include display image

app.py

@@ -40,15 +40,24 @@ def about_page():
         a given protein target. We demonstrate state-of-the-art performance over previous methods on multiple 
         well-known benchmarks, particularly in zero-shot settings for unseen protein targets.
         """
+        st.image('hyper-dti.png')
     )
 
 def display_dti():
-
+    st.markdown('##')
     smiles = st.text_input("Enter the SMILES of the query drug compound", value="CC(=O)OC1=CC=CC=C1C(=O)O", placeholder="CC(=O)OC1=CC=CC=C1C(=O)O")
     
     if smiles:
         mol = Chem.MolFromSmiles(smiles)
         mol_img = Chem.Draw.MolToImage(mol)
+        col1, col2, col3 = st.columns(3)
+        with col1:
+            st.write("")
+        with col2:
+            st.image(mol_imgs, width = 140)
+        with col3:
+            st.write("")
+        st.markdown('##')
 
     sequence = st.text_input("Enter the amino-acid sequence of the query protein target", value="HXHVWPVQDAKARFSEFLDACITEGPQIVSRRGAEEAVLVPIGEWRRLQAAA", placeholder="HXHVWPVQDAKARFSEFLDACITEGPQIVSRRGAEEAVLVPIGEWRRLQAAA")