100vw 768px srchttpmarginalrevolutioncomwpcontentuploads202111healthcareworkerspng alt width768 srcsethttpmarginalrevolutioncomwpcontentuploads202111healthcareworkerspng 1168w httpmarginalrevolutioncomwpcontentuploads202111healthcareworkers300x116png 300w httpmarginalrevolutioncomwpcontentuploads202111healthcareworkers1024x395png 1024w httpmarginalrevolutioncomwpcontentuploads202111healthcareworkers768x296png 768w classwpimage82402 height296we are short a million health care workers today with extreme stress on the system there are 16 million health care workers about five hundred thousand fewer than when the pandemic began in january of 2020 and about one million fewer than would be expected based on decades of growth a loss of this many workers is unprecedentedp
ped yong in the atlantic discusses a hrefhttpswwwtheatlanticcomhealtharchive202111themassexodusofamericashealthcareworkers620713why healthcare workers are quitting in drovesap
blockquote
pspanhealthcare workersspan under any circumstances live in the thick of death stress and trauma you go in knowing those are the things youll see cassandra werry an icu nurse currently working in idaho told me not everyone pulls through but at the end of the day the point is to get people better you strive for those wins covid19 has upset that balance confronting even experienced people with the worst conditions they have ever faced and turning difficult jobs into unbearable onesp
pin the spring of 2020 id walk past an ice truck of dead bodies and pictures on the wall of cleaning staff and nurses whod died into a room with more dead bodies lindsay fox a former emergencymedicine doctor from newark new jersey told me at the same time artec durham an icu nurse from flagstaff arizona was watching his hospital fill with patients from the navajo nation nearly every one of them died and there was nothing we could do he said we ran out of body bagsp
pmany healthcare workers imagined that such traumas were behind them once the vaccines arrived but plateauing vaccination rates premature lifts on masking and a hrefhttpswwwtheatlanticcomhealtharchive202108deltahaschangedpandemicendgame619726the ascendant delta varianta undid those hopes a hrefhttpswwwtheatlanticcomhealtharchive202107deltamissouripandemicsurge619456this summer many hospitals clogged up emagainema as patients waited to be admitted into icus they filled emergency rooms and then waiting rooms and hallways that unrealized promise of some sort of normalcy has made the feelings of exhaustion and frustration worse bettencourt told mep
phealthcare workers want to help their patients and their inability to do so properly is hollowing them out especially now with delta not many people get better and go home werry told me people have asked her if she would have gone to nursing school had she known the circumstances she would encounter and for her its a resounding no she said werry quit her job in an arizona hospital last december and plans on leaving medicine once she pays off her student debtsp
pmany have told me that theyre boneweary depressed irritable and unusually for them unable to hide any of that nurses excel at feeling their feelings in a supply closet or bathroom and then putting their game face back on and jumping into the ring werry said but she and others are now constantly on the verge of tears or prone to snapping at colleagues and patients some call this emburnoutem but gerard brogan the director of nursing practice at national nurses united dislikes the term because it implies a lack of character he told me he prefers a hrefhttpsjournalofethicsamaassnorgarticlewhoexperiencingwhatkindmoraldistressdistinctionsmovingnarrowbroaddefinitionmoraldistress201706emmoral distressemathe anguish of being unable to take the course of action that you know is rightp
phealthcare workers arent quitting because they cant handle their jobs theyre quitting because they cant handle embeing unable to do their jobsemp
blockquote
phat tip a hrefhttpstwittercommattyglesiasstatus1461152068157284352s20matt yglesiasap
pthe post a relnofollow hrefhttpmarginalrevolutioncommarginalrevolution202111thegreatresignationhealthcareworkershtmlthe great resignation health care workersa appeared first on a relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap | pimg sizesmaxwidth 768px 100vw 768px srchttpmarginalrevolutioncomwpcontentuploads202111healthcareworkerspng alt width768 srcsethttpmarginalrevolutioncomwpcontentuploads202111healthcareworkerspng 1168w httpmarginalrevolutioncomwpcontentuploads202111healthcareworkers300x116png 300w httpmarginalrevolutioncomwpcontentuploads202111healthcareworkers1024x395png 1024w httpmarginalrevolutioncomwpcontentuploads202111healthcareworkers768x296png 768w classwpimage82402 height296we short million health care workers today extreme stress system 16 million health care workers thousand fewer pandemic began january 2020 million fewer expected based decades growth loss workers unprecedentedp ped yong atlantic discusses hrefhttpswwwtheatlanticcomhealtharchive202111themassexodusofamericashealthcareworkers620713why healthcare workers quitting drovesap blockquote pspanhealthcare workersspan circumstances live thick death stress trauma knowing things youll cassandra werry icu nurse currently working idaho told pulls end day point people better strive wins covid19 upset balance confronting experienced people worst conditions faced turning difficult jobs unbearable onesp pin spring 2020 id walk past ice truck dead bodies pictures wall cleaning staff nurses whod died room dead bodies lindsay fox emergencymedicine doctor newark new jersey told time artec durham icu nurse flagstaff arizona watching hospital fill patients navajo nation nearly died said ran body bagsp pmany healthcare workers imagined traumas vaccines arrived plateauing vaccination rates premature lifts masking hrefhttpswwwtheatlanticcomhealtharchive202108deltahaschangedpandemicendgame619726the ascendant delta varianta undid hopes hrefhttpswwwtheatlanticcomhealtharchive202107deltamissouripandemicsurge619456this summer hospitals clogged emagainema patients waited admitted icus filled emergency rooms waiting rooms hallways unrealized promise sort normalcy feelings exhaustion frustration worse bettencourt told mep phealthcare workers want help patients inability properly hollowing especially delta people better home werry told people asked gone nursing school known circumstances encounter resounding said werry quit job arizona hospital december plans leaving medicine pays student debtsp pmany told theyre boneweary depressed irritable unusually unable hide nurses excel feeling feelings supply closet bathroom putting game face jumping ring werry said constantly verge tears prone snapping colleagues patients emburnoutem gerard brogan director nursing practice national nurses united dislikes term implies lack character told prefers hrefhttpsjournalofethicsamaassnorgarticlewhoexperiencingwhatkindmoraldistressdistinctionsmovingnarrowbroaddefinitionmoraldistress201706emmoral distressemathe anguish unable course action know rightp phealthcare workers arent quitting cant handle jobs theyre quitting cant handle embeing unable jobsemp blockquote phat tip hrefhttpstwittercommattyglesiasstatus1461152068157284352s20matt yglesiasap pthe post relnofollow hrefhttpmarginalrevolutioncommarginalrevolution202111thegreatresignationhealthcareworkershtmlthe great resignation health care workersa appeared relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap |
619a8a3cff41b25bdf59c9a8 | Nellie Bowles interviews me on inflation | blockquotepso i called someone smart tyler cowen an economist a rel hrefhttpswwwpenguinrandomhousecombooks265612thegreatstagnationbytylercowenauthora and professor at george mason university to explain the dynamics to mep
pinflation right now is still transitory in that we can choose to end it cowen told me the federal reserve could disinflate and raise interest ratesa rel hrefhttpswwwfoxbusinesscompersonalfinancetodaysmortgageratesnovember172021mortgage interest rates today remain well below 3athough that risks starting a recessionp
pcowen explained that the reason the inflationwary are still pretty quiet is that all the antiobama republicans were so wrong in 2008 after the obamaera bailout during the great recession republicans were convinced inflation would run rampant and they said so a lot but inflation stayed mostly in control they all got egg on their faces after that cowen said so the crowd that would complain now theyre whispering about it but not shouting yet a rel hrefhttpswwwnytimescom20211116opinionbideninflationspendingmanchinhtmllarry summers and steve rattner have sounded the alarmap
pi think the inflation will last two to three years and it will be bad cowen said but really grim hyperinflation la carterera he thinks is unlikely it could only happen if the federal reserve decides its too risky to trim the sails of cheap money id put it at 20 chance that the fed will think trump might run again and we dont want biden to lose historys in our hands so well wait to tighten and then it just goes on and then its very badp
pbut a recession is also bad its hard to sort it all out as the saying goes if youre not confused you dont know whats going on cowen told mepblockquote
pthat is a relnoopener hrefhttpsbariweisssubstackcomptgifinflationrisesrussiagatefalls target_blankfrom the bari weiss substacka other topics are considerd not by me at the linkp
pthe post a relnofollow hrefhttpmarginalrevolutioncommarginalrevolution202111nelliebowlesinterviewsmeoninflationhtmlnellie bowles interviews me on inflationa appeared first on a relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap | blockquotepso called smart tyler cowen economista rel hrefhttpswwwpenguinrandomhousecombooks265612thegreatstagnationbytylercowenauthora professor george mason university explain dynamics mep pinflation right transitory choose end cowen told federal reserve disinflate raise interest ratesa rel hrefhttpswwwfoxbusinesscompersonalfinancetodaysmortgageratesnovember172021mortgage interest rates today remain 3athough risks starting recessionp pcowen explained reason inflationwary pretty quiet antiobama republicans wrong 2008 obamaera bailout great recession republicans convinced inflation run rampant said lot inflation stayed control got egg faces cowen said crowd complain theyre whispering shouting rel hrefhttpswwwnytimescom20211116opinionbideninflationspendingmanchinhtmllarry summers steve rattner sounded alarmap pi think inflation years bad cowen said grim hyperinflation la carterera thinks unlikely happen federal reserve decides risky trim sails cheap money id 20 chance fed think trump run dont want biden lose historys hands wait tighten goes badp pbut recession bad hard sort saying goes youre confused dont know whats going cowen told mepblockquote pthat relnoopener hrefhttpsbariweisssubstackcomptgifinflationrisesrussiagatefalls target_blankfrom bari weiss substacka topics considerd linkp pthe post relnofollow hrefhttpmarginalrevolutioncommarginalrevolution202111nelliebowlesinterviewsmeoninflationhtmlnellie bowles interviews inflationa appeared relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap |
619a8a4aff41b25bdf59c9ac | What is the income-happiness gradient for dogs? | blockquotepgunther the german shepherd spent a recent morning playing with his tennis ball rolling in the grass slobbering a little and napping a lot later he had a meeting with the real estate agents selling his miami mansion that his handlers bought from madonnap
pand of course gunther was wearing his very best faux diamond dog collar for the meeting his real gold collar is back at his main home in tuscany as crazy as it sounds even by floridas standards gunther vi inherited his vast fortune including the eightbedroom waterfront home once owned by the material girl singer from his grandfather gunther iv at least thats what the handlers who manage the estate sayp
pthe tuscanstyle villa with views of biscayne bay went on sale wednesday for 3175 million a whopping markup from the purchase two decades ago from the pop star for 75 million the home also boasts a gilded framed portrait of gunther iv over the living room fireplacep
pthe dogs lineage dates back decades to when gunther iii inherited a multimilliondollar trust from late owner german countess karlotta liebenstein when she died in 1992 since then a group of handlers have helped maintain a jetsetting lifestyle for a succession of dogs there are trips to the milan and the bahamas where the latest gunther recently dined out at restaurants every evening his handlers like to make sure hes well socializedp
pa chef cooks his breakfast each morning made of the finest meat fresh vegetables and rice sometimes he enjoys caviar but theres never any kibble in sight he travels by private jet works on obedience skills daily with his trainer and sleeps in a lavish round red velvet bed overlooking the bayp
phe lives in madonnas former master bedroom said real estate agent ruthie assouline who nabbed the listing with her husband ethan for the 12acre 05 hectare property in a row of a halfdozen waterfront homes next to a public county park and on the same street where sylvester stallone once livedp
phe literally sleeps overlooking the most magnificent view in an italian custom bed in the former bedroom of the greatest pop star in the worldpblockquote
phere is a relnoopener hrefhttpswwwnprorg202111181056805293dogmiamimansionmadonnarealestate target_blankthe full storya via fred smalkinp
pthe post a relnofollow hrefhttpmarginalrevolutioncommarginalrevolution202111whatistheincomehappinessgradientfordogshtmlwhat is the incomehappiness gradient for dogsa appeared first on a relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap | blockquotepgunther german shepherd spent recent morning playing tennis ball rolling grass slobbering little napping lot later meeting real estate agents selling miami mansion handlers bought madonnap pand course gunther wearing best faux diamond dog collar meeting real gold collar main home tuscany crazy sounds floridas standards gunther vi inherited vast fortune including eightbedroom waterfront home owned material girl singer grandfather gunther iv thats handlers manage estate sayp pthe tuscanstyle villa views biscayne bay went sale wednesday 3175 million whopping markup purchase decades ago pop star 75 million home boasts gilded framed portrait gunther iv living room fireplacep pthe dogs lineage dates decades gunther iii inherited multimilliondollar trust late owner german countess karlotta liebenstein died 1992 group handlers helped maintain jetsetting lifestyle succession dogs trips milan bahamas latest gunther recently dined restaurants evening handlers like sure hes socializedp pa chef cooks breakfast morning finest meat fresh vegetables rice enjoys caviar theres kibble sight travels private jet works obedience skills daily trainer sleeps lavish round red velvet bed overlooking bayp phe lives madonnas master bedroom said real estate agent ruthie assouline nabbed listing husband ethan 12acre 05 hectare property row halfdozen waterfront homes public county park street sylvester stallone livedp phe literally sleeps overlooking magnificent view italian custom bed bedroom greatest pop star worldpblockquote phere relnoopener hrefhttpswwwnprorg202111181056805293dogmiamimansionmadonnarealestate target_blankthe storya fred smalkinp pthe post relnofollow hrefhttpmarginalrevolutioncommarginalrevolution202111whatistheincomehappinessgradientfordogshtmlwhat incomehappiness gradient dogsa appeared relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap |
619ac8b772e41ed32b78af22 | Where to dine in Austin | pthe city is right now one of americas better food scenes and perhaps americas most dynamic city overall it is radically different from even my recent visit a few short years ago here are a few recommendationsp
pa relnoopener hrefhttpswwwloroeatscom target_blankloroa asian fusion and smoked meats dont forget to get the sweet corn and also the cabbagep
pa relnoopener hrefhttpsleroyandlewisbbqcom target_blankleroy and lewisa outside dining from a food truck firstrate beef cheeks get there earlyp
pa relnoopener hrefhttpssammiesitaliancom target_blanksammiesa doesnt seem like it should be good but excellent italian with a texas emphasisp
pa relnoopener hrefhttpscomedortxcom target_blankcomedora nouvelle mexican the quesadillas were the surprise with the biggest upsidep
pthe post a relnofollow hrefhttpmarginalrevolutioncommarginalrevolution202111wheretodineinaustinhtmlwhere to dine in austina appeared first on a relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap | pthe city right americas better food scenes americas dynamic city overall radically different recent visit short years ago recommendationsp pa relnoopener hrefhttpswwwloroeatscom target_blankloroa asian fusion smoked meats dont forget sweet corn cabbagep pa relnoopener hrefhttpsleroyandlewisbbqcom target_blankleroy lewisa outside dining food truck firstrate beef cheeks earlyp pa relnoopener hrefhttpssammiesitaliancom target_blanksammiesa doesnt like good excellent italian texas emphasisp pa relnoopener hrefhttpscomedortxcom target_blankcomedora nouvelle mexican quesadillas surprise biggest upsidep pthe post relnofollow hrefhttpmarginalrevolutioncommarginalrevolution202111wheretodineinaustinhtmlwhere dine austina appeared relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap |
Subsets and Splits
No community queries yet
The top public SQL queries from the community will appear here once available.