initialize simple plotting of drug

app.py

@@ -41,11 +41,25 @@ def about_page():
         well-known benchmarks, particularly in zero-shot settings for unseen protein targets.
         """
     )
+
+def display_dti():
+
+    smiles = st.text_input("Enter the SMILES of the query drug compound", value="CC(=O)OC1=CC=CC=C1C(=O)O", placeholder="CC(=O)OC1=CC=CC=C1C(=O)O")
+    
+    if smiles:
+        mol = Chem.MolFromSmiles(smiles)
+        mol_img = Chem.Draw.MolToImage(mol)
+
+    sequence = st.text_input("Enter the amino-acid sequence of the query protein target", value="HXHVWPVQDAKARFSEFLDACITEGPQIVSRRGAEEAVLVPIGEWRRLQAAA", placeholder="HXHVWPVQDAKARFSEFLDACITEGPQIVSRRGAEEAVLVPIGEWRRLQAAA")
+    
+    if sequence:
+        st.markdown(f'TODO plot {sequence}')
     
 # example proteins ["HXHVWPVQDAKARFSEFLDACITEGPQIVSRRGAEEAVLVPIGEWRRLQAAA"], ["AHKLFIGGLPNYLNDDQVKELLTSFGPLKAFNLVKDSATGLSKGYAFCEYVDINVTDQAIAGLNGMQLGDKKLLVQRASVGAKNA"]
 
 page_names_to_func = {
-    'About': about_page
+    'About': about_page,
+    'Display DTI': display_dti
 }
 
 selected_page = st.sidebar.selectbox('Choose function', page_names_to_func.keys())