_id
stringlengths 24
24
| title
stringlengths 5
149
| content
stringlengths 74
164k
| clean_content
stringlengths 35
156k
|
|---|---|---|---|
63055659d6b8b54d06b3710c
|
White House to announce student loan cancellation, payment pause extension Wednesday
|
figure dataanvatoplayeridp1
div
divdiv
div
div datareactcomponentanvatovideoplayerdiv
figure
pthe white house is expected to announce a plan to cancel a chunk of student loan debt on wednesday in addition to an extension of the existing payment pause three sources with knowledge of the situation told the hill p
psources said president bidens intended measure will include at least 10000 in loan forgiveness for borrowers who make less than 125000 annually as well as another payment freeze for roughly four months p
pthe 10000 figure would be the largest forgiveness of federal student loans per individual to datep
pthe move comes just a week ahead of the white houses selfimposed aug 31 deadline the timing has a hrefhttpsthehillcomhomenewsadministration3606883bidenkeepsstudentloanborrowersinsuspenseoverpaymentpauseleft millions of americans waitinga for guidance from the department of education on whether student loan payments that have been deferred since the start of the pandemic would resume next monthp
pthe potential announcement on wednesday comes within the smallest window of time borrowers have had to determine when their payments would resume the white house under biden and former president trump has extended the pause six times since march 2020 sometimes giving borrowers up to a months notice on whether their bills would be duep
ptrumps order temporarily stopped the accrual of interest on federal student loans effectively putting 16 trillion in debt owed by some 40 million americans on holdp
psince biden has taken office his administration has greenlighted over 31 billion in student loan relief for hundreds of thousands of borrowers but that relief has only extended to certain cases including for those who have attended schools found to have misled students borrowers with disabilities and those participating in the public service loan forgiveness programp
pbut the 10000 in forgiveness for a much wider breadth of borrowers will likely not satisfy some democrats or activists who have pushed the biden administration to forgive much more in federal student loan debtp
pin may senate majority leader charles schumer dny sen elizabeth warren dmass and sen raphael warnock dga met with biden to push for forgiveness advocates and other democrats including schumer have pressed for forgiveness of 50000 per borrower or to cancel debt entirelyp
pemupdated at 125 pmemp
|
figure dataanvatoplayeridp1 div divdiv div div datareactcomponentanvatovideoplayerdiv figure pthe white house expected announce plan cancel chunk student loan debt wednesday addition extension existing payment pause sources knowledge situation told hillp psources said president bidens intended measure include 10000 loan forgiveness borrowers 125000 annually payment freeze roughly monthsp pthe 10000 figure largest forgiveness federal student loans individual datep pthe comes week ahead white houses selfimposed aug 31 deadline timing hrefhttpsthehillcomhomenewsadministration3606883bidenkeepsstudentloanborrowersinsuspenseoverpaymentpauseleft millions americans waitinga guidance department education student loan payments deferred start pandemic resume monthp pthe potential announcement wednesday comes smallest window time borrowers determine payments resume white house biden president trump extended pause times march 2020 giving borrowers months notice bills duep ptrumps order temporarily stopped accrual interest federal student loans effectively putting 16 trillion debt owed 40 million americans holdp psince biden taken office administration greenlighted 31 billion student loan relief hundreds thousands borrowers relief extended certain cases including attended schools found misled students borrowers disabilities participating public service loan forgiveness programp pbut 10000 forgiveness wider breadth borrowers likely satisfy democrats activists pushed biden administration forgive federal student loan debtp pin senate majority leader charles schumer dny sen elizabeth warren dmass sen raphael warnock dga met biden push forgiveness advocates democrats including schumer pressed forgiveness 50000 borrower cancel debt entirelyp pemupdated 125 pmemp
|
630ac1ae6f3425b28e1152c1
|
The long-awaited upgrade to Ethereum
|
pwhich are the best sources to read on what is happening and its likely benefits and problems if you are starting from scratch here is a relnoopener hrefhttpswwwnytimescom20220826technologycryptoethereumthemergehtml target_blanksome nyt coveragea the ethereum foundation a relnoopener hrefhttpsethereumorgenupgradesmerge target_blankreportsap
div
ul
lisoon the current ethereum mainnet will merge with the beacon chain proofofstake systemli
lithis will mark the end of proofofwork for ethereum and the full transition to proofofstakeli
lithis sets the stage for future scaling upgrades including shardingli
lithe merge will reduce ethereums energy consumption by 9995li
ul
pwhat else should i be reading on this here are a relnoopener hrefhttpswwwgooglecomsearchqethereumupgrademergeredditeiubwky8t1kaax5nopvawc0auved0ahukewjesytmkof5ahwmgfkfhb2safoq4dudca0uact5oqethereumupgrademergeredditgs_lcpcgdnd3mtd2l6eamycagheb4qfhadmggiiraeebyqhtohcaaqrxcwazogcaaqhhawoguiabcgazofcceqoae6bqghekscsgqiqrgasgqirhgauk4fwlsmyoqsaafwaxgagagnaygb3gssaqm1ljkyaqcgaqhiaqjaaqesclientgwswiz target_blankvarious reddit threadsa here is a relnoopener hrefhttpsarstechnicacomtechpolicy202208themergethebiggestchangeinethereumhistoryexplained target_blankcoverage from timothy b leea and what are you all expecting please dont just rehash the standard crypto debatesp
div
p p
pthe post a relnofollow hrefhttpmarginalrevolutioncommarginalrevolution202208thelongawaitedupgradetoethereumhtmlthe longawaited upgrade to ethereuma appeared first on a relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap
|
pwhich best sources read happening likely benefits problems starting scratch relnoopener hrefhttpswwwnytimescom20220826technologycryptoethereumthemergehtml target_blanksome nyt coveragea ethereum foundation relnoopener hrefhttpsethereumorgenupgradesmerge target_blankreportsap div ul lisoon current ethereum mainnet merge beacon chain proofofstake systemli lithis mark end proofofwork ethereum transition proofofstakeli lithis sets stage future scaling upgrades including shardingli lithe merge reduce ethereums energy consumption 9995li ul pwhat reading relnoopener hrefhttpswwwgooglecomsearchqethereumupgrademergeredditeiubwky8t1kaax5nopvawc0auved0ahukewjesytmkof5ahwmgfkfhb2safoq4dudca0uact5oqethereumupgrademergeredditgs_lcpcgdnd3mtd2l6eamycagheb4qfhadmggiiraeebyqhtohcaaqrxcwazogcaaqhhawoguiabcgazofcceqoae6bqghekscsgqiqrgasgqirhgauk4fwlsmyoqsaafwaxgagagnaygb3gssaqm1ljkyaqcgaqhiaqjaaqesclientgwswiz target_blankvarious reddit threadsa relnoopener hrefhttpsarstechnicacomtechpolicy202208themergethebiggestchangeinethereumhistoryexplained target_blankcoverage timothy b leea expecting dont rehash standard crypto debatesp div pp pthe post relnofollow hrefhttpmarginalrevolutioncommarginalrevolution202208thelongawaitedupgradetoethereumhtmlthe longawaited upgrade ethereuma appeared relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap
|
630ac1b36f3425b28e1152c3
|
The United States Is Fighting Inflation With History
|
fed chief jerome powell wants the world to understand his present decisions are guided by past traumas
|
fed chief jerome powell wants world understand present decisions guided past traumas
|
630ac2086f3425b28e1152d5
|
The Student Loan Giveaway is Much Bigger Than You Think
|
pwiping out 10k in student debt is not the most expensive part of the a hrefhttpswwwwhitehousegovbriefingroomstatementsreleases20220824factsheetpresidentbidenannouncesstudentloanreliefforborrowerswhoneeditmostbiden student loan programa most federal student loans are now eligible for an a hrefhttpsstudentaidgovmanageloansrepaymentplansincomedrivenincome based repayment plana under these plans students pay a small percentage of their discretionary income say 10 and then after a fixed number of years the debt is wiped off the students books at first glance these plans dont seem crazy but as matt bruenig points out they create a hrefhttpswwwpeoplespolicyprojectorg20220826thenewincomedrivenrepaymentsystemcouldcausesomebigproblemsperverse incentivesap
blockquotepunder the public service loan forgiveness pslf program law graduates that go on to work in the public sector which is a lot of them as the public sector employs many lawyers only have to pay 10 percent of their discretionary income for 10 years in order to have their debt forgivenp
plaw schools a hrefhttpsabovethelawcom201308lawschoolsdevisetricktogametaxpayersfigureda out many years ago that for a student who is planning to enroll in pslf upon graduation prices and debt loads dont matter ten percent of your discretionary income is ten percent of your discretionary income regardless of what the law school charges you and how much debt you nominally have to take onp
plaw schools also realized that they could make the deal even sweeter by setting up lraps [repayment programs at] that give graduates money to cover the the modest repayments required by the pslfp
pthe lrap schemes work as followsp
ul
lispanthe school increases their tuitionspanli
lispanthe student takes out federal loans to cover the tuition increasespanli
lispanthe school squirrels away the debtfinanced tuition increase into an lrap fundspanli
lispanthe school disburses money from the lrap fund to cover pslf repaymentsspanli
ul
blockquote
pdid you get that heres a stylized example suppose a student will make 150k per year for 10 years working in the public sector if they have 200k in debt they pay 15k every year to the government for 10 years and then 50k is forgiven but now the law school comes to the student and says heh i have a deal which will make both of us better off we are going to raise the price of law school to 400k but dont worry not only wont that cost you a penny more than the 15k a year you are already obligated to pay it will actually cost you much less because we will pay your payments of 15k per year this indeed is a great deal for the student who pays emnothingem and its a great deal for the law school which gets 200k more revenue immediately in return for 150k of payments paid out over the following 10 years winwin except for the taxpayer of coursep
pbut wait theres more student loans can be used not only to pay tuition and fees but also to pay living expenses thus under these plans students have an incentive to take out as big a loan as allowed in excess of tuition and fees because no matter how large the loan the students costs are zero lyman stone has a a hrefhttpstwittercomlymanstonekystatus1563204617931870208s20tfryu8hnx9o59vjavsnieggood tweet threada giving many examples of how to game the system such as every student should borrow their maximum loan eligibility and then find some way to invest it illegally my strategy would be rent a wildly oversized apartment and sublet and here is a tweet thread from michael feinberg showing how a hrefhttpstwittercommike_feinbergstatus1563532331574788096s20tsyop2nax1y8oozejozzpiaeven wealthy parents may be able to game the systemap
pfurthermore the new biden plan makes the income driven repayment schemes even more generousp
blockquotepthe idr changes are fourfoldp
ul
liincrease the amount of income not subject to idr from 150 percent of the federal poverty line to 225 percent of the federal poverty lineli
lireduce the interest rate on idrenrolled loans to 0 percentli
lifor undergraduate debt reduce the idr rate from 10 percent of income beyond the threshold in 1 to 5 percent of income beyond the threshold in 1li
lifor idrenrolled debts with original loan balances below 12000 reduce the repayment period from 20 years to 10 yearsli
ul
blockquote
pessentially what this means is that every school will now have the possibility of using a law school like program to shift costs onto taxpayers thus a hrefhttpswwwpeoplespolicyprojectorg20220826thenewincomedrivenrepaymentsystemcouldcausesomebigproblemsbruenig concludesap
blockquotepgoing forward these new rules could quite radically alter the incentives of colleges and students when it comes to college prices institutional financial aid how much debt to take on and how to approach repaymentpblockquote
pindeed these programs are likely to be very expensive and the resulting increase in the price of tuition will lead to calls either to end the program or for price controls on educationp
pthe post a relnofollow hrefhttpmarginalrevolutioncommarginalrevolution202208thestudentloangiveawayitsmuchbiggerthanyouthinkhtmlthe student loan giveaway is much bigger than you thinka appeared first on a relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap
|
pwiping 10k student debt expensive hrefhttpswwwwhitehousegovbriefingroomstatementsreleases20220824factsheetpresidentbidenannouncesstudentloanreliefforborrowerswhoneeditmostbiden student loan programa federal student loans eligible hrefhttpsstudentaidgovmanageloansrepaymentplansincomedrivenincome based repayment plana plans students pay small percentage discretionary income 10 fixed number years debt wiped students books glance plans dont crazy matt bruenig points create hrefhttpswwwpeoplespolicyprojectorg20220826thenewincomedrivenrepaymentsystemcouldcausesomebigproblemsperverse incentivesap blockquotepunder public service loan forgiveness pslf program law graduates work public sector lot public sector employs lawyers pay 10 percent discretionary income 10 years order debt forgivenp plaw schoolsa hrefhttpsabovethelawcom201308lawschoolsdevisetricktogametaxpayersfiguredaout years ago student planning enroll pslf graduation prices debt loads dont matter percent discretionary income percent discretionary income regardless law school charges debt nominally onp plaw schools realized deal sweeter setting lraps [repayment programs at] graduates money cover modest repayments required pslfp pthe lrap schemes work followsp ul lispanthe school increases tuitionspanli lispanthe student takes federal loans cover tuition increasespanli lispanthe school squirrels away debtfinanced tuition increase lrap fundspanli lispanthe school disburses money lrap fund cover pslf repaymentsspanli ul blockquote pdid heres stylized example suppose student 150k year 10 years working public sector 200k debt pay 15k year government 10 years 50k forgiven law school comes student says heh deal better going raise price law school 400k dont worry wont cost penny 15k year obligated pay actually cost pay payments 15k year great deal student pays emnothingem great deal law school gets 200k revenue immediately return 150k payments paid following 10 years winwin taxpayer coursep pbut wait theres student loans pay tuition fees pay living expenses plans students incentive big loan allowed excess tuition fees matter large loan students costs zero lyman stone hrefhttpstwittercomlymanstonekystatus1563204617931870208s20tfryu8hnx9o59vjavsnieggood tweet threada giving examples game system student borrow maximum loan eligibility find way invest illegally strategy rent wildly oversized apartment sublet tweet thread michael feinberg showing hrefhttpstwittercommike_feinbergstatus1563532331574788096s20tsyop2nax1y8oozejozzpiaeven wealthy parents able game systemap pfurthermore new biden plan makes income driven repayment schemes generousp blockquotepthe idr changes fourfoldp ul liincrease income subject idr 150 percent federal poverty line 225 percent federal poverty lineli lireduce interest rate idrenrolled loans 0 percentli lifor undergraduate debt reduce idr rate 10 percent income threshold 1 5 percent income threshold 1li lifor idrenrolled debts original loan balances 12000 reduce repayment period 20 years 10 yearsli ul blockquote pessentially means school possibility law school like program shift costs taxpayers hrefhttpswwwpeoplespolicyprojectorg20220826thenewincomedrivenrepaymentsystemcouldcausesomebigproblemsbruenig concludesap blockquotepgoing forward new rules radically alter incentives colleges students comes college prices institutional financial aid debt approach repaymentpblockquote pindeed programs likely expensive resulting increase price tuition lead calls end program price controls educationp pthe post relnofollow hrefhttpmarginalrevolutioncommarginalrevolution202208thestudentloangiveawayitsmuchbiggerthanyouthinkhtmlthe student loan giveaway bigger thinka appeared relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap
|
630ac2826f3425b28e1152e8
|
It’s time for Anglofuturism
|
pspanjust a few years ago to be concerned with national resilience was to be seen as some kind of crank at best and some kind of nativist radical at worst even at the height of covid to diagnose the fundamental problem facing britain as one of eroded state capacity was often viewed by liberal commentators as some kind of quasistalinist state worship dangerously close to either fascism or communism spanp
pspantoday however the british states inability to provide the most basic of functions stopping crime providing adequate healthcare housing and functioning utilities like energy and water are the central plank of political discussion we have won the argument yet there has been very little reflection on what this means or how we have reached this dismal state of affairs worse the people who brought us here are still in chargespanp
pspanbut what is the alternative in their 2015 book spana relnoopener hrefhttpswwwversobookscombooks2315inventingthefuture target_blankispaninventing the futurespaniaspan the leftwing writers nick srnicek and alex williams used the example of the seventies crisis which ushered in our current political and economic model to examine the way in which one governing ideology can supersede its predecessor as the commonsense frame of political argument and become hegemonic the previous dominant keynesian framework had no immediate answer to the economic crisis of the time and thus ceded ground to the freemarket ideology of neoliberalism which had created spana relnoopener hrefhttpswwwcambridgeorgcoreservicesaopcambridgecorecontentviewe177ee608d445c3df10a8c03e55f9f0fs0960777321000199apdfneoliberal_thinkers_and_european_integration_in_the_1980s_and_the_early_1990spdf target_blankspanan ecosystem of think tanks and journalistic popularisersspanaspan biding their time for a moment of crisis the neoliberals had both a diagnosis of the problem and a solution as a result they observe government officials who were uncertain about what to do in the face of crisis found a plausible story in neoliberalismspanp
divdiv
pspanthe fundamental problem facing britain today is the collapse of this chosen model the fruit of a previous lesser era of crisis instead of shoring up the states resilience to the pressures of an increasingly unstable world the reliance on market forces has left the government increasingly unable to impose order provide functioning healthcare keep the lights on or put roofs over peoples heads a state that cannot provide these basic functions is really no state at all we are witnessing the death spiral of the world created after the seventies crisis even conservatives now understand that things cannot continue as they are to argue in favour of the current system is now the marginal and eccentric position half the ideological battle has already been wonspanp
pspanand yet no single viable alternative model is waiting in the wings both parties are ideologically inflexible far more so than voters the most likely outcome is westminsters desperate political preservation of a rapidly collapsing system in which no one believes the model has failed but the people who imposed it who genuinely believed in it and somehow still believe in it remain in power spanp
pspanthere have been no consequences for their decades of failure and the detachment of voters from the people who represent them has never been greater this is a deeply dangerous unstable situation which has already given birth to conspiratorial political religions such as qanon russiagate and the great reset which will doubtless multiply as living standards continue to plummet and politicians continue to fail they seek to discern some underlying logic or rationale to events when there is only incompetence and a dying political system bereft of ideas at a moment of grave national crisis we require a statesman of historic stature with the vision and will to steer us out of disaster instead were getting liz trussspanp
diva hrefhttpsunherdcom202208howtogetoverborisjohnsonrefinnara hrefhttpsunherdcom202208howtogetoverborisjohnsonrefinnarimg srchttpsunherdcomwpcontentuploads202208gettyimages12388135401copy300x200jpgadiva hrefhttpsunherdcom202208howtogetoverborisjohnsonrefinnarspansuggested readingspanaa hrefhttpsunherdcom202208howtogetoverborisjohnsonrefinnarh5how to get over boris johnsonh5apa hrefhttpsunherdcom202208howtogetoverborisjohnsonrefinnarspanbyspan dominic sandbrookapdivadiv
pspanbut in reality it no longer matters whether truss or sunak wins the battle to enter no 10 no one believes that either has any answers to the problems facing us and the paperthin dividing line between them is merely the narcissism of small differences similarly the increasingly bitter battle over political control of the american state conceals the fact that whichever party wins will find themselves at the mercy of global forces they can no longer control across the western world the red lights are flashing in the cockpit but no one knows how to fly the plane spanp
pspandegrowth the failed totalitarianism of the 20th century political islam these arent useful alternatives just fringe ideologies more often used rhetorically by the current regime to justify its prolonged existence than sincerely adhered to fukuyama may have posited liberal capitalisms victory because nothing had shown up to replace it yet its failure looks more like the world we already inhabit a world of niche microideologies without any grand unifying project spanp
pspanto maintain the fiction of progress we must believe that things are better now than they have ever been even when they are demonstrably worse than any time in living memory we are entering a postprogress era where the achievements of the past decades even centuries will be reversed we will for the next decade at least perhaps longer be forced to live in a simpler sparer way the fat will be cut off now we have entered the lean years as macron spana relnoopener hrefhttpswwwbarronscomnewsmacronwarnssacrificesaheadafterendofabundance01661332507 target_blankspanobserved this weekspanaspan we are living through what could seem like the end of abundance to describe the years since 2008 as an age of abundance seems absurd but we may well soon be nostalgic for the stagnation of the 2010sspanp
pspanit is as if we have entered a dark tunnel and the political forms waiting at the end of it are too distant and obscure to make out but there is no reason to believe things will get any better and much reason to believe that there is much further for us to descend we dont know how the confrontation with russia over ukraine will end there is the prospect of a grave escalation we dont know the consequences of a chinese attack on taiwan now more likely than ever but surely given the wests total dependence on chinas industrial base it will dwarf the consequences of the ukraine war spanp
pspanthe term crisis implies an end state like a fever breaking but this is the new baseline normality next year will be worse than this year the year after will be worse again previous attempts to stave off disaster the mass demonstrations of the early 2010s and the populist wave that followed were often inchoate attempts to correct our course both failed the ideological output of the 2010s like fully automated luxury communism posited a postscarcity world of happy abundant consumption derived through mining asteroids and other unlikely tech fixes a decade later were having to settle for energy rationing and trying to restore the very most basic competences of governancespanp
diva hrefhttpsunherdcom202208thetoriesarecriminallyblindrefinnara hrefhttpsunherdcom202208thetoriesarecriminallyblindrefinnarimg srchttpsunherdcomwpcontentuploads202208gettyimages466087646scalede1661246669809300x184jpgadiva hrefhttpsunherdcom202208thetoriesarecriminallyblindrefinnarspansuggested readingspanaa hrefhttpsunherdcom202208thetoriesarecriminallyblindrefinnarh5the tories are criminally blindh5apa hrefhttpsunherdcom202208thetoriesarecriminallyblindrefinnarspanbyspan john oxleyapdivadiv
pspanas the marxist thinker spana relnoopener hrefhttpswwwversobookscombooks2519howwillcapitalismend target_blankspanwolfgang streeck warnsspanaspan we are facing a long period of systemic disintegration in which social structures become unstable and unreliable and therefore uninstructive for those living in them it is a time perhaps lasting centuries when deep changes will occur rapidly and continuously but they will be unpredictable and in any case ungovernable life in such a society offers rich opportunities to oligarchs and warlords while imposing uncertainty and insecurity on all others in some ways like the long interregnum that began in the fifth century ce and is now called the dark agespanp
pspanhow are we to manage life in this hard new world for ourselves and our children the survival of the british state our ark in the coming storm is paramount yet whether the british state will even exist at the end of the decade is still a matter of helpless conjecture we must demand a wartime level of mobilisation focused on state resilience we are now far beyond nudges and quick fixes this is a campaign for the basic functions of the state streets that are safe to walk homes to live in healthcare for those in need universal access to food warmth and shelter spanp
pspanas milton friedman put it only a crisis actual or perceived produces real change when that crisis occurs the actions that are taken depend on the ideas that are lying around that i believe is our basic function to develop alternatives to existing policies to keep them alive and available until the politically impossible becomes the politically inevitable that time has now come spanspanof necessity in a world without a convincing successor ideology this new model of politics must be pragmatic and nonideological centred on restoring the basic functions of statehood it must unite labour voters as well as tories socialists and conservatives it is a call i propose for anglofuturismspanp
pspananglo because britain should survive as an entity focused on the health and prosperity of the people and not merely as a theme park for international capital through shifting domestic industry abroad and encouraging mass immigration of lowwage labour at home policymakers were able to create the illusion of prosperity conjuring the outward form of a middleclass existence even as it demolished its foundations but this world has now gone forever leaving us poorer and less resilient spanp
pspanthe futurism is for the understanding that spana relnoopener hrefhttpstwittercommlanetrainstatus1556381583585804291s20tiog5sl1olttjycq7ftrnwa target_blankspanunlike our current political classspanaspan this approach looks beyond the electoral cycle it is the idea that the state and the nation have interests to be safeguarded over the course of generations and that infrastructure should be built now to secure the lives and prosperity of our descendents futurism also because it harnesses the optimism and high modernism of the postwar era a vanished world of frenetic housebuilding and technological innovation where british scientific research could lead the world and produce higher living standards through its fusion with wellpaid highskilled labour spanp
diva hrefhttpsunherdcom202208themythoftorybirminghamrefinnara hrefhttpsunherdcom202208themythoftorybirminghamrefinnarimg srchttpsunherdcomwpcontentuploads202208p300x169jpgadiva hrefhttpsunherdcom202208themythoftorybirminghamrefinnarspansuggested readingspanaa hrefhttpsunherdcom202208themythoftorybirminghamrefinnarh5the myth of tory birminghamh5apa hrefhttpsunherdcom202208themythoftorybirminghamrefinnarspanbyspan richard vinenapdivadiv
pspanthe anglofuturist vision of britain is one where every county town has its own spana relnoopener hrefhttpstwittercomjefferson_mfgstatus1556922317040766977s20tx02sqvobmalbt_kzgjpiga target_blankspansmall modular reactorspanaspan providing clean abundant nuclear energy it is a country where cheap and reliable highspeed rail darts across the country through the new towns where everyone who wants can have their own warm and spacious home past the small family farms which provide the countrys food security in the clean skies spana relnoopener hrefhttpstwittercomjefferson_mfgstatus1488834473080893441s20tx02sqvobmalbt_kzgjpiga target_blankspanelectric airshipsspanaspan move freight across the country in our seas teeming with fish vast arrays of domesticallymanufactured wind and wave power stations the product of a revived industrial strategy unite british ingenuity and manufacturing capacity in clean power generation that is the envy of the world spanp
pspanthis is not a reactionary vision for there is no going back the britain of the fifties is gone forever as is the britain of the nineties and the 2010s yet everything to come has been shaped by what has been before rooting our vision of the future in the best of our past and britains unique natural and cultural gifts perhaps we can emerge from this crisis richer happier and healthier than we have ever been this requires a total warlevel shifting of the westminster worldview brought about by public pressure after all the political incentives currently in place are what brought us here like the austerity of the 2010s which midwifed the weakened state of the 2020s trusss desperate cargocult thatcherism promises only deeper faster harder collapse it is the proposed cure that already ails us we must look towards a pragmatic emergency programme of rebuilding state capacity as a matter of national survival spanspaneven as we enter a decadeslong period of nearcollapse it is time to reject decline and embrace a better future its time for anglofuturismspanp
a hrefhttpsunherdcom202208itstimeforanglofuturismappcommentsview 58 commentsa
|
pspanjust years ago concerned national resilience seen kind crank best kind nativist radical worst height covid diagnose fundamental problem facing britain eroded state capacity viewed liberal commentators kind quasistalinist state worship dangerously close fascism communismspanp pspantoday british states inability provide basic functions stopping crime providing adequate healthcare housing functioning utilities like energy water central plank political discussion won argument little reflection means reached dismal state affairs worse people brought chargespanp pspanbut alternative 2015 book spana relnoopener hrefhttpswwwversobookscombooks2315inventingthefuture target_blankispaninventing futurespaniaspan leftwing writers nick srnicek alex williams example seventies crisis ushered current political economic model examine way governing ideology supersede predecessor commonsense frame political argument hegemonic previous dominant keynesian framework immediate answer economic crisis time ceded ground freemarket ideology neoliberalism created spana relnoopener hrefhttpswwwcambridgeorgcoreservicesaopcambridgecorecontentviewe177ee608d445c3df10a8c03e55f9f0fs0960777321000199apdfneoliberal_thinkers_and_european_integration_in_the_1980s_and_the_early_1990spdf target_blankspanan ecosystem think tanks journalistic popularisersspanaspan biding time moment crisis neoliberals diagnosis problem solution result observe government officials uncertain face crisis found plausible story neoliberalismspanp divdiv pspanthe fundamental problem facing britain today collapse chosen model fruit previous lesser era crisis instead shoring states resilience pressures increasingly unstable world reliance market forces left government increasingly unable impose order provide functioning healthcare lights roofs peoples heads state provide basic functions state witnessing death spiral world created seventies crisis conservatives understand things continue argue favour current system marginal eccentric position half ideological battle wonspanp pspanand single viable alternative model waiting wings parties ideologically inflexible far voters likely outcome westminsters desperate political preservation rapidly collapsing system believes model failed people imposed genuinely believed believe remain powerspanp pspanthere consequences decades failure detachment voters people represent greater deeply dangerous unstable situation given birth conspiratorial political religions qanon russiagate great reset doubtless multiply living standards continue plummet politicians continue fail seek discern underlying logic rationale events incompetence dying political system bereft ideas moment grave national crisis require statesman historic stature vision steer disaster instead getting liz trussspanp diva hrefhttpsunherdcom202208howtogetoverborisjohnsonrefinnara hrefhttpsunherdcom202208howtogetoverborisjohnsonrefinnarimg srchttpsunherdcomwpcontentuploads202208gettyimages12388135401copy300x200jpgadiva hrefhttpsunherdcom202208howtogetoverborisjohnsonrefinnarspansuggested readingspanaa hrefhttpsunherdcom202208howtogetoverborisjohnsonrefinnarh5how boris johnsonh5apa hrefhttpsunherdcom202208howtogetoverborisjohnsonrefinnarspanbyspan dominic sandbrookapdivadiv pspanbut reality longer matters truss sunak wins battle enter 10 believes answers problems facing paperthin dividing line merely narcissism small differences similarly increasingly bitter battle political control american state conceals fact whichever party wins find mercy global forces longer control western world red lights flashing cockpit knows fly planespanp pspandegrowth failed totalitarianism 20th century political islam arent useful alternatives fringe ideologies rhetorically current regime justify prolonged existence sincerely adhered fukuyama posited liberal capitalisms victory shown replace failure looks like world inhabit world niche microideologies grand unifying projectspanp pspanto maintain fiction progress believe things better demonstrably worse time living memory entering postprogress era achievements past decades centuries reversed decade longer forced live simpler sparer way fat cut entered lean years macron spana relnoopener hrefhttpswwwbarronscomnewsmacronwarnssacrificesaheadafterendofabundance01661332507 target_blankspanobserved weekspanaspan living like end abundance describe years 2008 age abundance absurd soon nostalgic stagnation 2010sspanp pspanit entered dark tunnel political forms waiting end distant obscure reason believe things better reason believe descend dont know confrontation russia ukraine end prospect grave escalation dont know consequences chinese attack taiwan likely surely given wests total dependence chinas industrial base dwarf consequences ukraine warspanp pspanthe term crisis implies end state like fever breaking new baseline normality year worse year year worse previous attempts stave disaster mass demonstrations early 2010s populist wave followed inchoate attempts correct course failed ideological output 2010s like fully automated luxury communism posited postscarcity world happy abundant consumption derived mining asteroids unlikely tech fixes decade later having settle energy rationing trying restore basic competences governancespanp diva hrefhttpsunherdcom202208thetoriesarecriminallyblindrefinnara hrefhttpsunherdcom202208thetoriesarecriminallyblindrefinnarimg srchttpsunherdcomwpcontentuploads202208gettyimages466087646scalede1661246669809300x184jpgadiva hrefhttpsunherdcom202208thetoriesarecriminallyblindrefinnarspansuggested readingspanaa hrefhttpsunherdcom202208thetoriesarecriminallyblindrefinnarh5the tories criminally blindh5apa hrefhttpsunherdcom202208thetoriesarecriminallyblindrefinnarspanbyspan john oxleyapdivadiv pspanas marxist thinker spana relnoopener hrefhttpswwwversobookscombooks2519howwillcapitalismend target_blankspanwolfgang streeck warnsspanaspan facing long period systemic disintegration social structures unstable unreliable uninstructive living time lasting centuries deep changes occur rapidly continuously unpredictable case ungovernable life society offers rich opportunities oligarchs warlords imposing uncertainty insecurity ways like long interregnum began fifth century ce called dark agespanp pspanhow manage life hard new world children survival british state ark coming storm paramount british state exist end decade matter helpless conjecture demand wartime level mobilisation focused state resilience far nudges quick fixes campaign basic functions state streets safe walk homes live healthcare need universal access food warmth shelterspanp pspanas milton friedman crisis actual perceived produces real change crisis occurs actions taken depend ideas lying believe basic function develop alternatives existing policies alive available politically impossible politically inevitable time come spanspanof necessity world convincing successor ideology new model politics pragmatic nonideological centred restoring basic functions statehood unite labour voters tories socialists conservatives propose anglofuturismspanp pspananglo britain survive entity focused health prosperity people merely theme park international capital shifting domestic industry abroad encouraging mass immigration lowwage labour home policymakers able create illusion prosperity conjuring outward form middleclass existence demolished foundations world gone forever leaving poorer resilientspanp pspanthe futurism understanding spana relnoopener hrefhttpstwittercommlanetrainstatus1556381583585804291s20tiog5sl1olttjycq7ftrnwa target_blankspanunlike current political classspanaspan approach looks electoral cycle idea state nation interests safeguarded course generations infrastructure built secure lives prosperity descendents futurism harnesses optimism high modernism postwar era vanished world frenetic housebuilding technological innovation british scientific research lead world produce higher living standards fusion wellpaid highskilled labourspanp diva hrefhttpsunherdcom202208themythoftorybirminghamrefinnara hrefhttpsunherdcom202208themythoftorybirminghamrefinnarimg srchttpsunherdcomwpcontentuploads202208p300x169jpgadiva hrefhttpsunherdcom202208themythoftorybirminghamrefinnarspansuggested readingspanaa hrefhttpsunherdcom202208themythoftorybirminghamrefinnarh5the myth tory birminghamh5apa hrefhttpsunherdcom202208themythoftorybirminghamrefinnarspanbyspan richard vinenapdivadiv pspanthe anglofuturist vision britain county town spana relnoopener hrefhttpstwittercomjefferson_mfgstatus1556922317040766977s20tx02sqvobmalbt_kzgjpiga target_blankspansmall modular reactorspanaspan providing clean abundant nuclear energy country cheap reliable highspeed rail darts country new towns wants warm spacious home past small family farms provide countrys food security clean skies spana relnoopener hrefhttpstwittercomjefferson_mfgstatus1488834473080893441s20tx02sqvobmalbt_kzgjpiga target_blankspanelectric airshipsspanaspan freight country seas teeming fish vast arrays domesticallymanufactured wind wave power stations product revived industrial strategy unite british ingenuity manufacturing capacity clean power generation envy worldspanp pspanthis reactionary vision going britain fifties gone forever britain nineties 2010s come shaped rooting vision future best past britains unique natural cultural gifts emerge crisis richer happier healthier requires total warlevel shifting westminster worldview brought public pressure political incentives currently place brought like austerity 2010s midwifed weakened state 2020s trusss desperate cargocult thatcherism promises deeper faster harder collapse proposed cure ails look pragmatic emergency programme rebuilding state capacity matter national survival spanspaneven enter decadeslong period nearcollapse time reject decline embrace better future time anglofuturismspanp hrefhttpsunherdcom202208itstimeforanglofuturismappcommentsview 58 commentsa
|
630ac3886f3425b28e115312
|
Does Liberalism Have a Future? A Conversation with Francis Fukuyama
|
img altdoes liberalism have a future a conversation with francis fukuyama srchttpswisdomofcrowdslivecontentimages202208the_spirit_of_war_19781211jpgpjust as it has a past liberalism has a future the only question is whether this future will be compelling enough for those who have lost faith we have our doubts which is why we wanted to talk to francis fukuyama author of emthe end of history and the last man emand perhaps the foremost thinker on the development of modern political order in his new book ema hrefhttpsamznto3dtscuvliberalism and its discontentsa emfukuyama mounts a comprehensive and stirring defense of the liberal idea but is it enough ppwe started by discussing donald trumpand other possible threats from the gop to liberalism liberalism hasnt necessarily failed but it has weakened how and why did this happen is liberalism too quotthinquot to serve as the bedrock of american identity fukuyama argues that modern liberalism has become deformed and is no longer liberal what would it mean to return to quotclassical liberalismquot and is it even possible paudio controls
source srchttpstrafficlibsyncomforcednwisdomofcrowdswocff_mainmp3
pyour browser doesnt support html audio a hrefhttpstrafficlibsyncomforcednwisdomofcrowdswocff_mainmp3herea is a link to the filep
audiopin strongpart 2 strongof the conversation a hrefhttpswisdomofcrowdsliveliberalismsenemiesfromwithinandwithoutstrongavailable herestronga for subscribers shadi questioned fukuyama on whether ostensibly liberal states do in fact promote their own particular conception of the good for example can stateenforced secularism like frances be reasonably considered liberal damir raises the point that the universalist assumptions behind liberalism may simply not be workable in a large diverse societiesppfinally we talk about the specific ways in which rising illiberalism could be beaten back fukuyama believes that the only way to defeat rightwing illiberalism is to defeat it decisively at the polls through the democratic party moving towards the center and ditching its quotwokequot wing in the long term however fukuyama is optimistic about liberalisms prospects and the chances for quotpartisans of human freedomquot to succeedppemrequired readingempullipaths to depolarization by francis fukuyama a hrefhttpswwwpersuasioncommunitypfukuyamapathstodepolarizationtriedsigningintrueempersuasionemaliliemememliberalism and its discontentsem ememby francis fukuyama emememema hrefhttpswwwamazoncomliberalismitsdiscontentsfrancisfukuyamadp0374606714refasc_df_0374606714taghyprod20linkcodedf0hvadid553268237417hvposhvnetwghvrand17968239559841796036hvponehvptwohvqmthvdevchvdvcmdlhvlocinthvlocphy9007325hvtargidpla1479442716474psc1amazonaememememliliemthe end of history and the last manem by francis fukuyama a hrefhttpswwwamazoncomendhistorylastmandpb07gfpv7h1refsr_1_1crid2rnj61w7qwkgzkeywordstheendofhistoryandthelastmanqid1661527211sprefixtheendofhist2caps2c84sr81amazonaliliempolitical order and political decay from the industrial revolution to the globalization of democracyem by francis fukuyama a hrefhttpswwwamazoncompoliticalorderdecayindustrialglobalizationdp0374535620refasc_df_0374535620taghyprod20linkcodedf0hvadid312443114357hvposhvnetwghvrand17968239559841796036hvponehvptwohvqmthvdevchvdvcmdlhvlocinthvlocphy9007325hvtargidpla448758029740psc1amazonaliliemememthe transformation of title ix regulating gender equality in educationem ememby r shep melnick emememema hrefhttpswwwamazoncomtransformationtitleixregulatingeducationdp0815732228amazonaememememliliememthe inheritors an intimate portrait of south africas racial reckoningem emby eve fairbanksem ema hrefhttpswwwamazoncominheritorsintimateportraitafricasreckoningdp1476725241refasc_df_1476725241taghyprod20linkcodedf0hvadid564725474608hvposhvnetwghvrand2472350770635167435hvponehvptwohvqmthvdevchvdvcmdlhvlocinthvlocphy9007325hvtargidpla1598515976838psc1amazonaememliul
|
img altdoes liberalism future conversation francis fukuyama srchttpswisdomofcrowdslivecontentimages202208the_spirit_of_war_19781211jpgpjust past liberalism future question future compelling lost faith doubts wanted talk francis fukuyama author emthe end history man emand foremost thinker development modern political order new book ema hrefhttpsamznto3dtscuvliberalism discontentsa emfukuyama mounts comprehensive stirring defense liberal idea ppwe started discussing donald trumpand possible threats gop liberalism liberalism hasnt necessarily failed weakened happen liberalism quotthinquot serve bedrock american identity fukuyama argues modern liberalism deformed longer liberal mean return quotclassical liberalismquot possible paudio controls source srchttpstrafficlibsyncomforcednwisdomofcrowdswocff_mainmp3 pyour browser doesnt support html audio hrefhttpstrafficlibsyncomforcednwisdomofcrowdswocff_mainmp3herea link filep audiopin strongpart 2 strongof conversation hrefhttpswisdomofcrowdsliveliberalismsenemiesfromwithinandwithoutstrongavailable herestronga subscribers shadi questioned fukuyama ostensibly liberal states fact promote particular conception good example stateenforced secularism like frances reasonably considered liberal damir raises point universalist assumptions liberalism simply workable large diverse societiesppfinally talk specific ways rising illiberalism beaten fukuyama believes way defeat rightwing illiberalism defeat decisively polls democratic party moving center ditching quotwokequot wing long term fukuyama optimistic liberalisms prospects chances quotpartisans human freedomquot succeedppemrequired readingempullipaths depolarization francis fukuyama hrefhttpswwwpersuasioncommunitypfukuyamapathstodepolarizationtriedsigningintrueempersuasionemaliliemememliberalism discontentsem ememby francis fukuyama emememema hrefhttpswwwamazoncomliberalismitsdiscontentsfrancisfukuyamadp0374606714refasc_df_0374606714taghyprod20linkcodedf0hvadid553268237417hvposhvnetwghvrand17968239559841796036hvponehvptwohvqmthvdevchvdvcmdlhvlocinthvlocphy9007325hvtargidpla1479442716474psc1amazonaememememliliemthe end history manem francis fukuyama hrefhttpswwwamazoncomendhistorylastmandpb07gfpv7h1refsr_1_1crid2rnj61w7qwkgzkeywordstheendofhistoryandthelastmanqid1661527211sprefixtheendofhist2caps2c84sr81amazonaliliempolitical order political decay industrial revolution globalization democracyem francis fukuyama hrefhttpswwwamazoncompoliticalorderdecayindustrialglobalizationdp0374535620refasc_df_0374535620taghyprod20linkcodedf0hvadid312443114357hvposhvnetwghvrand17968239559841796036hvponehvptwohvqmthvdevchvdvcmdlhvlocinthvlocphy9007325hvtargidpla448758029740psc1amazonaliliemememthe transformation title ix regulating gender equality educationem ememby r shep melnick emememema hrefhttpswwwamazoncomtransformationtitleixregulatingeducationdp0815732228amazonaememememliliememthe inheritors intimate portrait south africas racial reckoningem emby eve fairbanksem ema hrefhttpswwwamazoncominheritorsintimateportraitafricasreckoningdp1476725241refasc_df_1476725241taghyprod20linkcodedf0hvadid564725474608hvposhvnetwghvrand2472350770635167435hvponehvptwohvqmthvdevchvdvcmdlhvlocinthvlocphy9007325hvtargidpla1598515976838psc1amazonaememliul
|
630ac3896f3425b28e115314
|
How to Defeat Illiberalism
|
img althow to defeat illiberalism srchttpswisdomofcrowdslivecontentimages202208political_drama_197121jpgpin strongpart 2 strongof the podcast shadi questioned fukuyama on whether ostensibly liberal states in fact promote a particular conception of the good life for their citizens for example can stateenforced secularism like frances truly be part of a liberal state damir raises the point that the universalist assumptions behind liberalism may simply not be workable in a large diverse societiesppfinally we talk about the specific ways in which rising illiberalism could be beaten back fukuyama believes that the only way to defeat rightwing illiberalism is to defeat it decisively at the polls through the democratic party moving towards the american center and ditching its quotwokequot wing in the long term however he is optimistic about liberalisms prospects and the chances for quotpartisans of human freedomquot to succeedp
|
img althow defeat illiberalism srchttpswisdomofcrowdslivecontentimages202208political_drama_197121jpgpin strongpart 2 strongof podcast shadi questioned fukuyama ostensibly liberal states fact promote particular conception good life citizens example stateenforced secularism like frances truly liberal state damir raises point universalist assumptions liberalism simply workable large diverse societiesppfinally talk specific ways rising illiberalism beaten fukuyama believes way defeat rightwing illiberalism defeat decisively polls democratic party moving american center ditching quotwokequot wing long term optimistic liberalisms prospects chances quotpartisans human freedomquot succeedp
|
630ac52f6f3425b28e11534f
|
There are dark days ahead for the Jewish diaspora
|
pthe post a relnofollow hrefhttpswwwspikedonlinecom20220826therearedarkdaysaheadforthejewishdiasporathere are dark days ahead for the jewish diasporaa appeared first on a relnofollow hrefhttpswwwspikedonlinecomspikedap
|
pthe post relnofollow hrefhttpswwwspikedonlinecom20220826therearedarkdaysaheadforthejewishdiasporathere dark days ahead jewish diasporaa appeared relnofollow hrefhttpswwwspikedonlinecomspikedap
|
630ac78a6f3425b28e1153a7
|
My Conversation with Cynthia L. Haven
|
phere is a relnoopener hrefhttpsconversationswithtylercomepisodescynthiahaven target_blankthe audio and transcripta here is part of the summaryp
blockquotepthose two interests converged as they led her to interview and write books about three writers and thinkers whom she also came to call mentors ren girard czeslaw milosz and joseph brodskyp
pcynthia joined tyler to discuss what shes gleaned from each of the three including what traits they have in common why her biography of girard had to come from outside academia miloszs reaction to the berkley free speech movement girards greatest talent and flaw as a thinker whether brodsky will fall down the memory hole why he was so terrible on ukraine why cynthias early career was much like emthe devil wears pradaem the failings of twitter and morep
blockquote
pand one excerptp
blockquote
pstrongcowen strongwhat is your philosophy of what is missing in most other peoples interviewsp
pstronghaven strongi dont know that its a philosophyp
pstrongcowen strongyou must think youre adding something rightp
pstronghaven strongim interested in big questions i think a lot of people arent a lot of interviewers arent its not an era for big questions is itp
pstrongcowen strong2022 im not surep
pstronghavenstrong reallyp
pstrongcowenstrong maybe the questions are either too big or too small and not enough in betweenp
pstronghaven strongthats an interesting point of viewp
pstrongcowen strongtheres plenty of ideology in the world and in this country it doesnt have to be a emgoodem thing but p
pstronghaven strongideology is different than big questions i thinkp
blockquote
pinteresting throughoutp
pthe post a relnofollow hrefhttpmarginalrevolutioncommarginalrevolution202208myconversationwithcynthialhavenhtmlmy conversation with cynthia l havena appeared first on a relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap
|
phere relnoopener hrefhttpsconversationswithtylercomepisodescynthiahaven target_blankthe audio transcripta summaryp blockquotepthose interests converged led interview write books writers thinkers came mentors ren girard czeslaw milosz joseph brodskyp pcynthia joined tyler discuss shes gleaned including traits common biography girard come outside academia miloszs reaction berkley free speech movement girards greatest talentand flawas thinker brodsky fall memory hole terrible ukraine cynthias early career like emthe devil wears pradaem failings twitter morep blockquote pand excerptp blockquote pstrongcowen strongwhat philosophy missing peoples interviewsp pstronghaven strongi dont know philosophyp pstrongcowen strongyou think youre adding rightp pstronghaven strongim interested big questions think lot people arent lot interviewers arent era big questions itp pstrongcowen strong2022 im surep pstronghavenstrong reallyp pstrongcowenstrong maybe questions big small betweenp pstronghaven strongthats interesting point viewp pstrongcowen strongtheres plenty ideology world country doesnt emgoodem thing butp pstronghaven strongideology different big questions thinkp blockquote pinteresting throughoutp pthe post relnofollow hrefhttpmarginalrevolutioncommarginalrevolution202208myconversationwithcynthialhavenhtmlmy conversation cynthia l havena appeared relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap
|
630acb1f6f3425b28e11542c
|
How Britain haunts America
|
pthe rhetoric of modern america is dominated by the paradigm of a biracial nation but history is never black and white fissures between national and ethnic traditions have always been at the heart of its political conflictp
ptheir significance is highlighted in david hacket fischers ialbions seed four british folkways in americai and kevin phillipss ithe cousins wars religion politics civil warfare and the triumph of angloamericai fischer shows how the factions and coalitions in colonial america played out in the early republic sowing the seeds of the the civil war while continuing to haunt american politics to this day phillips meanwhile flags up the differences between the english settlers of north america and the english of the metropolep
piidiva hrefhttpsunherdcom202206americasfakecastewarrefinnara hrefhttpsunherdcom202206americasfakecastewarrefinnarimg srchttpsunherdcomwpcontentuploads2022062gettyimages692787880scaled1300x213jpgadiva hrefhttpsunherdcom202206americasfakecastewarrefinnarspanmore from this author spanaa hrefhttpsunherdcom202206americasfakecastewarrefinnarh5americas fake caste warh5apa hrefhttpsunherdcom202206americasfakecastewarrefinnarspanbyspan razib khan apdivadiv
pfischers early america is framed around four dominant folkways there are the new england yankees in the northeast gentry planters in the lowland south along with their retainers inhabitants of the upland south originally from ulster and the scottishenglish border and the diverse businessoriented groups in the midatlantic from dutch burghers to quakers for both authors the yankees and the southern planters have direct genealogical connections to the roundhead whigs and the royalist tories the borderers and the more mercantile folk of the midatlantic play a less prominent role in phillips narrative but eventually amalgamated into the broader northern and southern cultural and political alliancesp
pthese groupings would eventually struggle against each other in the american civil war when house member a relnoopener hrefhttpsunherdcom202208americastribesarereadyforwar target_blankpreston brooks nearly beat senator charles sumnera to death on the floor of the senate in 1856 a foreshadowing of the conflict to come it reflected the anxious daggersdrawn national mood but it was also the culmination of centuries of tumultuous history between those disparate strands in british culture which had put down deep roots into north americap
pbrooks was a scion of the south carolina upcountry and exemplar of a nascent fused southern identity a vociferous defender of slavery as a right and proper institution in contrast sumner was a new england yankee through and through brookss focus on family honour he believed sumner had insulted his cousin reflects both the values of the english gentry and of the scotsirish borderers sumner espoused the antislavery cause at a time when compromise between south and north was seen as prudent politics this reflected a yankees commitment to humanitarian justice descended from the utopianism that gripped the roundhead forebears of his new england ancestorsp
diva hrefhttpsunherdcom202109howrationalisstevenpinkersworldrefinnara hrefhttpsunherdcom202109howrationalisstevenpinkersworldrefinnarimg srchttpsunherdcomwpcontentuploads202109gettyimages1301892355scaled1300x200jpgadiva hrefhttpsunherdcom202109howrationalisstevenpinkersworldrefinnarspanmore from this author spanaa hrefhttpsunherdcom202109howrationalisstevenpinkersworldrefinnarh5how rational is steven pinkers worldh5apa hrefhttpsunherdcom202109howrationalisstevenpinkersworldrefinnarspanbyspan razib khan apdivadiv
pwhere the ultimate basis of this american factionalism puritan new england yankee against southern planter cavalier can be found in england roundhead east anglia against the royalist glens of devonshire ithe cousins wars iobserves that the migration to north america of dissenters simultaneously enabled the creation of britain as a cohesive 19thcentury power after the false dawn of the english republic in the 1650s puritanminded protestantism only flourished as the dominant force in new england the existence of north america as a release valve for radical protestantism stabilised the middle path that the anglican church occupied meanwhile the irish potato famine and the mass migration to the us of roman catholic peasants meant that the protestant proportion of the united kingdom was far higher in 1900 than in 1800 there are victors in ithe cousins wars i just different ones in different placesp
pthe englishmen scots or welshmen who migrated to america were not normal britons perhaps they sought more freedom of worship outside the established church or more economic opportunities outside of the class system or perhaps they were fleeing debt and the hand of the law the cowboy is a clich but these cowboys came from somewhere many even genealogically descended from herders on the scottish border that engaged in as much theft as productive labor the inverse of the american cowboy were the english who were left behind the aristocrats peasants and gentry who came together to create a british empire with a much more united cultural identity in the 19th century than it had in the 17th centuryp
pialbions seed iandi the cousins wars ihave as much to do with the present and future as the past donald trumps victory in 2016 saw the emergence of a belt of red republican counties dominated by borderers attracted to the aggressive pugilistic style of their candidate though barack obama was perceived by america and the world as the first black president he was raised by a mother whose paternal grandfather was named ralph waldo emerson dunham a nod to her ancestral yankee lineage obama presented a moralistic even utopian vision for america in keeping with this ancestryp
diva hrefhttpsunherdcom202207vikingsneedtobetamedrefinnara hrefhttpsunherdcom202207vikingsneedtobetamedrefinnarimg srchttpsunherdcomwpcontentuploads202207vikingpice1657186060148300x156jpgadiva hrefhttpsunherdcom202207vikingsneedtobetamedrefinnarspanmore from this author spanaa hrefhttpsunherdcom202207vikingsneedtobetamedrefinnarh5vikings need to be tamedh5apa hrefhttpsunherdcom202207vikingsneedtobetamedrefinnarspanbyspan razib khan apdivadiv
pin contrast trump the germanscottish son of new yorks outer boroughs reflects a persona that is in tension with the dominant yankee tradition of the north it is not well remembered but during the civil war new york city was a hotbed of prosouthern sentiment and the mayor fernando wood even proposed the citys secession from the union to the west much of southern illinois indiana and ohio were proconfederate during the conflict because the local population were butternuts descended from settlers who had moved north in the first half of the 19th century like kentuckyborn abraham lincoln the great emancipator was though a direct descendent of samuel lincoln of norfolk east anglia who was to settle in massachusetts in 1638p
diva hrefhttpsunherdcom202111wouldamericasurviveacivilwarrefinnara hrefhttpsunherdcom202111wouldamericasurviveacivilwarrefinnarimg srchttpsunherdcomwpcontentuploads202111gettyimages6094814501scalede16366526132601300x169jpgadiva hrefhttpsunherdcom202111wouldamericasurviveacivilwarrefinnarspansuggested articlespanaa hrefhttpsunherdcom202111wouldamericasurviveacivilwarrefinnarh5would america survive a civil warh5apa hrefhttpsunherdcom202111wouldamericasurviveacivilwarrefinnarspanbyspan malcom kyeyune apdivadiv
pthough the old ethnicities are in decline today their shadow still haunts the present as the us fractures along cultural and regional lines again the progressive cultural left has rekindled the flame of enthusiastic abolitionism attempting to attain cosmic justice in their utopia maga america in contrast channels the irascible and pessimistic vision of the borders and their tribune is a fighter focused more on winning than policy in the 19th century the switch of the populace of the lower north pennsylvania ohio and indiana to an alliance with new england yankees signalled the rise of a new republican ascendancy that would persist down to fdrs day now we are witnessing americans of latin american heritage frustrated with the moralism and cultural politics of the progressive left eyeing perhaps a realignment with the borderers with whom they might share a cultural ethos if not historyp
ponce you read fischer and phillipss narrative the past becomes illuminated you can see shadows of the future already being castp
a hrefhttpsunherdcom202208howbritainhauntsamericaappcommentsview 8 commentsa
|
pthe rhetoric modern america dominated paradigm biracial nation history black white fissures national ethnic traditions heart political conflictp ptheir significance highlighted david hacket fischers ialbions seed british folkways americai kevin phillipss ithe cousins wars religion politics civil warfare triumph angloamericai fischer shows factions coalitions colonial america played early republic sowing seeds civil war continuing haunt american politics day phillips flags differences english settlers north america english metropolep piidiva hrefhttpsunherdcom202206americasfakecastewarrefinnara hrefhttpsunherdcom202206americasfakecastewarrefinnarimg srchttpsunherdcomwpcontentuploads2022062gettyimages692787880scaled1300x213jpgadiva hrefhttpsunherdcom202206americasfakecastewarrefinnarspanmore author spanaa hrefhttpsunherdcom202206americasfakecastewarrefinnarh5americas fake caste warh5apa hrefhttpsunherdcom202206americasfakecastewarrefinnarspanbyspan razib khan apdivadiv pfischers early america framed dominant folkways new england yankees northeast gentry planters lowland south retainers inhabitants upland south originally ulster scottishenglish border diverse businessoriented groups midatlantic dutch burghers quakers authors yankees southern planters direct genealogical connections roundhead whigs royalist toriesthe borderers mercantile folk midatlantic play prominent role phillips narrative eventually amalgamated broader northern southern cultural political alliancesp pthese groupings eventually struggle american civil war house member relnoopener hrefhttpsunherdcom202208americastribesarereadyforwar target_blankpreston brooks nearly beat senator charles sumnera death floor senate 1856 foreshadowing conflict come reflected anxious daggersdrawn national mood culmination centuries tumultuous history disparate strands british culture deep roots north americap pbrooks scion south carolina upcountry exemplar nascent fused southern identity vociferous defender slavery right proper institution contrast sumner new england yankee brookss focus family honour believed sumner insulted cousin reflects values english gentry scotsirish borderers sumner espoused antislavery cause time compromise south north seen prudent politics reflected yankees commitment humanitarian justice descended utopianism gripped roundhead forebears new england ancestorsp diva hrefhttpsunherdcom202109howrationalisstevenpinkersworldrefinnara hrefhttpsunherdcom202109howrationalisstevenpinkersworldrefinnarimg srchttpsunherdcomwpcontentuploads202109gettyimages1301892355scaled1300x200jpgadiva hrefhttpsunherdcom202109howrationalisstevenpinkersworldrefinnarspanmore author spanaa hrefhttpsunherdcom202109howrationalisstevenpinkersworldrefinnarh5how rational steven pinkers worldh5apa hrefhttpsunherdcom202109howrationalisstevenpinkersworldrefinnarspanbyspan razib khan apdivadiv pwhere ultimate basis american factionalism puritan new england yankee southern planter cavalier found england roundhead east anglia royalist glens devonshire ithe cousins wars iobserves migration north america dissenters simultaneously enabled creation britain cohesive 19thcentury power false dawn english republic 1650s puritanminded protestantism flourished dominant force new england existence north america release valve radical protestantism stabilised middle path anglican church occupied irish potato famine mass migration roman catholic peasants meant protestant proportion united kingdom far higher 1900 1800 victors ithe cousins wars ijust different ones different placesp pthe englishmen scots welshmen migrated america normal britons sought freedom worship outside established church economic opportunities outside class system fleeing debt hand law cowboy clich cowboys came genealogically descended herders scottish border engaged theft productive labor inverse american cowboy english left aristocrats peasants gentry came create british empire united cultural identity 19th century 17th centuryp pialbions seed iandi cousins wars ihave present future past donald trumps victory 2016 saw emergence belt red republican counties dominated borderers attracted aggressive pugilistic style candidate barack obama perceived america world black president raised mother paternal grandfather named ralph waldo emerson dunham nod ancestral yankee lineage obama presented moralistic utopian vision america keeping ancestryp diva hrefhttpsunherdcom202207vikingsneedtobetamedrefinnara hrefhttpsunherdcom202207vikingsneedtobetamedrefinnarimg srchttpsunherdcomwpcontentuploads202207vikingpice1657186060148300x156jpgadiva hrefhttpsunherdcom202207vikingsneedtobetamedrefinnarspanmore author spanaa hrefhttpsunherdcom202207vikingsneedtobetamedrefinnarh5vikings need tamedh5apa hrefhttpsunherdcom202207vikingsneedtobetamedrefinnarspanbyspan razib khan apdivadiv pin contrast trump germanscottish son new yorks outer boroughs reflects persona tension dominant yankee tradition north remembered civil war new york city hotbed prosouthern sentiment mayor fernando wood proposed citys secession union west southern illinois indiana ohio proconfederate conflict local population butternuts descended settlers moved north half 19th century like kentuckyborn abraham lincoln great emancipator direct descendent samuel lincoln norfolk east anglia settle massachusetts 1638p diva hrefhttpsunherdcom202111wouldamericasurviveacivilwarrefinnara hrefhttpsunherdcom202111wouldamericasurviveacivilwarrefinnarimg srchttpsunherdcomwpcontentuploads202111gettyimages6094814501scalede16366526132601300x169jpgadiva hrefhttpsunherdcom202111wouldamericasurviveacivilwarrefinnarspansuggested articlespanaa hrefhttpsunherdcom202111wouldamericasurviveacivilwarrefinnarh5would america survive civil warh5apa hrefhttpsunherdcom202111wouldamericasurviveacivilwarrefinnarspanbyspan malcom kyeyune apdivadiv pthough old ethnicities decline today shadow haunts present fractures cultural regional lines progressive cultural left rekindled flame enthusiastic abolitionism attempting attain cosmic justice utopia maga america contrast channels irascible pessimistic vision borders tribune fighter focused winning policy 19th century switch populace lower north pennsylvania ohio indiana alliance new england yankees signalled rise new republican ascendancy persist fdrs day witnessing americans latin american heritage frustrated moralism cultural politics progressive left eyeing realignment borderers share cultural ethos historyp ponce read fischer phillipss narrative past illuminated shadows future castp hrefhttpsunherdcom202208howbritainhauntsamericaappcommentsview 8 commentsa
|
630bed644ab25e37cec3295f
|
Salman Rushdie's The Satanic Verses Enraged the Muslim World
|
div
picture
source sizesminwidth 600px 331px 100vw typeimagewebp srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202206vignettethesatanicversesjpgwebp 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202206vignettethesatanicversesjpgwebp 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202206vignettethesatanicverses800x450jpgwebp 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202206vignettethesatanicverses600x338jpgwebp 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202206vignettethesatanicverses331x186jpgwebp 331w
source sizesminwidth 600px 331px 100vw typeimagejpeg srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202206vignettethesatanicversesjpg 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202206vignettethesatanicversesjpg 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202206vignettethesatanicverses800x450jpg 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202206vignettethesatanicverses600x338jpg 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202206vignettethesatanicverses331x186jpg 331w
img width1200 altsalman rushdies the satanic verses banned book srchttpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202206vignettethesatanicverses800x450jpg height675
picture
div
pthe fallout from salman rushdies emthe satanic versesem 1988 was even more bizarre and terrifying than the novels opening sequence in which a hijacked plane flying from india to britain explodes over the english channel and the two protagonists gibreel and saladin are transformed into an archangel and devil respectivelyp
pwhile gibreelwho has been transformed into the archangel gabrielfalls into the atlantic he has several dreams including one about an alternateuniverse founding of islam by a man named mahound emmahoundem another name for muhammad was used by christians in the middle ages in these visions the emerging religion allows the worship of several goddesses and doubt is cast on the divine nature of the prophets words rushdie went so far as to name the books prostitute characters after muhammads wivesp
preaders later learn that these visions were sent by the devil but the fun housemirror image of islam nevertheless angered much of the muslim world in 1989 iranian leader ayatollah khomeini called for the author and those involved in the books publication to be put to death clerics and government officials were in essence instructing muslims to hunt and kill rushdie with islamic organizations closely aligned with the government placing a 25 million bounty on his headp
pthe consequences were grim rushdie was put under police protection at his home in the united kingdom for the better part of a decade hitoshi igarashi a japanese translator for the book was killed by an unknown attacker in 1991 an italian translator of the book named ettore capriolo was stabbed but did not die from his wounds that same year aziz nesin a turkish translator was attacked by arsonists while praying with others the fire killed 37 people though nesin survivedp
pin 1989 india banned the book deeming it hate speech quotthese persons whom i do not hesitate to call extremists even fundamentalists have attacked me and my novel while stating that they had no need actually to read itquot wrote rushdie in emthe new york timesem quotthat the government should have given in to such figures is profoundly disturbingquot he noted that indias parliament described the ban as a quotpreemptive measurequot since quotcertain passages had been identified as susceptible to distortion and misuse presumably by unscrupulous religious fanatics and such the banning order had been issued to prevent this misusequotp
prushdie summed up the governments tortured logic quotit is as though having identified an innocent person as a likely target for assault by muggers or rapists you were to put that person in jail for protectionquotp
pthe post a relnofollow hrefhttpsreasoncom20220828thesatanicversessalman rushdies ltemthe satanic versesltem enraged the muslim worlda appeared first on a relnofollow hrefhttpsreasoncomreasoncomap
|
div picture source sizesminwidth 600px 331px 100vw typeimagewebp srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202206vignettethesatanicversesjpgwebp 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202206vignettethesatanicversesjpgwebp 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202206vignettethesatanicverses800x450jpgwebp 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202206vignettethesatanicverses600x338jpgwebp 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202206vignettethesatanicverses331x186jpgwebp 331w source sizesminwidth 600px 331px 100vw typeimagejpeg srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202206vignettethesatanicversesjpg 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202206vignettethesatanicversesjpg 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202206vignettethesatanicverses800x450jpg 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202206vignettethesatanicverses600x338jpg 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202206vignettethesatanicverses331x186jpg 331w img width1200 altsalman rushdies satanic verses banned book srchttpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202206vignettethesatanicverses800x450jpg height675 picture div pthe fallout salman rushdiesemthe satanic versesem1988 bizarre terrifying novels opening sequence hijacked plane flying india britain explodes english channel protagonists gibreel saladin transformed archangel devil respectivelyp pwhile gibreelwho transformed archangel gabrielfalls atlantic dreams including alternateuniverse founding islam man named mahound emmahoundem muhammad christians middle ages visions emerging religion allows worship goddesses doubt cast divine nature prophets words rushdie went far books prostitute characters muhammads wivesp preaders later learn visions sent devil fun housemirror image islam angered muslim world 1989 iranian leader ayatollah khomeini called author involved books publication death clerics government officials essence instructing muslims hunt kill rushdie islamic organizations closely aligned government placing 25 million bounty headp pthe consequences grim rushdie police protection home united kingdom better decade hitoshi igarashi japanese translator book killed unknown attacker 1991 italian translator book named ettore capriolo stabbed die wounds year aziz nesin turkish translator attacked arsonists praying fire killed 37 people nesin survivedp pin 1989 india banned book deeming hate speech quotthese persons hesitate extremists fundamentalists attacked novel stating need actually read itquot wrote rushdie inemthe new york timesem quotthat government given figures profoundly disturbingquot noted indias parliament described ban quotpreemptive measurequot quotcertain passages identified susceptible distortion misuse presumably unscrupulous religious fanatics banning order issued prevent misusequotp prushdie summed governments tortured logic quotit having identified innocent person likely target assault muggers rapists person jail protectionquotp pthe post relnofollow hrefhttpsreasoncom20220828thesatanicversessalman rushdies ltemthe satanic versesltem enraged muslim worlda appeared relnofollow hrefhttpsreasoncomreasoncomap
|
630beda14ab25e37cec32965
|
The Fall of ‘Nature’
|
img altthe fall of nature srchttpss3amazonawscomprodstaticcontentquillettecom202208naturepngpppemand science we should insist better than any other discipline can hold up to its students and followers an ideal of patient devotion to the search for objective truth with vision unclouded by personal or political motiveembr
sir henry hallett dalep
palthough the modern prestige bestowed upon science is laudable it is not without peril for as the ideological value of science increases so too does the threat to its objectivity slogans and hashtags can quickly politicize science and scientists can be tempted to subordinate the pursuit of the truth to moral or political ends as they become aware of their own prodigious social importance inconvenient data can be suppressed or hidden and inconvenient research can be quashed this is especially true when one political tribe or faction enjoys disproportionate influence in academiaits members can disfigure science often unconsciously to support their own ideological preferences this is how science becomes more like propaganda than empiricism and academia becomes more like a partisan media organization than an impartial institution ppa hrefhttpswwwnaturecomarticless41562022014432an editoriala in emnature human behavior emprovides the most recent indication of just how bad things are becoming it begins like so many essays of its kind by announcing that although academic freedom is fundamental it is not unbounded when the invocation of a fundamental freedom in one clause is immediately undermined in the next we should be skeptical of whatever follows but in this case the authors are taking issue with a view very few people actually hold at minimum most academics will readily accept that scientific curiosity should be constrained by ethical concerns about research participants pfigureblockquote classtwittertweetp langen dirltrmy latest editorial for naturehumanbehav on why ethics principles of benefit and harm should apply to all research about humans not just primary research with human participants a hrefhttpstcojp5z1mkzi9httpstcojp5z1mkzi9ap stavroula kousta koustastavroula a hrefhttpstwittercomkoustastavroulastatus1562034181894455296ref_srctwsrc5etfwaugust 23 2022ablockquote
figurepunfortunately the authors then announce that they also wish to apply these wellestablished ethics frameworks to humans who do not participate directly in the research they are especially concerned that people can be harmed indirectly by research that inadvertently stigmatizes individuals or human groups such research may be discriminatory racist sexist ableist or homophobic and may provide justification for undermining the rights of specific groups simply because of their social characteristics because of these concerns the springer nature community has worked up a new set of research guidelines intended to address these potential harms explicitly applying ethics frameworks for research with human participations to any academic publication ppin plain language this means that from now on the journal will reject articles that might potentially harm even inadvertently those individuals or groups most vulnerable to racism sexism ableism or homophobia since it is already standard practice to reject false or poorly argued work it is safe to assume that these new guidelines have been designed to reject any article deemed to pose a threat to disadvantaged groups irrespective of whether or not its central claims are true or at least wellsupported within a few sentences we have moved from a banal statement of the obvious to draconian and censorious editorial discretion editors will now enjoy unprecedented power to reject articles on the basis of nebulous moral concerns and anticipated harms pfigureblockquote classtwittertweetp langen dirltrsome argue that we should evaluate such research only on the basis of its scientific soundness and merit i disagreep stavroula kousta koustastavroula a hrefhttpstwittercomkoustastavroulastatus1562034502897106946ref_srctwsrc5etfwaugust 23 2022ablockquote
figurepimagine for a moment that this editorial were written not by political progressives but by conservative catholics who announced that any research promoting even inadvertently promiscuous sex the breakdown of the nuclear family agnosticism and atheism or the decline of the nation state would be suppressed or rejected lest it inflict unspecified harm on vaguely defined groups or individuals many of those presently nodding along with emnatureems editors would have no difficulty identifying the subordination of science to a political agenda one need not argue that opposing racism or promoting the nuclear family are dubious goals in order to also worry about elevating them over free inquiry and the dispassionate pursuit of understanding ppsuppose someone discovers that men are more likely than women to be represented at the tail end of the mathematical ability distribution and therefore more likely to be engineers or physics professors does such a finding constitute sexism if only by implication does it stigmatize or help to negatively stereotype women are the authors of the editorial contending that journals should not publish an article that contains these data or makes such an argument the very vagueness of these new guidelines allowsor rather emrequiresemthe political biases of editors and reviewers to intrude into the publishing process ppas the editorial proceeds it becomes steadily more alarming and more explicitly political advancing knowledge and understanding the authors declare is also a fundamental public good in some cases however potential harms to the populations studied may outweigh the benefit of publication such as any material that undermines the dignity or rights of specific groups or assumes that a human group is superior or inferior over another simply because of a social characteristic will be sufficient to raise ethics concerns that may require revisions or supersede the value of publication ppbut no serious scientist or scholar contends that some groups are superior or inferior to others those who write candidly about sex and population differences such as a hrefhttpsbooksgooglecombooksaboutmale_femalehtmlidxqkpaqaamaajdavid gearya or a hrefhttpsbooksgooglecombooksabouthuman_diversityhtmlid_6oxdwaaqbajcharles murraya routinely preface discussion of their findings with the unambiguous declaration that empirical differences emdo not justify claims of superiority or inferiorityem nevertheless the editorial is a warrant to attack silence and suppress research that finds differences of any social significance between sexes or populations emregardless of whether or not such differences do in fact existem the empirical claim that men are overrepresented visvis women at the extreme right tail of the distribution of mathematical ability can therefore be rejected on the basis that it may be understood to imply a claim of male superiority even if no such claim is made and even if it is explicitly disavowedppsensing the dangerous and censorious path they are walking the authors pause to offer a sop to those of us who still believe in the importance of academic freedom pblockquotethere is a fine balance between academic freedom and the protection of the dignity and rights of individuals and human groups we commit to using this guidance cautiously and judiciously consulting with ethics experts and advocacy groups where needed ensuring that ethically conducted research on individual differences and differences among human groups flourishes and no research is discouraged simply because it may be socially or academically controversial is as important as preventing harmblockquotepthis is not at all reassuring asking ethicists to assess the wisdom of publishing a journal article is as antithetical to the spirit of science as soliciting publication advice from a religious scholar who are these ethics experts and advocacy groups anyway i am skeptical of ethical expertise i am especially skeptical of ethical expertise from an academy more inclined to reward conclusions that support progressive preferences than those that emerge from empirical study and rational thought i am more skeptical still of advocacy groups which exist to pursue a political agenda and are therefore by their very nature a good deal more interested in what is useful than what is trueppimagine the outcry on the left if a journal announced it would be consulting prolife advocates before publishing an article about the effects of abortion on wellbeing or if it decided to consult conservative evangelicals when evaluating an article about the effects of adoption by homosexual couples the journal is effectively announcing the employment of sensitivity readers who it can safely be assumed will invariably recommend the riskaverse option of suppression whenever the possibility of controversy arises ppbefore they set out their new guidelines the authors take a moment to selfflagellate with a cookie cutter denunciation of science for its dismal history of inequality and discrimination still with this guidance we take a step toward countering this they say as if it were an act of atonement i find that i am more positive about the science of the past than the editorials authors and more gloomy about the socialjusticeoriented science of the future they are proposing yes humans are flawed and fallible and always will be so we must accept that science will forever be an imperfect endeavor but the best way to correct its imperfections is not to demand the capitulation of science to ideology but to remain alive to our biases and devise mechanisms that can compensate for them trying to counter past bias by replacing it with a new kind of bias is selfevidently nonsensicallike trying to conquer alcohol consumption by replacing beer with hard liquor pppredictably the proposed editorial guidelines focus on the needs and sensitivities of groups perceived to be marginalized and identified by race ethnicity class sex and sexual orientation religious and political beliefs age and disability and naturally the guidelines themselves are as vague and troubling as the rest of the editorial the authors reiterate that they want to extend protections for research participants across the entire publishing process harms they note can also arise indirectly as a result of the publication of a research project or a piece of scholarly communicationfor instance stigmatization of a vulnerable human group or potential use of the results of research for unintended purposes eg public policies that undermine human rights or misuse of information to threaten public healthpplike almost everything else in the editorial this claim is unhelpfully ambiguous and politically contentious furthermore possible realworld harms or benefits that result from the publication of academic papers are incredibly perhaps prohibitively difficult to anticipate and measure would a paper that finds homosexual men to be more promiscuous on average than heterosexual men result in the stigmatization of or harm to a vulnerable human group the answer would depend in no small part upon the respondents view of homosexuality and how capacious or otherwise their definitions of stigmatization and harm are ppthe notion that homosexual men are more promiscuous than straight men might produce some negative stereotypes about the former but it could also raise awareness of the disproportionate dangers posed to homosexual mens sexual health by unprotected promiscuity which might in turn lead to a reduction in the rate of sexually transmitted infections we simply do not know this is precisely why peer review should only consider the plausibility and theoretical importance of articles not their unknowable political and moral effects ppthe new guidelines state that even if a project were to be reviewed and approved by appropriate committees editors reserve the right to request modifications or even refuse publication or retract postpublication if it contains content thatpblockquoteis premised upon the assumption of inherent biological social or cultural superiority or inferiority of one human group over another based on race ethnicity national or social origin sex gender identity sexual orientation religion political or other beliefs age disease disability or other socially constructed or socially relevant groupings hereafter referred to as socially constructed or socially relevant human groupingsblockquoteporpblockquoteunderminesor could reasonably be perceived to underminethe rights and dignities of an individual or human group on the basis of socially constructed or socially relevant human groupingsblockquoteporpblockquoteembod[ies] singular privileged perspectives which are exclusionary of a diversity of voices in relation to socially constructed or socially relevant human groupings and which purport such perspectives to be generalisable andor assumedblockquotepno examples are adduced of course so it is difficult to know what kind of content would commit these retractable iniquities could a discussion of group differences in cognitive ability reasonably be perceived to undermine the rights and dignities of an individual or human group would an exploration of sex differences in homicide rates would an analysis of political differences in cognitive rigidity would a test of the association between religiosity and prosociality and who is to be the judge of what is and is not reasonable and what does or does not constitute undermining ppambiguity is piled upon ambiguity to expand the capricious purview of the censor it does not require clairvoyance to predict that these criteria will not be consistently applied it may be considered racist to point out that a disproportionate number of crimes are committed by black americans but it will surely not be considered misandrist to point out that a disproportionate number of crimes are committed by american males even those who work ardently for the triumph of progressive ideas and values should shudder not only will these guidelines further degrade the already embattled prestige of science but they offer remarkable deference to the idiosyncratic moral concerns of editors and reviewers which are subject to change at short notice as radical feminists have recently discovered those who sit within the progressive overton window today may find themselves thrust outside of it tomorrowvictims of a censorious system they thought they were erecting in their own interestsppthe guidelines intended to combat racism begin by announcing that race and ethnicity are sociopolitical constructs this is a contentious claim even if we could agree on what is meant by sociopolitical construct and it is one that i happen to think is unsupported by either the a hrefhttpspubmedncbinlmnihgov30300578dataa or by sound philosophical a hrefhttpsphilpapersorgrecsesrasargumenta even so the section goes on to assert that pblockquotebiomedical studies should not conflate genetic ancestry a biological construct and raceethnicity sociopolitical constructs although raceethnicity are important constructs for the study of disparities in health outcomes and health care empirically established genetic ancestry is the appropriate construct for the study of the biological aetiology of diseases or differences in treatment responseblockquotepthis convoluted reasoning will surely only aggravate existing double standards in discussions of race and ethnicitythose who contend that society is teeming with racism can point to disadvantages experienced by racial groups but those who contend that disparities are caused by behavioral differences are flatly told that race does not exist would these standards be consistently applied to a paper that examined racial disparities in police shootings and a paper that examined racial differences in crime rates ppracism we are told is scientifically unfounded and ethically untenable editors reserve the right to request modifications to or correct or otherwise amend postpublication and in severe cases refuse publication of or retract postpublication racist content but since scientifically unfounded material can be rejected on that basis alone there is no need to invoke potential harms to vulnerable groups as an additional justification the authors implication seems to be that racism should be understood unlike the reverse variety to apply to some groups and not others and that what the authors wish to oppose is research that might discredit the efficacy or justness of say affirmative action but since the editorial and its guidelines provide no examples of supposedly racist content it is difficult to know ppthe section on sex gender and sexual orientation is similarly vague and tendentious the authors claim for example that there is a spectrum of gender identities and expression defining how individuals identify themselves and express their gender well maybe but this is an ideologically provocative claimand certainly one with which many people across the political spectrum will strongly disagree brazenly avoiding any pretense of objectivity the authors then itemize the usual laundry list of putative gender identities including but not limited to transgender genderqueer genderfluid nonbinary gendervariant genderless agender nongender bigender trans man trans woman trans masculine trans feminine and cisgender gender norms we are told are not fixed but evolve across time and space as such definitions will require frequent revisiting it is hard to imagine that more than five percent of conservatives would agree to this but that is evidently of no concern to the authors the chief purpose of this section seems to be to signal to other progressives we are on your side and to send a corresponding signal to conservatives you are not our peopleppthe editorial closes by declaring that researchers are encouraged to promote equality in their academic research and that editors reserve the right to retract articles that are sexist misogynistic andor antilgbtq again no examples of these retractionworthy crimes are offered and so familiar objections resurface is a paper that contends that men are physically stronger than women misogynistic is a paper that examines the correlation between transidentity and other mental illnesses antilgbtq ppscience is a human activity and like all human activities it is influenced by human values human biases and human imperfections those will never be eliminated the banner of science has undoubtedly been waved to justify excuse or otherwise rationalize appalling crimes and atrocities from the racial pseudoscience of the nazis to the blank slatism and lysenkoism of the communists but the correct response to these distortions is not to endorse a highly partisan vision of science that promotes a progressive worldview alienating all those who disagree and further encouraging doubt about the objectivity of scientific endeavor the correct response is to preserve an adversarial vision of science that promotes debate disagreement and free inquiry as the best way to reach the truthp
|
img altthe fall nature srchttpss3amazonawscomprodstaticcontentquillettecom202208naturepngpppemand science insist better discipline hold students followers ideal patient devotion search objective truth vision unclouded personal political motiveembr sir henry hallett dalep palthough modern prestige bestowed science laudable peril ideological value science increases threat objectivity slogans hashtags quickly politicize science scientists tempted subordinate pursuit truth moral political ends aware prodigious social importance inconvenient data suppressed hidden inconvenient research quashed especially true political tribe faction enjoys disproportionate influence academiaits members disfigure science unconsciously support ideological preferences science like propaganda empiricism academia like partisan media organization impartial institution ppa hrefhttpswwwnaturecomarticless41562022014432an editoriala emnature human behavior emprovides recent indication bad things begins like essays kind announcing academic freedom fundamental unbounded invocation fundamental freedom clause immediately undermined skeptical follows case authors taking issue view people actually hold minimum academics readily accept scientific curiosity constrained ethical concerns research participants pfigureblockquote classtwittertweetp langen dirltrmy latest editorial naturehumanbehav ethics principles benefit harm apply research humans primary research human participants hrefhttpstcojp5z1mkzi9httpstcojp5z1mkzi9ap stavroula kousta koustastavroula hrefhttpstwittercomkoustastavroulastatus1562034181894455296ref_srctwsrc5etfwaugust 23 2022ablockquote figurepunfortunately authors announce wish apply wellestablished ethics frameworks humans participate directly research especially concerned people harmed indirectly research inadvertently stigmatizes individuals human groups research discriminatory racist sexist ableist homophobic provide justification undermining rights specific groups simply social characteristics concerns springer nature community worked new set research guidelines intended address potential harms explicitly applying ethics frameworks research human participations academic publication ppin plain language means journal reject articles potentially harm inadvertently individuals groups vulnerable racism sexism ableism homophobia standard practice reject false poorly argued work safe assume new guidelines designed reject article deemed pose threat disadvantaged groups irrespective central claims true wellsupported sentences moved banal statement obvious draconian censorious editorial discretion editors enjoy unprecedented power reject articles basis nebulous moral concerns anticipated harms pfigureblockquote classtwittertweetp langen dirltrsome argue evaluate research basis scientific soundness merit disagreep stavroula kousta koustastavroula hrefhttpstwittercomkoustastavroulastatus1562034502897106946ref_srctwsrc5etfwaugust 23 2022ablockquote figurepimagine moment editorial written political progressives conservative catholics announced research promoting inadvertently promiscuous sex breakdown nuclear family agnosticism atheism decline nation state suppressed rejected lest inflict unspecified harm vaguely defined groups individuals presently nodding emnatureems editors difficulty identifying subordination science political agenda need argue opposing racism promoting nuclear family dubious goals order worry elevating free inquiry dispassionate pursuit understanding ppsuppose discovers men likely women represented tail end mathematical ability distribution likely engineers physics professors finding constitute sexism implication stigmatize help negatively stereotype women authors editorial contending journals publish article contains data makes argument vagueness new guidelines allowsor emrequiresemthe political biases editors reviewers intrude publishing process ppas editorial proceeds steadily alarming explicitly political advancing knowledge understanding authors declare fundamental public good cases potential harms populations studied outweigh benefit publication material undermines dignity rights specific groups assumes human group superior inferior simply social characteristic sufficient raise ethics concerns require revisions supersede value publication ppbut scientist scholar contends groups superior inferior write candidly sex population differences hrefhttpsbooksgooglecombooksaboutmale_femalehtmlidxqkpaqaamaajdavid gearya hrefhttpsbooksgooglecombooksabouthuman_diversityhtmlid_6oxdwaaqbajcharles murraya routinely preface discussion findings unambiguous declaration empirical differences emdo justify claims superiority inferiorityem editorial warrant attack silence suppress research finds differences social significance sexes populations emregardless differences fact existem empirical claim men overrepresented visvis women extreme right tail distribution mathematical ability rejected basis understood imply claim male superiority claim explicitly disavowedppsensing dangerous censorious path walking authors pause offer sop believe importance academic freedom pblockquotethere fine balance academic freedom protection dignity rights individuals human groups commit guidance cautiously judiciously consulting ethics experts advocacy groups needed ensuring ethically conducted research individual differences differences human groups flourishes research discouraged simply socially academically controversial important preventing harmblockquotepthis reassuring asking ethicists assess wisdom publishing journal article antithetical spirit science soliciting publication advice religious scholar ethics experts advocacy groups skeptical ethical expertise especially skeptical ethical expertise academy inclined reward conclusions support progressive preferences emerge empirical study rational thought skeptical advocacy groups exist pursue political agenda nature good deal interested useful trueppimagine outcry left journal announced consulting prolife advocates publishing article effects abortion wellbeing decided consult conservative evangelicals evaluating article effects adoption homosexual couples journal effectively announcing employment sensitivity readers safely assumed invariably recommend riskaverse option suppression possibility controversy arises ppbefore set new guidelines authors moment selfflagellate cookie cutter denunciation science dismal history inequality discrimination guidance step countering act atonement find positive science past editorials authors gloomy socialjusticeoriented science future proposing yes humans flawed fallible accept science forever imperfect endeavor best way correct imperfections demand capitulation science ideology remain alive biases devise mechanisms compensate trying counter past bias replacing new kind bias selfevidently nonsensicallike trying conquer alcohol consumption replacing beer hard liquor pppredictably proposed editorial guidelines focus needs sensitivities groups perceived marginalized identified race ethnicity class sex sexual orientation religious political beliefs age disability naturally guidelines vague troubling rest editorial authors reiterate want extend protections research participants entire publishing process harms note arise indirectly result publication research project piece scholarly communicationfor instance stigmatization vulnerable human group potential use results research unintended purposes eg public policies undermine human rights misuse information threaten public healthpplike editorial claim unhelpfully ambiguous politically contentious furthermore possible realworld harms benefits result publication academic papers incredibly prohibitively difficult anticipate measure paper finds homosexual men promiscuous average heterosexual men result stigmatization harm vulnerable human group answer depend small respondents view homosexuality capacious definitions stigmatization harm ppthe notion homosexual men promiscuous straight men produce negative stereotypes raise awareness disproportionate dangers posed homosexual mens sexual health unprotected promiscuity turn lead reduction rate sexually transmitted infections simply know precisely peer review consider plausibility theoretical importance articles unknowable political moral effects ppthe new guidelines state project reviewed approved appropriate committees editors reserve right request modifications refuse publication retract postpublication contains content thatpblockquoteis premised assumption inherent biological social cultural superiority inferiority human group based race ethnicity national social origin sex gender identity sexual orientation religion political beliefs age disease disability socially constructed socially relevant groupings referred socially constructed socially relevant human groupingsblockquoteporpblockquoteunderminesor reasonably perceived underminethe rights dignities individual human group basis socially constructed socially relevant human groupingsblockquoteporpblockquoteembod[ies] singular privileged perspectives exclusionary diversity voices relation socially constructed socially relevant human groupings purport perspectives generalisable andor assumedblockquotepno examples adduced course difficult know kind content commit retractable iniquities discussion group differences cognitive ability reasonably perceived undermine rights dignities individual human group exploration sex differences homicide rates analysis political differences cognitive rigidity test association religiosity prosociality judge reasonable constitute undermining ppambiguity piled ambiguity expand capricious purview censor require clairvoyance predict criteria consistently applied considered racist point disproportionate number crimes committed black americans surely considered misandrist point disproportionate number crimes committed american males work ardently triumph progressive ideas values shudder guidelines degrade embattled prestige science offer remarkable deference idiosyncratic moral concerns editors reviewers subject change short notice radical feminists recently discovered sit progressive overton window today find thrust outside tomorrowvictims censorious system thought erecting interestsppthe guidelines intended combat racism begin announcing race ethnicity sociopolitical constructs contentious claim agree meant sociopolitical construct happen think unsupported hrefhttpspubmedncbinlmnihgov30300578dataa sound philosophical hrefhttpsphilpapersorgrecsesrasargumenta section goes assert pblockquotebiomedical studies conflate genetic ancestry biological construct raceethnicity sociopolitical constructs raceethnicity important constructs study disparities health outcomes health care empirically established genetic ancestry appropriate construct study biological aetiology diseases differences treatment responseblockquotepthis convoluted reasoning surely aggravate existing double standards discussions race ethnicitythose contend society teeming racism point disadvantages experienced racial groups contend disparities caused behavioral differences flatly told race exist standards consistently applied paper examined racial disparities police shootings paper examined racial differences crime rates ppracism told scientifically unfounded ethically untenable editors reserve right request modifications correct amend postpublication severe cases refuse publication retract postpublication racist content scientifically unfounded material rejected basis need invoke potential harms vulnerable groups additional justification authors implication racism understood unlike reverse variety apply groups authors wish oppose research discredit efficacy justness affirmative action editorial guidelines provide examples supposedly racist content difficult know ppthe section sex gender sexual orientation similarly vague tendentious authors claim example spectrum gender identities expression defining individuals identify express gender maybe ideologically provocative claimand certainly people political spectrum strongly disagree brazenly avoiding pretense objectivity authors itemize usual laundry list putative gender identities including limited transgender genderqueer genderfluid nonbinary gendervariant genderless agender nongender bigender trans man trans woman trans masculine trans feminine cisgender gender norms told fixed evolve time space definitions require frequent revisiting hard imagine percent conservatives agree evidently concern authors chief purpose section signal progressives send corresponding signal conservatives peopleppthe editorial closes declaring researchers encouraged promote equality academic research editors reserve right retract articles sexist misogynistic andor antilgbtq examples retractionworthy crimes offered familiar objections resurface paper contends men physically stronger women misogynistic paper examines correlation transidentity mental illnesses antilgbtq ppscience human activity like human activities influenced human values human biases human imperfections eliminated banner science undoubtedly waved justify excuse rationalize appalling crimes atrocities racial pseudoscience nazis blank slatism lysenkoism communists correct response distortions endorse highly partisan vision science promotes progressive worldview alienating disagree encouraging doubt objectivity scientific endeavor correct response preserve adversarial vision science promotes debate disagreement free inquiry best way reach truthp
|
630bedbc4ab25e37cec3296b
|
Will open science matter?
|
pyesterday i posted a relnoopener hrefhttpswwwwhitehousegovostpnewsupdates20220825ostpissuesguidancetomakefederallyfundedresearchfreelyavailablewithoutdelay target_blankthis linka about how federally funded science will have to be made open access right away im all for this as it has some upside and no downside that i can see still at the margin i am not sure it will make a huge differencep
pwho says when the research is ready to be posted no matter what you put in the fine print de facto that is a decision made by the scientists if scientists wish to delay open access publication i doubt if this will stop them the paper simply isnt finished yet the law cannot in practice dictate otherwise of course scientists already put plenty of works online and open to the public and this private calculation will continue but with only modest changesp
pthe actual main effect will be to enable scientists to resist commercial attempts to monopolize publication rights in closed access form presumably such contracts now will be illegal but think about the new equilibrium there will be a final published canonical version of the article published in the journal of botchagaloup there will be an open access not yet published noncanonical no proper pp at the very least version on the scientists home page and very often there will be an illegal copy of the canonical version on scihub the pirate site for scientific papers plus the data copies that circulated before the commercial publisher made the authors take them downp
phow is that so different from the status quo some scientists who didnt get a crack at the data the first time around wont have to wait as long to access it and maybe scientists will make more of an effort for the open access version of their papers to be closer to the canonical versions published in commercial journals this could prove a modest benefit though you as an outside scientist wishing to cite p43 just wont know how canonical the open access version will be and presumably forprofit commercial journals will add extra stages to the final production process if only to keep interest in the product they are selling relative to the open access versions online so i dont think it will do under forprofit scientific publishing not to mention that many articles are not federally funded by the us governmentp
pa more radical policy change would have been to require emthe journalsem to make their final versions of the papers open to the public and in the final canonical versions that would create greater benefits but also run the risk of putting those journals out of business as i understand the new dictate it does not do thisp
pthe new law also will give scientists leverage against private companies that wish to buy up the research rights and not publicize the results probably this is a benefit though that doesnt hold a priori as it does raise the cost of private sector involvement by forcing them to share the information more and some unscrupulous scientists might try to get a better deal from the companies by releasing a different and inferior version of the public research results to the open access community still on net i expect these are benefitsp
pstrongaddendumstrong you may recall that a relnoopener hrefhttpsfastgrantsorg target_blankfast grantsa had its own version of an open access requirement i think this worked quite well but it is interesting why it might have proven effective i think we credibly signaled that people with open and early good results would be plausible candidates for additional funding emand soonem and indeed some of them were to the extent that the federal government can signal the same good incentives will be all the stronger but this new ostp order does not coordinate future funding decisions per se and i dont see any clauses that the nih nsf and others are bound to revise their funding policies accordingly to favor researchers who come out with speedy open results so the benefits here could be emmuch greaterem if the entire federal science apparatus could signal its prioritization of speed and openness we are still quite far from this nonetheless this policy is a marginal improvement and a step in the right direction and its creates some preconditions for matters getting better yetp
pthe post a relnofollow hrefhttpmarginalrevolutioncommarginalrevolution202208willopensciencematterhtmlwill open science mattera appeared first on a relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap
|
pyesterday posted relnoopener hrefhttpswwwwhitehousegovostpnewsupdates20220825ostpissuesguidancetomakefederallyfundedresearchfreelyavailablewithoutdelay target_blankthis linka federally funded science open access right away im upside downside margin sure huge differencep pwho says research ready posted matter fine print de facto decision scientists scientists wish delay open access publication doubt stop paper simply isnt finished law practice dictate course scientists plenty works online open public private calculation continue modest changesp pthe actual main effect enable scientists resist commercial attempts monopolize publication rights closed access form presumably contracts illegal think new equilibrium final published canonical version article published journal botchagaloup open access published noncanonical proper pp version scientists home page illegal copy canonical version scihub pirate site scientific papers plus data copies circulated commercial publisher authors downp phow different status quo scientists didnt crack data time wont wait long access maybe scientists effort open access version papers closer canonical versions published commercial journals prove modest benefit outside scientist wishing cite p43 wont know canonical open access version presumably forprofit commercial journals add extra stages final production process interest product selling relative open access versions online dont think forprofit scientific publishing mention articles federally funded governmentp pa radical policy change require emthe journalsem final versions papers open public final canonical versions create greater benefits run risk putting journals business understand new dictate thisp pthe new law scientists leverage private companies wish buy research rights publicize results probably benefit doesnt hold priori raise cost private sector involvement forcing share information unscrupulous scientists try better deal companies releasing different inferior version public research results open access community net expect benefitsp pstrongaddendumstrong recall relnoopener hrefhttpsfastgrantsorg target_blankfast grantsa version open access requirement think worked interesting proven effective think credibly signaled people open early good results plausible candidates additional funding emand soonem extent federal government signal good incentives stronger new ostp order coordinate future funding decisions se dont clauses nih nsf bound revise funding policies accordingly favor researchers come speedy open results benefits emmuch greaterem entire federal science apparatus signal prioritization speed openness far nonetheless policy marginal improvement step right direction creates preconditions matters getting better yetp pthe post relnofollow hrefhttpmarginalrevolutioncommarginalrevolution202208willopensciencematterhtmlwill open science mattera appeared relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap
|
630d3e538c12495a454a54a2
|
An Upgrade, not a Rebuild
|
div
picture
source sizesminwidth 600px 331px 100vw typeimagewebp srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202207guardrailsncc1pngwebp 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202207guardrailsncc11200x675pngwebp 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202207guardrailsncc1800x450pngwebp 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202207guardrailsncc1600x338pngwebp 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202207guardrailsncc1331x186pngwebp 331w
source sizesminwidth 600px 331px 100vw typeimagejpeg srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202207guardrailsncc1png 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202207guardrailsncc11200x675png 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202207guardrailsncc1800x450png 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202207guardrailsncc1600x338png 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202207guardrailsncc1331x186png 331w
img width1200 altguardrails ncc srchttpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202207guardrailsncc1800x450png height675
picture
div
pimg sizesmaxwidth 300px 100vw 300px srchttpsd2eehagpk5cl65cloudfrontnetimgq60uploads202207guardrailsncc1300x169png alt width300 srcsethttpsd2eehagpk5cl65cloudfrontnetimgq60uploads202207guardrailsncc1300x169png 300w httpsd2eehagpk5cl65cloudfrontnetimgq60uploads202207guardrailsncc11024x576png 1024w httpsd2eehagpk5cl65cloudfrontnetimgq60uploads202207guardrailsncc1768x432png 768w httpsd2eehagpk5cl65cloudfrontnetimgq60uploads202207guardrailsncc11536x863png 1536w httpsd2eehagpk5cl65cloudfrontnetimgq60uploads202207guardrailsncc11200x675png 1200w httpsd2eehagpk5cl65cloudfrontnetimgq60uploads202207guardrailsncc1800x450png 800w httpsd2eehagpk5cl65cloudfrontnetimgq60uploads202207guardrailsncc1600x338png 600w httpsd2eehagpk5cl65cloudfrontnetimgq60uploads202207guardrailsncc1331x186png 331w httpsd2eehagpk5cl65cloudfrontnetimgq60uploads202207guardrailsncc1png 1580w classwpimage8194233 height169p
pbear with me for a moment but to understand the conservative case for preserving the guardrails of democracy one has to understand the m1 abrams main battle tank introduced in 1980 it was the most powerful land warfare vehicle ever devised by the mind and industry of man in 2022 it is still unmatched on the battlefieldp
pbut its not quite the same m1 its had gun upgrades armor upgrades and targeting upgrades to name just a few of the improvements over more than 40 years of service there was the m1 the m1a1 the m1a2 and now the m1a2 sep its still the same tank it even looks much the same but its substantially betterbuilt to withstand the challenges of modern warp
pand so it is with the constitution and american democracy first there was democracy one the original document that was at the time a remarkable advance for democracy and human rights but it was flawed it permitted slavery its most potent human rights protectionsthe guarantees of the individual liberty in the bill of rightsdidnt apply to the states so the system was unstable it was not going to age wellp
pand it didnt the nation ripped itself apart in the civil war and the victorious union created democracy two with a substantially updated constitution that over time extended the bill of rights to protect individual liberty from every organ of american government but still it wasnt enough black americans continued to confront the quotbadges and incidents of slaveryquot in the form of a brutal system of racial oppression that depended on both public and private discriminationp
pso along came democracy three the postcivil rights era the power of that state expanded dramatically the government began to touch virtually every aspect of commercial life the administrative state grew until it became the most potent branch of government and while the united states is absolutely more just than it wasand citizens enjoy a greater degree of legal equality than in any previous iteration of the american experimentthe strains are beginning to showp
pcongress intended to be the most powerful branch of government is now the weakest campaign finance reforms that were intended to empower the grassroots and disempower the wealthy elite have backfired radicalized smalldollar donors drive the financial bus progressive reforms that were designed to give power to the people through primaries have sidelined political parties now small minorities of activist primary voters exercise disproportionate power and further polarize our politicsp
ptaken together these developments mean that the united states is less democratic where it needs the voice of the people and more democratic where it needs the voice of the parties and so the american constitutional main battle tank needs another overhaulbut not one as dramatic as the first two lets call ours democracy 31p
pour a hrefhttpsconstitutioncenterorgmediafilesteam_conservative_finalpdfconservative reformsa are designed to revitalize congress revival of the nondelegation doctrine and the reversal of the ichevroni doctrine would together deter congress from punting more power to the presidency war powers reform would prevent the president both declaring iandi waging war filibuster reform would preserve procedural safeguards against bare majorities passing sweeping legislation while acknowledging that the present filibuster standard paralyzes congress we also want a legislative veto so that congress can block executive branch lawmaking even without the presidents consentp
pcritically we also propose making it easier to amend the constitution the barrier is simply too high for meaningful constitutional reformp
peach of these reforms would make the united states more democratic mainly by revitalizing congress the most democratic branch of the federal government but lest anyone think we conservatives have become too enamored by the voice of the people there are places where we also want less democracy especially in party politicsp
pwe propose eliminating individual campaign contribution limits every single effort to micromanage political expenditures hasnt just failed its backfired no one can get money out of politics but we can distort the ways in which it flows into the system and presently money flows through radicalized small donors who are mobilized through alarmist rhetoric and captivated by celebrityp
psmall dollar donations also undermine the power of parties give a political celebrity an email list and they can build a movement we want stronger parties we want smokefilled rooms and if we cant have smokefilled rooms we want party conventions if we cant have party conventions we want tighter requirements for party primary votingp
pthe goal is to give voters and leaders a sense of institutional responsibility we love american democracy but not every institution in america needs to be democratic we accept the power of accountable leadership in the military the academy and in corporate america we need accountable leadership in our political parties as wellp
pany discussion of american democracy should also include a discussion of american education school choice is a vital value schools should compete for students and within that spirit of competition theres a role for revamped curriculum our curricular culture wars are inherently oppositional does defeating crt prepare our students to counter the economic and military challenge of a rising chinap
pa commitment to school choice allows for creativity for new ways of teaching history and for different emphases in the stem fields why do we mandate algebra and geometry but not statistics and coding thats an argument worth havingone thats far more impactful and interesting than whether a schools diversity powerpoints are too problematicp
pfinally we want to make election day great again the wellmeaning desire to make voting easier has turned election day into election season and perversely has put a premium on mobilization over persuasion now theres a focus on quotbankingquot votes and the presumption is that quotyourquot voters are your voters and the challenge is finding and collecting all your peoplep
pbut new information surfaces on candidates all the time how many early voters in 2016 wished they had a second bite at the apple after say the access hollywood tape or james comeys letter announcing that the fbi was reopening the clinton email investigation moreover election day is an important communal civic eventp
peven an election weekend would be preferable to an election season and we can make election day a national holiday to help those who have difficult work schedules we know that we wont go back to a single election day but deadlines can and do concentrate the mind lets restore the sense of communal civic participation and make sure that were all operating with the same access to information when we votep
pnot one of our reforms is as consequential as the civil war amendments or the civil rights act but even modest changes can make a profound difference if theyre precisely targeted at the problems that are causing systemic breakdown weve long enjoyed the benefits of the worlds best constitutional system but it still needs an upgradep
pwe dont need a revolution to return to the m1 analogy at the start we dont need to scrap our tank we just need the next iteration of the same basic system that has made the united states of america the most powerful and prosperous democracy in the history of the worldp
p p
pthe post a relnofollow hrefhttpsreasoncomvolokh20220829anupgradenotarebuildan upgrade not a rebuilda appeared first on a relnofollow hrefhttpsreasoncomreasoncomap
|
div picture source sizesminwidth 600px 331px 100vw typeimagewebp srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202207guardrailsncc1pngwebp 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202207guardrailsncc11200x675pngwebp 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202207guardrailsncc1800x450pngwebp 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202207guardrailsncc1600x338pngwebp 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202207guardrailsncc1331x186pngwebp 331w source sizesminwidth 600px 331px 100vw typeimagejpeg srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202207guardrailsncc1png 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202207guardrailsncc11200x675png 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202207guardrailsncc1800x450png 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202207guardrailsncc1600x338png 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202207guardrailsncc1331x186png 331w img width1200 altguardrails ncc srchttpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202207guardrailsncc1800x450png height675 picture div pimg sizesmaxwidth 300px 100vw 300px srchttpsd2eehagpk5cl65cloudfrontnetimgq60uploads202207guardrailsncc1300x169png alt width300 srcsethttpsd2eehagpk5cl65cloudfrontnetimgq60uploads202207guardrailsncc1300x169png 300w httpsd2eehagpk5cl65cloudfrontnetimgq60uploads202207guardrailsncc11024x576png 1024w httpsd2eehagpk5cl65cloudfrontnetimgq60uploads202207guardrailsncc1768x432png 768w httpsd2eehagpk5cl65cloudfrontnetimgq60uploads202207guardrailsncc11536x863png 1536w httpsd2eehagpk5cl65cloudfrontnetimgq60uploads202207guardrailsncc11200x675png 1200w httpsd2eehagpk5cl65cloudfrontnetimgq60uploads202207guardrailsncc1800x450png 800w httpsd2eehagpk5cl65cloudfrontnetimgq60uploads202207guardrailsncc1600x338png 600w httpsd2eehagpk5cl65cloudfrontnetimgq60uploads202207guardrailsncc1331x186png 331w httpsd2eehagpk5cl65cloudfrontnetimgq60uploads202207guardrailsncc1png 1580w classwpimage8194233 height169p pbear moment understand conservative case preserving guardrails democracy understand m1 abrams main battle tank introduced 1980 powerful land warfare vehicle devised mind industry man 2022 unmatched battlefieldp pbut m1 gun upgrades armor upgrades targeting upgrades improvements 40 years service m1 m1a1 m1a2 m1a2 sep tank looks substantially betterbuilt withstand challenges modern warp pand constitution american democracy democracy original document time remarkable advance democracy human rights flawed permitted slavery potent human rights protectionsthe guarantees individual liberty bill rightsdidnt apply states system unstable going age wellp pand didnt nation ripped apart civil war victorious union created democracy substantially updated constitution time extended bill rights protect individual liberty organ american government wasnt black americans continued confront quotbadges incidents slaveryquot form brutal system racial oppression depended public private discriminationp pso came democracy postcivil rights era power state expanded dramatically government began touch virtually aspect commercial life administrative state grew potent branch government united states absolutely wasand citizens enjoy greater degree legal equality previous iteration american experimentthe strains beginning showp pcongress intended powerful branch government weakest campaign finance reforms intended empower grassroots disempower wealthy elite backfired radicalized smalldollar donors drive financial bus progressive reforms designed power people primaries sidelined political parties small minorities activist primary voters exercise disproportionate power polarize politicsp ptaken developments mean united states democratic needs voice people democratic needs voice parties american constitutional main battle tank needs overhaulbut dramatic lets democracy 31p pour hrefhttpsconstitutioncenterorgmediafilesteam_conservative_finalpdfconservative reformsa designed revitalize congress revival nondelegation doctrine reversal ichevroni doctrine deter congress punting power presidency war powers reform prevent president declaring iandi waging war filibuster reform preserve procedural safeguards bare majorities passing sweeping legislation acknowledging present filibuster standard paralyzes congress want legislative veto congress block executive branch lawmaking presidents consentp pcritically propose making easier amend constitution barrier simply high meaningful constitutional reformp peach reforms united states democratic mainly revitalizing congress democratic branch federal government lest think conservatives enamored voice people places want democracy especially party politicsp pwe propose eliminating individual campaign contribution limits single effort micromanage political expenditures hasnt failed backfired money politics distort ways flows system presently money flows radicalized small donors mobilized alarmist rhetoric captivated celebrityp psmall dollar donations undermine power parties political celebrity email list build movement want stronger parties want smokefilled rooms cant smokefilled rooms want party conventions cant party conventions want tighter requirements party primary votingp pthe goal voters leaders sense institutional responsibility love american democracy institution america needs democratic accept power accountable leadership military academy corporate america need accountable leadership political parties wellp pany discussion american democracy include discussion american education school choice vital value schools compete students spirit competition theres role revamped curriculum curricular culture wars inherently oppositional defeating crt prepare students counter economic military challenge rising chinap pa commitment school choice allows creativity new ways teaching history different emphases stem fields mandate algebra geometry statistics coding thats argument worth havingone thats far impactful interesting schools diversity powerpoints problematicp pfinally want election day great wellmeaning desire voting easier turned election day election season perversely premium mobilization persuasion theres focus quotbankingquot votes presumption quotyourquot voters voters challenge finding collecting peoplep pbut new information surfaces candidates time early voters 2016 wished second bite apple access hollywood tape james comeys letter announcing fbi reopening clinton email investigation election day important communal civic eventp peven election weekend preferable election season election day national holiday help difficult work schedules know wont single election day deadlines concentrate mind lets restore sense communal civic participation sure operating access information votep pnot reforms consequential civil war amendments civil rights act modest changes profound difference theyre precisely targeted problems causing systemic breakdown weve long enjoyed benefits worlds best constitutional system needs upgradep pwe dont need revolution return m1 analogy start dont need scrap tank need iteration basic system united states america powerful prosperous democracy history worldp pp pthe post relnofollow hrefhttpsreasoncomvolokh20220829anupgradenotarebuildan upgrade rebuilda appeared relnofollow hrefhttpsreasoncomreasoncomap
|
630d3ec28c12495a454a54ac
|
The Distributional Effects of Student Loan Forgiveness
|
peven worse than you thoughtp
blockquotepwe study the distributional consequences of student debt forgiveness in present value terms accounting for differences in repayment behavior across the earnings distribution full or partial forgiveness is regressive because high earners took larger loans but also because for low earners balances greatly overstate present values consequently forgiveness would benefit the top decile as much as the bottom three deciles combined blacks and hispanics would also benefit substantially less than balances suggest enrolling households who would benefit from incomedriven repayment is the least expensive and most progressive policy we considerpblockquote
pthat is from a relnoopener hrefhttpsbfiuchicagoeduworkingpaper2020169 target_blanka working papera by sylvaine catherine and constantine yanellis it is sad that such material even needs to be posted i hope you are not taken in by a relnoopener hrefhttpstwittercomarindubestatus1564115798200926209 target_blankdubeous ideasa to the contraryp
pthe post a relnofollow hrefhttpmarginalrevolutioncommarginalrevolution202208thedistributionaleffectsofstudentloanforgivenesshtmlthe distributional effects of student loan forgivenessa appeared first on a relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap
|
peven worse thoughtp blockquotepwe study distributional consequences student debt forgiveness present value terms accounting differences repayment behavior earnings distribution partial forgiveness regressive high earners took larger loans low earners balances greatly overstate present values consequently forgiveness benefit decile deciles combined blacks hispanics benefit substantially balances suggest enrolling households benefit incomedriven repayment expensive progressive policy considerpblockquote pthat relnoopener hrefhttpsbfiuchicagoeduworkingpaper2020169 target_blanka working papera sylvaine catherine constantine yanellis sad material needs posted hope taken relnoopener hrefhttpstwittercomarindubestatus1564115798200926209 target_blankdubeous ideasa contraryp pthe post relnofollow hrefhttpmarginalrevolutioncommarginalrevolution202208thedistributionaleffectsofstudentloanforgivenesshtmlthe distributional effects student loan forgivenessa appeared relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap
|
630d3ede8c12495a454a54b4
|
New Yorkers Under 21 Can't Buy Whipped Cream Cans
|
div
picture
source sizesminwidth 600px 331px 100vw typeimagewebp srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202208whippedcreamjpgwebp 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202208whippedcream1200x675jpgwebp 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202208whippedcream800x450jpgwebp 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202208whippedcream600x338jpgwebp 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202208whippedcream331x186jpgwebp 331w
source sizesminwidth 600px 331px 100vw typeimagejpeg srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202208whippedcreamjpg 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202208whippedcream1200x675jpg 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202208whippedcream800x450jpg 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202208whippedcream600x338jpg 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202208whippedcream331x186jpg 331w
img width1200 alta can of whipped cream srchttpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202208whippedcream800x450jpg height675
picture
div
pspanas a babyfaced 22yearold i know i can expect to get carded every time i enter a bar or try to buy alcohol at the grocery store even when my similarlyaged friends arent stopped by the bouncer or the waitress at brunch ill have to dig through my purse and fork over my drivers license watching it get examined for the umpteenth timespanp
pspani can now expect the same rigmarole if i try to buy a can of whipped cream in new yorkspanp
pspanwhy is there an age limit for purchasing a dessert topping because the cans also known as whippets contain nitrous oxide also known as laughing gas so you can use them to get aspan a hrefhttpswwwncbinlmnihgovpmcarticlespmc4453489spanbrief highspanaspan and this prompted new yorks state assembly to pass one of the strangest bills of the drug warspanp
pspansince november 2021 it has been illegal for anyone under 21 to buy a canister of whipped cream in new yorkthough the law was littleknown until aspan a hrefhttpswwwnbcnewyorkcomnewslocalturnsoutitsillegalforpeopleunder21tobuycanistersofwhippedcreaminny3839957spanphotospanaspan from an albany convenience store alerting customers to the policy change started spreading online last week selling whipped cream canisters to anyone under 21 is aspan a hrefhttpswwwnysenategovnewsroompressreleasesjosephpaddabbojraddabbobillprohibitingsalewhippedcreamchargersspancivil offensespanaspan in the state earning offenders a 250 fee for the first offense and a 500 fee for every subsequent offensespanp
pspanquotused whippits piling up in our communities are not only an eye sore but also indicative of a significant nitrous oxide abuse problem this law will help to protect our youth from the dangers of this lethal chemical while helping to clean up our neighborhoodsquot the bills sponsor joseph p addabbo jrspan a hrefhttpswwwnysenategovnewsroompressreleasesjosephpaddabbojraddabbobillprohibitingsalewhippedcreamchargersspanexplainedspanaspan right after the bill passed quotnitrous oxide is a legal chemical for legitimate professional use but when used improperly it can be extremely lethalquotspanp
pspanthe evidence for the dangers of whippits is iffy the main risk is asphyxiation from breathing in too much nitrous oxide and not enough air but nitrous deaths almost always happen when people breathe in the gas through a mask similarly to how laughing gas is administered at the dentist nitrous inhalers have also been known to die when using some other means to restrict their access to oxygen such as putting a plastic bag over their headspanp
pspanquotwhen people pass out theyll drop the balloon or whatever and start breathing airquot matthew howard an inhalant abuse expert at the university of north carolina a hrefhttpswwwvicecomenarticle5gqg4qhowscaredshouldibeofwhipitstoldaspan ispanvicespani spanin 2016 quotif youve got a gas mask on you wontquotspanp
pspanthose who seriously abuse the substance can also developspan a hrefhttpswwwsciencedirectcomsciencearticleabspiis0387760418303887spansubacute combined degenerationspanaspan a degeneration of the spinal cord due to vitamin b12 deficiency but when treated quickly with a b12 injection most affected by the condition will make a full recovery despite addabbos fearmongering nitrous oxide rarely poses a longterm health riskemespeciallyem when inhaled from a whipped cream can rather than an industrial tankspanp
pspanfurther whippits dont appear to be a particularly popular drug among teens according to a 2015span a hrefhttpswwwsamhsagovdatasitesdefaultfilesreport_3095shortreport3095htmlspanstudyspanaspan from the substance abuse and mental health service administration only 04 percent of 12 to 17yearolds reported having done whippits in the past year if used whipped cream cans are littering the streets of new york state the under21s arent necessarily the ones to blamespanp
pspanit is unclear how much this bill will impact whippit use the small number of teenagers who actually want to get high off nitrous oxide will probably just purchase other household items that contain nitrous oxide canisters such as sprayable cooking oil or theyll buy cheap nitrous oxide canistersspan a hrefhttpswwwamazoncomexecobidosasinb007lyzfiureasonmagazinea20spanonlinespanaspan and if youre one of thespanspan 996 percent of teens who emdontem get high this way then you just might need to pick a different ice cream toppingspanp
pthe post a relnofollow hrefhttpsreasoncom20220829newyorkersunder21cantbuywhippedcreamcansnew yorkers under 21 cant buy whipped cream cansa appeared first on a relnofollow hrefhttpsreasoncomreasoncomap
|
div picture source sizesminwidth 600px 331px 100vw typeimagewebp srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202208whippedcreamjpgwebp 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202208whippedcream1200x675jpgwebp 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202208whippedcream800x450jpgwebp 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202208whippedcream600x338jpgwebp 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202208whippedcream331x186jpgwebp 331w source sizesminwidth 600px 331px 100vw typeimagejpeg srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202208whippedcreamjpg 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202208whippedcream1200x675jpg 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202208whippedcream800x450jpg 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202208whippedcream600x338jpg 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202208whippedcream331x186jpg 331w img width1200 alta whipped cream srchttpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202208whippedcream800x450jpg height675 picture div pspanas babyfaced 22yearold know expect carded time enter bar try buy alcohol grocery store similarlyaged friends arent stopped bouncer waitress brunch ill dig purse fork drivers license watching examined umpteenth timespanp pspani expect rigmarole try buy whipped cream new yorkspanp pspanwhy age limit purchasing dessert topping cans known whippets contain nitrous oxide known laughing gas use aspana hrefhttpswwwncbinlmnihgovpmcarticlespmc4453489spanbrief highspanaspan prompted new yorks state assembly pass strangest bills drug warspanp pspansince november 2021 illegal 21 buy canister whipped cream new yorkthough law littleknown aspana hrefhttpswwwnbcnewyorkcomnewslocalturnsoutitsillegalforpeopleunder21tobuycanistersofwhippedcreaminny3839957spanphotospanaspan albany convenience store alerting customers policy change started spreading online week selling whipped cream canisters 21 aspana hrefhttpswwwnysenategovnewsroompressreleasesjosephpaddabbojraddabbobillprohibitingsalewhippedcreamchargersspancivil offensespanaspan state earning offenders 250 fee offense 500 fee subsequent offensespanp pspanquotused whippits piling communities eye sore indicative significant nitrous oxide abuse problem law help protect youth dangers lethal chemical helping clean neighborhoodsquot bills sponsor joseph p addabbo jrspan hrefhttpswwwnysenategovnewsroompressreleasesjosephpaddabbojraddabbobillprohibitingsalewhippedcreamchargersspanexplainedspanaspan right bill passed quotnitrous oxide legal chemical legitimate professional use improperly extremely lethalquotspanp pspanthe evidence dangers whippits iffy main risk asphyxiation breathing nitrous oxide air nitrous deaths happen people breathe gas mask similarly laughing gas administered dentist nitrous inhalers known die means restrict access oxygen putting plastic bag headspanp pspanquotwhen people pass theyll drop balloon start breathing airquot matthew howard inhalant abuse expert university north carolina hrefhttpswwwvicecomenarticle5gqg4qhowscaredshouldibeofwhipitstoldaspan ispanvicespani spanin 2016 quotif youve got gas mask wontquotspanp pspanthose seriously abuse substance developspan hrefhttpswwwsciencedirectcomsciencearticleabspiis0387760418303887spansubacute combined degenerationspanaspan degeneration spinal cord vitamin b12 deficiency treated quickly b12 injection affected condition recovery despite addabbos fearmongering nitrous oxide rarely poses longterm health riskemespeciallyem inhaled whipped cream industrial tankspanp pspanfurther whippits dont appear particularly popular drug teens according 2015span hrefhttpswwwsamhsagovdatasitesdefaultfilesreport_3095shortreport3095htmlspanstudyspanaspan substance abuse mental health service administration 04 percent 12 17yearolds reported having whippits past year whipped cream cans littering streets new york state under21s arent necessarily ones blamespanp pspanit unclear bill impact whippit use small number teenagers actually want high nitrous oxide probably purchase household items contain nitrous oxide canisters sprayable cooking oil theyll buy cheap nitrous oxide canistersspan hrefhttpswwwamazoncomexecobidosasinb007lyzfiureasonmagazinea20spanonlinespanaspan youre thespanspan 996 percent teens emdontem high way need pick different ice cream toppingspanp pthe post relnofollow hrefhttpsreasoncom20220829newyorkersunder21cantbuywhippedcreamcansnew yorkers 21 cant buy whipped cream cansa appeared relnofollow hrefhttpsreasoncomreasoncomap
|
630d3ef98c12495a454a54b6
|
The Dark Truth About Social-Emotional Learning (SEL)
|
h4the new discourses podcast with james lindsay episode 92h4
pwe have to talk about socialemotional learning sel its not the first time its been addressed here on the new discourses podcast but the full picture hasnt been painted for you yet socialemotional learning is evil and must be stopped it isnt a nice little program to help atrisk kids deal with the difficulties of learning its the central pillar of a nefarious attempt to remake and control society host james lindsay walks you through a number of sources promoting and describing socialemotional learning in unprecedented depth breadth and clarity in this long but crucial episode of the podcast join him to understand why socialemotional learning and the mechanisms that enable it must be removed from our schools as soon as possible and the people who have implemented it need to be investigated and held accountablep
hr
pemsubscribe to the new discourses podcast on spanspana relnoopener noreferrer hrefhttpssoundcloudcomnewdiscourses target_blanksoundcloudaspanspan spanspana relnoopener noreferrer hrefhttpspodcastsapplecomuspodcastnewdiscoursesid1499880546 target_blankapple podcastsaspanspan spanspana relnoopener noreferrer hrefhttpspodcastsgooglecomfeedahr0cdovl2zlzwrzlnnvdw5ky2xvdwquy29tl3vzzxjzl3nvdw5ky2xvdwq6dxnlcnm6nzgxmte2mzi1l3nvdw5kcy5yc3m target_blankgoogle podcastsaspanspan spanspana relnoopener noreferrer hrefhttpsopenspotifycomshow0hfzdaxi5l4lnjqstfwgzpsikd5rtswgt1epiuyrixmlgw target_blankspotifyaspanspan spanspana relnoopener noreferrer hrefhttpswwwstitchercompodcastnewdiscourses target_blankstitcheraspanspana relnoopener noreferrer hrefhttpswwwstitchercompodcastnewdiscourses target_blanka spanspana relnoopener noreferrer hrefhttpswwwyoutubecomplaylistlistpl2hruftaprxcqcbydcaullid2d9exyny target_blankyoutubeaspanspan or by spanspana relnoopener noreferrer hrefhttpsfeedssoundcloudcomuserssoundcloudusers781116325soundsrss target_blankrssaspanspanemp
pemadditional episodes of the new discourses podcast are available spanspana relnoopener hrefhttpsnewdiscoursescomtagndpodcast target_blankhereaspanspanemp
pemfollow james lindsay spanspana relnoopener hrefhttpslinktreeconceptualjames target_blankhttpslinktreeconceptualjamesaspanspanemp
pthe post a relnofollow hrefhttpsnewdiscoursescom202208thedarktruthaboutsocialemotionallearningselthe dark truth about socialemotional learning sela appeared first on a relnofollow hrefhttpsnewdiscoursescomnew discoursesap
|
h4the new discourses podcast james lindsay episode 92h4 pwe talk socialemotional learning sel time addressed new discourses podcast picture hasnt painted socialemotional learning evil stopped isnt nice little program help atrisk kids deal difficulties learning central pillar nefarious attempt remake control society host james lindsay walks number sources promoting describing socialemotional learning unprecedented depth breadth clarity long crucial episode podcast join tounderstand socialemotional learning mechanisms enable removed schools soon possible people implemented need investigated held accountablep hr pemsubscribe new discourses podcast spanspana relnoopener noreferrer hrefhttpssoundcloudcomnewdiscourses target_blanksoundcloudaspanspanspanspana relnoopener noreferrer hrefhttpspodcastsapplecomuspodcastnewdiscoursesid1499880546 target_blankapple podcastsaspanspanspanspana relnoopener noreferrer hrefhttpspodcastsgooglecomfeedahr0cdovl2zlzwrzlnnvdw5ky2xvdwquy29tl3vzzxjzl3nvdw5ky2xvdwq6dxnlcnm6nzgxmte2mzi1l3nvdw5kcy5yc3m target_blankgoogle podcastsaspanspanspanspana relnoopener noreferrer hrefhttpsopenspotifycomshow0hfzdaxi5l4lnjqstfwgzpsikd5rtswgt1epiuyrixmlgw target_blankspotifyaspanspanspanspana relnoopener noreferrer hrefhttpswwwstitchercompodcastnewdiscourses target_blankstitcheraspanspana relnoopener noreferrer hrefhttpswwwstitchercompodcastnewdiscourses target_blankaspanspana relnoopener noreferrer hrefhttpswwwyoutubecomplaylistlistpl2hruftaprxcqcbydcaullid2d9exyny target_blankyoutubeaspanspan byspanspana relnoopener noreferrer hrefhttpsfeedssoundcloudcomuserssoundcloudusers781116325soundsrss target_blankrssaspanspanemp pemadditional episodes new discourses podcast available spanspana relnoopener hrefhttpsnewdiscoursescomtagndpodcast target_blankhereaspanspanemp pemfollow james lindsayspanspana relnoopener hrefhttpslinktreeconceptualjames target_blankhttpslinktreeconceptualjamesaspanspanemp pthe post relnofollow hrefhttpsnewdiscoursescom202208thedarktruthaboutsocialemotionallearningselthe dark truth socialemotional learning sela appeared relnofollow hrefhttpsnewdiscoursescomnew discoursesap
|
630d3f0a8c12495a454a54ba
|
Restoring the Guardrails of Democracy: A Libertarian View
|
div
picture
source sizesminwidth 600px 331px 100vw typeimagewebp srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202207guardrailsncc1pngwebp 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202207guardrailsncc11200x675pngwebp 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202207guardrailsncc1800x450pngwebp 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202207guardrailsncc1600x338pngwebp 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202207guardrailsncc1331x186pngwebp 331w
source sizesminwidth 600px 331px 100vw typeimagejpeg srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202207guardrailsncc1png 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202207guardrailsncc11200x675png 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202207guardrailsncc1800x450png 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202207guardrailsncc1600x338png 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202207guardrailsncc1331x186png 331w
img width1200 altguardrails ncc srchttpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202207guardrailsncc1800x450png height675
picture
div
pimg sizesmaxwidth 300px 100vw 300px srchttpsd2eehagpk5cl65cloudfrontnetimgq60uploads202207guardrailsncc1300x169png alt width300 srcsethttpsd2eehagpk5cl65cloudfrontnetimgq60uploads202207guardrailsncc1300x169png 300w httpsd2eehagpk5cl65cloudfrontnetimgq60uploads202207guardrailsncc11024x576png 1024w httpsd2eehagpk5cl65cloudfrontnetimgq60uploads202207guardrailsncc1768x432png 768w httpsd2eehagpk5cl65cloudfrontnetimgq60uploads202207guardrailsncc11536x863png 1536w httpsd2eehagpk5cl65cloudfrontnetimgq60uploads202207guardrailsncc11200x675png 1200w httpsd2eehagpk5cl65cloudfrontnetimgq60uploads202207guardrailsncc1800x450png 800w httpsd2eehagpk5cl65cloudfrontnetimgq60uploads202207guardrailsncc1600x338png 600w httpsd2eehagpk5cl65cloudfrontnetimgq60uploads202207guardrailsncc1331x186png 331w httpsd2eehagpk5cl65cloudfrontnetimgq60uploads202207guardrailsncc1png 1580w classwpimage8194233 height169p
pthe events leading up to inauguration day 2021 posed a stress test for americas republican institutions and we need to be ready should more such tests follow in particular proposals to overhaul the nations electoral institutions should be judged in the light of the lessons of that brush with constitutional extremity reforms that shore up what we now can see as critical weaknesses deserve high priority reforms irrelevant to these dangers might well go to the back burner if not be set aside for now and proposals that would actually create new risks of constitutional crisis are unlikely to be right for the momentp
pthus argues my contribution to the a hrefhttpsnam11safelinksprotectionoutlookcomurlhttps3a2f2fconstitutioncenterorg2fmedia2ffiles2fteam_libertarian_finalpdfdata057c017cisomin40gmuedu7c344cd041bc0d44093bd808da894a8f167c9e857255df574c47a0c00546460380cb7c07c07c6379732516543415937cunknown7ctwfpbgzsb3d8eyjwijoimc4wljawmdailcjqijoiv2lumziilcjbtii6ik1hawwilcjxvci6mn03d7c30007c7c7csdatasepgqtovydmejqvmqwc5f36nurqsiw6qi9j2fdjq9hqq3dreserved0team libertarian papera which you can also read a hrefhttpssecurewebciscocom1ljmqh5ouw1sxkedd1x46jj42kjbxblmco4gentrpwiyzjgut7l7vbt_bhy4kd6r92yiggzsk771iph_j_db04foveq4e386onzzy7lej2qmoj0pv_seizfuripzgjokehhrcog3aredh8odt08pde7uzqqr0_imtse3rexfbmtqgolm_tfohjgixoqwz_zhw0wxyekvxryf1fr9df522vt8d02plaideegaur5jncd9c_nhjk7e6aprhjnev2hir2pmbiwgz8n7byo8fmau0j23exsapknpbxwzm7ejhbjhfsf6nmtbvtlpovclzjoqi27bku5xuxnhnl532ttednj7vbxwxe4g41gheplfjijjobbwahqyj0lt93fo_owmdvrzrbbhhsluqrngnwwpmxyz_t7qpxfebs5mipoxzhdgigutfdod0kka10hl9xskmrfa4r7uovh51lh2tjwhttps3a2f2fpapersssrncom2fsol32fpaperscfm3fabstract_id3d4156387on ssrna on elections and the democratic succession of power later in this post ill summarize the other two sections written by contributors clark neily and ilya sominp
pmany institutions performed well under the stress of the weeks leading up to the 2021 transfer of power including the courts the state governments nearly all local election authorities the electoral college and its participants and most of the us senate as well as the vice president key cabinet departments also pushed back against improper suggestions from the rogue white housep
pironically or not the institutions that proved wobbly under stress white house aside included one of those with the strongest claim on majoritarian legitimacy the us house of representatives in which 139 of 435 members an outright majority of the 212member republican caucus voted to support spurious challenges to bidens electoral slates behind these was an unlovely fact a majority of the gop base had in fact been willing to tag along with trumps claims of a stolen election and the house as the assembly most in touch with public passions reflected this while elite misconduct can endanger the democratic succession of power so can populist anger and mass delusionp
pi wont try to summarize each and every one of our prescriptions but here are some highlightsp
ul
lia hrefhttpsnam11safelinksprotectionoutlookcomurlhttps3a2f2fwwwcatoorg2fblog2fcatoscholarselectoralcountactdata057c017cisomin40gmuedu7c344cd041bc0d44093bd808da894a8f167c9e857255df574c47a0c00546460380cb7c07c07c6379732516543415937cunknown7ctwfpbgzsb3d8eyjwijoimc4wljawmdailcjqijoiv2lumziilcjbtii6ik1hawwilcjxvci6mn03d7c30007c7c7csdatadr2xw2fkn4qjksp9nsvrr7wvdighsxqtppzyennisb5m3dreserved0electoral count act reforma should confine each actor to its proper role after a presidential election clear up ambiguous and confusing terms in the present law and keep partisans from using the process to relitigate the underlying electionli
licongress should move to constrain the executive branchs resort to dangerous emergency powers the law should make clear or even clearer than now that presidents do not have unbounded discretion to invoke the insurrection act seize voting machines without a court order declare martial law when civil order has not broken down or in other ways use peremptory executive power to overturn or block an electionli
licounter distrust with a credibility agenda recognizing that in an age of distrust systems need to be both secure against fraud and bad practice and visibly so examples improve methods of keeping voter registration rolls accurate and uptodate strengthen audits states should facilitate and where appropriate mandate reporting of substantially complete returns on election night to counter the viral popularity of quotovernight stealquot claimsli
lilook for ways to incentivize losing candidates to concede former president trump has set the worst example in crying fraud after losing a contest but he has not been the only offenderli
liwatch out for proposals to gather ever greater election say over election administration to washington dc which would provide a single attractive target for bad actors to pressure or subvert we should be wary of what economist steven landsburg calls quotcentralizing the power to decide who will yield powerquotli
liavoid innovations that invite succession crises one example the illthoughtout national popular vote compact in which states pledge to cast their electoral votes for the national popular vote winner even though no way is offered to a hrefhttpsnam11safelinksprotectionoutlookcomurlhttps3a2f2fwwwcatoorg2fblog2ffatallyflawednationalpopularvoteplandata057c017cisomin40gmuedu7c344cd041bc0d44093bd808da894a8f167c9e857255df574c47a0c00546460380cb7c07c07c6379732516544978397cunknown7ctwfpbgzsb3d8eyjwijoimc4wljawmdailcjqijoiv2lumziilcjbtii6ik1hawwilcjxvci6mn03d7c30007c7c7csdataq5jrkfppzbt9lh7hnts2b1qacbtcncnrwsdpunoifnqq3dreserved0secure an authoritative tabulation of that votea so that it can be agreed who wonli
liturn down the temperature and stop delegitimizing key institutions both sides need to listen on this its one thing to decry worsening polarization as if it were all the other teams fault its another to resist the partisan temptation to delegitimize the existing institutions and machinery of our republic whether the supreme court the us senate or local election administrators because they dont yield the shortterm results you wantli
ul
pi think classical liberals and libertarians can play a constructive role in a conversation about guardrails given our particular attachment to the rule of law constitutionalism checks and balances and limitations on government power in general by instinct we understand and fear how a government is likely to start behaving once its top officials know that voters cannot turn them out of officep
pill turn now to summarizing the other two sections of the report by cato colleague clark neily on the role of the jury and volokh conspirator and george mason lawprof ilya somin on the benefits of choice between governmentsp
pthe right to trial by jury was often hailed as the palladium of angloamerican liberties its enshrined in the sixth and seventh amendments and relates closely to other constitutional provisions on criminal procedure as the founders knew oppressive regimes have used criminal law and prosecution throughout history to target enemies and exert social control and they meant for the citizen jury to serve as a key guardrail against that abusep
pyet says clark neily america has allowed the institution of the jury to decay to a point of near extinction in favor of an informal and opaque administrative system of plea bargaining that is bad news for criminal justice and may bear some relation to americas extraordinarily high rates of incarceration and it also erodes a line of defense that will be critically needed should american political life take a turn toward the authoritarian and government administrators intensify use of criminalization and prosecution as a purposeful tool against opposition in heedlessly allowing this institution to decay we also lose an important instrument of popular voice in government earlier generations understood that jury service was an important means by which the public participated directly in the public businessp
pilya somin champions a fundamental human right that deserves a place alongside the ballot box and the jury box as protectors of liberty the right to exitp
pwhen people choose which jurisdiction to live in within a federal system they vote in effect with their feet in fact for most individual citizens this is by far the most powerful way they can alter the laws and policies they live under it almost never happens that they can make such a change by casting a vote notwithstanding the a hrefhttpssecurewebciscocom1e73dh59mpcyy7yr7ie7_9rjlvqgrhyjlxuhwex6sqogiubc2krwcsd14nksryhgwx0ovg6tmruttf5h8wlujpvqzsunczihxrpvfiyvg92qpnturpj5_ie1c8v8uchto77y77o3bfbmyfwyiittylw1duv11lbeusfsvrffotbxcykwappkbh32riqrj9mcf3ah_ldtjlvd9jgxib1xl77abs_f8yk9wrxpxcb9aw612hviunrcibhubvsorxmxcsklq9mh0tuctzmiiv5nxa8wbpg4pzahnrs_5nnpyryltjnau0lcvtktkd40euq8cd2niri70hbf78caox8yvz8uqpezf3_wfs3f6yyxzgy0aqvtlp3giuscx1o156pga0u2phedevepnxhhlmhqja0znskotah0xihtn3z449cnp5cjogg3sdmhttps3a2f2fwwwfredericknewspostcom2fnews2fpolitics_and_government2felections2fnewresultsshowdicolawinningcountycouncilracebyonevote2farticle_08e9f269b5295236bd5bf0916414710bhtmlonevote margina just a hrefhttpssecurewebciscocom1e_lrknf9nk9zyv7h3oa_g9m4i2msj4ok0tkjy9zyd70c5ppwngwmnkbkufx0y5uqnqiizezkvuxphqufnni49eyddjtclwxpw7rsilz7ql7jmtrgiplkt12vkbhe8gnx_qgezchm4spq9kznje2pwdsg8lfy0tawa1jpaf44ngapxq9iau1w2tymvb5uawtflwpoyt1pjno2fawcuf352zdz0uqzspz5zob95uibvhfqldchk8w40ecacd1ioaxuo_tz6_qx4vgdilyz5wbzfw_zembvf2qlwtxuuy75pjeihb_4y0q0uijynnnlsfar8ej62dtsbzgnym5b9_xabpfpodhjafeckljflsridmr0hqxcu_36gxbmwxfgkplwezt4nmxmr0gbi7ru1qjlwicknm2zpnfjbs8ut0q8sq0poc8ngm9mznv9vz5qhttps3a2f2fwwwfredericknewspostcom2fnews2fcontinuing_coverage2felection_coverage2fupdateddespiterecountwindicolanotappealingdisqualificationendorsesthrasher2farticle_6f0b7beb2c105af5a0c65e2a27054787htmlseena in an election in my county nor are they likely to influence enough neighbors to change the outcome of even a single election for a single officep
pbecause foot voters can make a genuine change in their conditions of governance by moving residence they have at least some incentive to inform themselves carefully about the differences an incentive that ballot voters alas often lackp
pthe possibility of exit somin argues operates as a crucial check on the tendency of political institutions to overreach themselves in america it is closely tied to principles of federalism and decentralization that are important to the countrys hopes for preserving political stability despite sharp differences in local culture although not every issue can be handled at a local level decentralization of policy makes it more likely that the varied populations of new york arkansas vermont and utah can each live under a set of policies relatively well suited to the preferences of each group despite worries in some quarters about ideological sorting somin sees reasons to think that polarization might also decline if we wisely lowered the stakes of national redblue politics by curtailing the policy ambitions of the federal governmentp
pthe post a relnofollow hrefhttpsreasoncomvolokh20220829restoringtheguardrailsofdemocracyalibertarianviewrestoring the guardrails of democracy a libertarian viewa appeared first on a relnofollow hrefhttpsreasoncomreasoncomap
|
div picture source sizesminwidth 600px 331px 100vw typeimagewebp srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202207guardrailsncc1pngwebp 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202207guardrailsncc11200x675pngwebp 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202207guardrailsncc1800x450pngwebp 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202207guardrailsncc1600x338pngwebp 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202207guardrailsncc1331x186pngwebp 331w source sizesminwidth 600px 331px 100vw typeimagejpeg srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202207guardrailsncc1png 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202207guardrailsncc11200x675png 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202207guardrailsncc1800x450png 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202207guardrailsncc1600x338png 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202207guardrailsncc1331x186png 331w img width1200 altguardrails ncc srchttpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202207guardrailsncc1800x450png height675 picture div pimg sizesmaxwidth 300px 100vw 300px srchttpsd2eehagpk5cl65cloudfrontnetimgq60uploads202207guardrailsncc1300x169png alt width300 srcsethttpsd2eehagpk5cl65cloudfrontnetimgq60uploads202207guardrailsncc1300x169png 300w httpsd2eehagpk5cl65cloudfrontnetimgq60uploads202207guardrailsncc11024x576png 1024w httpsd2eehagpk5cl65cloudfrontnetimgq60uploads202207guardrailsncc1768x432png 768w httpsd2eehagpk5cl65cloudfrontnetimgq60uploads202207guardrailsncc11536x863png 1536w httpsd2eehagpk5cl65cloudfrontnetimgq60uploads202207guardrailsncc11200x675png 1200w httpsd2eehagpk5cl65cloudfrontnetimgq60uploads202207guardrailsncc1800x450png 800w httpsd2eehagpk5cl65cloudfrontnetimgq60uploads202207guardrailsncc1600x338png 600w httpsd2eehagpk5cl65cloudfrontnetimgq60uploads202207guardrailsncc1331x186png 331w httpsd2eehagpk5cl65cloudfrontnetimgq60uploads202207guardrailsncc1png 1580w classwpimage8194233 height169p pthe events leading inauguration day 2021 posed stress test americas republican institutions need ready tests follow particular proposals overhaul nations electoral institutions judged light lessons brush constitutional extremity reforms shore critical weaknesses deserve high priority reforms irrelevant dangers burner set aside proposals actually create new risks constitutional crisis unlikely right momentp pthus argues contribution hrefhttpsnam11safelinksprotectionoutlookcomurlhttps3a2f2fconstitutioncenterorg2fmedia2ffiles2fteam_libertarian_finalpdfdata057c017cisomin40gmuedu7c344cd041bc0d44093bd808da894a8f167c9e857255df574c47a0c00546460380cb7c07c07c6379732516543415937cunknown7ctwfpbgzsb3d8eyjwijoimc4wljawmdailcjqijoiv2lumziilcjbtii6ik1hawwilcjxvci6mn03d7c30007c7c7csdatasepgqtovydmejqvmqwc5f36nurqsiw6qi9j2fdjq9hqq3dreserved0team libertarian papera reada hrefhttpssecurewebciscocom1ljmqh5ouw1sxkedd1x46jj42kjbxblmco4gentrpwiyzjgut7l7vbt_bhy4kd6r92yiggzsk771iph_j_db04foveq4e386onzzy7lej2qmoj0pv_seizfuripzgjokehhrcog3aredh8odt08pde7uzqqr0_imtse3rexfbmtqgolm_tfohjgixoqwz_zhw0wxyekvxryf1fr9df522vt8d02plaideegaur5jncd9c_nhjk7e6aprhjnev2hir2pmbiwgz8n7byo8fmau0j23exsapknpbxwzm7ejhbjhfsf6nmtbvtlpovclzjoqi27bku5xuxnhnl532ttednj7vbxwxe4g41gheplfjijjobbwahqyj0lt93fo_owmdvrzrbbhhsluqrngnwwpmxyz_t7qpxfebs5mipoxzhdgigutfdod0kka10hl9xskmrfa4r7uovh51lh2tjwhttps3a2f2fpapersssrncom2fsol32fpaperscfm3fabstract_id3d4156387on ssrna elections democratic succession power later post ill summarize sections written contributors clark neily ilya sominp pmany institutions performed stress weeks leading 2021 transfer power including courts state governments nearly local election authorities electoral college participants senate vice president key cabinet departments pushed improper suggestions rogue white housep pironically institutions proved wobbly stress white house aside included strongest claim majoritarian legitimacy house representatives 139 435 members outright majority 212member republican caucus voted support spurious challenges bidens electoral slates unlovely fact majority gop base fact willing tag trumps claims stolen election house assembly touch public passions reflected elite misconduct endanger democratic succession power populist anger mass delusionp pi wont try summarize prescriptions highlightsp ul lia hrefhttpsnam11safelinksprotectionoutlookcomurlhttps3a2f2fwwwcatoorg2fblog2fcatoscholarselectoralcountactdata057c017cisomin40gmuedu7c344cd041bc0d44093bd808da894a8f167c9e857255df574c47a0c00546460380cb7c07c07c6379732516543415937cunknown7ctwfpbgzsb3d8eyjwijoimc4wljawmdailcjqijoiv2lumziilcjbtii6ik1hawwilcjxvci6mn03d7c30007c7c7csdatadr2xw2fkn4qjksp9nsvrr7wvdighsxqtppzyennisb5m3dreserved0electoral count act reforma confine actor proper role presidential election clear ambiguous confusing terms present law partisans process relitigate underlying electionli licongress constrain executive branchs resort dangerous emergency powers law clear clearer presidents unbounded discretion invoke insurrection act seize voting machines court order declare martial law civil order broken ways use peremptory executive power overturn block electionli licounter distrust credibility agenda recognizing age distrust systems need secure fraud bad practice visibly soexamples improve methods keeping voter registration rolls accurate uptodate strengthen auditsstates facilitate appropriate mandate reporting substantially complete returns election night counter viral popularity quotovernight stealquot claimsli lilook ways incentivize losing candidates concede president trump set worst example crying fraud losing contest offenderli liwatch proposals gather greater election election administration washington dc provide single attractive target bad actors pressure subvert wary economist steven landsburg calls quotcentralizing power decide yield powerquotli liavoid innovations invite succession crises example illthoughtout national popular vote compact states pledge cast electoral votes national popular vote winner way offered hrefhttpsnam11safelinksprotectionoutlookcomurlhttps3a2f2fwwwcatoorg2fblog2ffatallyflawednationalpopularvoteplandata057c017cisomin40gmuedu7c344cd041bc0d44093bd808da894a8f167c9e857255df574c47a0c00546460380cb7c07c07c6379732516544978397cunknown7ctwfpbgzsb3d8eyjwijoimc4wljawmdailcjqijoiv2lumziilcjbtii6ik1hawwilcjxvci6mn03d7c30007c7c7csdataq5jrkfppzbt9lh7hnts2b1qacbtcncnrwsdpunoifnqq3dreserved0secure authoritative tabulation votea agreed wonli liturn temperature stop delegitimizing key institutions sides need listen thing decry worsening polarization teams fault resist partisan temptation delegitimize existing institutions machinery republic supreme court senate local election administrators dont yield shortterm results wantli ul pi think classical liberals libertarians play constructive role conversation guardrails given particular attachment rule law constitutionalism checks balances limitations government power general instinct understand fear government likely start behaving itstop officials know voters turn officep pill turn summarizing sections report cato colleague clark neily role jury volokh conspirator george mason lawprof ilya somin benefits choice governmentsp pthe right trial jury hailed palladium angloamerican liberties enshrined sixth seventh amendments relates closely constitutional provisions criminal procedure founders knew oppressive regimes criminal law prosecution history target enemies exert social control meant citizen jury serve key guardrail abusep pyet says clark neily america allowed institution jury decay point near extinction favor informal opaque administrative system plea bargaining bad news criminal justice bear relation americas extraordinarily high rates incarceration erodes line defense critically needed american political life turn authoritarian government administrators intensify use criminalization prosecution purposeful tool opposition heedlessly allowing institution decay lose important instrument popular voice government earlier generations understood jury service important means public participated directly public businessp pilya somin champions fundamental human right deserves place alongside ballot box jury box protectors liberty right exitp pwhen people choose jurisdiction live federal system vote effect feet fact individual citizens far powerful way alter laws policies live happens change casting vote notwithstanding hrefhttpssecurewebciscocom1e73dh59mpcyy7yr7ie7_9rjlvqgrhyjlxuhwex6sqogiubc2krwcsd14nksryhgwx0ovg6tmruttf5h8wlujpvqzsunczihxrpvfiyvg92qpnturpj5_ie1c8v8uchto77y77o3bfbmyfwyiittylw1duv11lbeusfsvrffotbxcykwappkbh32riqrj9mcf3ah_ldtjlvd9jgxib1xl77abs_f8yk9wrxpxcb9aw612hviunrcibhubvsorxmxcsklq9mh0tuctzmiiv5nxa8wbpg4pzahnrs_5nnpyryltjnau0lcvtktkd40euq8cd2niri70hbf78caox8yvz8uqpezf3_wfs3f6yyxzgy0aqvtlp3giuscx1o156pga0u2phedevepnxhhlmhqja0znskotah0xihtn3z449cnp5cjogg3sdmhttps3a2f2fwwwfredericknewspostcom2fnews2fpolitics_and_government2felections2fnewresultsshowdicolawinningcountycouncilracebyonevote2farticle_08e9f269b5295236bd5bf0916414710bhtmlonevote margina hrefhttpssecurewebciscocom1e_lrknf9nk9zyv7h3oa_g9m4i2msj4ok0tkjy9zyd70c5ppwngwmnkbkufx0y5uqnqiizezkvuxphqufnni49eyddjtclwxpw7rsilz7ql7jmtrgiplkt12vkbhe8gnx_qgezchm4spq9kznje2pwdsg8lfy0tawa1jpaf44ngapxq9iau1w2tymvb5uawtflwpoyt1pjno2fawcuf352zdz0uqzspz5zob95uibvhfqldchk8w40ecacd1ioaxuo_tz6_qx4vgdilyz5wbzfw_zembvf2qlwtxuuy75pjeihb_4y0q0uijynnnlsfar8ej62dtsbzgnym5b9_xabpfpodhjafeckljflsridmr0hqxcu_36gxbmwxfgkplwezt4nmxmr0gbi7ru1qjlwicknm2zpnfjbs8ut0q8sq0poc8ngm9mznv9vz5qhttps3a2f2fwwwfredericknewspostcom2fnews2fcontinuing_coverage2felection_coverage2fupdateddespiterecountwindicolanotappealingdisqualificationendorsesthrasher2farticle_6f0b7beb2c105af5a0c65e2a27054787htmlseena election county likely influence neighbors change outcome single election single officep pbecause foot voters genuine change conditions governance moving residence incentive inform carefully differences incentive ballot voters alas lackp pthe possibility exit somin argues operates crucial check tendency political institutions overreach america closely tied principles federalism decentralization important countrys hopes preserving political stability despite sharp differences local culture issue handled local level decentralization policy makes likely varied populations new york arkansas vermont utah live set policies relatively suited preferences group despite worries quarters ideological sorting somin sees reasons think polarization decline wisely lowered stakes national redblue politics curtailing policy ambitions federal governmentp pthe post relnofollow hrefhttpsreasoncomvolokh20220829restoringtheguardrailsofdemocracyalibertarianviewrestoring guardrails democracy libertarian viewa appeared relnofollow hrefhttpsreasoncomreasoncomap
|
630ed4b891d58df6746cd0d0
|
Done With the Fascism Wars
|
img altdone with the fascism wars srchttpswisdomofcrowdslivecontentimages202208202665fgsdljpgpcan someone be a semiliberal or a semiislamist or a semipopulist theres a reason you havent heard anyone use such terms they are nonsensical which brings me to president bidens recent controversial a hrefhttpstwittercomalexthompstatus1562919223696973824remarka that the philosophy of trumpism and magaism is akin to semifascism pponce you introduce the word fascism into a conversation you can comfortably assume that it will cease being productive i however made the mistake of wading into this controversy with a hrefhttpstwittercomshadihamidstatus1563515723518865409s20tqi4dh_05jvewrawhduu4vaa tweeta that took issue with bidens characterization i said it wasnt a good look as the kids say i got a hrefhttpswwwdictionarycombrowseratioratioeda according to custom when you get ratioed youre supposed to take the l l apparently means loss ppin all of this i was reminded that the fascism debate is as old as well fascism george orwell might have put it best in his dry biting fashion pblockquoteit will be seen that as used the word fascism is almost entirely meaningless in conversation of course it is used even more wildly than in print i have heard it applied to farmers shopkeepers social credit corporal punishment foxhunting bullfighting the 1922 committee the 1941 committee kipling gandhi chiang kaishek homosexuality priestleys broadcasts youth hostels astrology women dogs and i do not know what elseblockquotepsemifascism grates on me because it doesnt actually have any substantive content if by quotsemicommunismquot you simply mean a little bit communist or somewhat communist then what are you really even saying if something is just a little bit communist then its not in fact communist in short once you start using the qualifier quotsemiquot for an ideology it is no longer the ideology in question yes yes maybe im being pedantic i should get with the times it is no longer fashionable to associate words with a distinct intelligible meaning with enough devotion we can will words to be something other than what they are we are all postmodernists the bastard children of derrida and foucault pdiv dataplaceholdersubscribedivpokay now thats out of the way i can get to more substantive preoccupations my main objection is straightforward that when you say the sort of thing that biden said you are effectively saying that tens of millions of trump supporters are fascists or more precisely semifascists sometimes i know that something i say will be controversial but for whatever reason i decide that its worth saying ppbut this time that thought didnt even occur to me i thought what i was saying was relatively banal and innocuous especially after the disaster of hillary clinton calling a big chunk of trump supporters deplorables in the before trump was president era btwpe wasnt this similar enough to elicit some amount of displeasure caution or worry or were the lessons of hillarys misstep no longer applicable because while we couldnt be sure that they were deplorables emthenem there are no such doubts today ppmy brother texted me after he saw my tweets and basically said shadi why i sympathize with this i too asked myself why why does the use of the word fascism bother me so much on substantive grounds i soon found out and what i found frightened me at least biden unwittingly qualified an otherwise categorical statement introducing some doubt as to his true meaning most of the thousands of replies i received did not try to further qualify bidens statement which would have been the obvious argumentative gambit they could have said i was creating a straw man in order to destroy it but no most people including various journalists at leading publications adopted the position that tens of millions of americansperhaps as many as 50 million or even morewere in fact fascists or at least supporters of a fascist ideology which raises the question of what the difference actually is between a fascist and a emsupporter of fascismem ppthis strikes me as a ridiculous argument and to clarify since there appeared to be some confusion on the matter im not doubting that tens of millions of republicans wouldnt mind an authoritarian outcome in 2024 or for that matter 2022 but authoritarianism is not the same as fascism but ridiculousness like beauty or terrorism is in the eye of the beholder so i will put it aside for a moment my issue is this and it colors much of my work in ways that may not seem immediately obvious if words are meant to have meaning then to say that tens of millions of supporters of the other partythe emonly emother partyare fascists fascistic or semifascistic is to use the language of national emergency to believe that your opponents are an existential threat to everything you hold dear is to transform them from adversaries into enemies once you start employing the language of existential threat it becomes all the more easy to justify taking extraordinary action to suppress the threat ppbut maybe im taking this all too seriously maybe i should just chill this is only twitter after all its not real life or anythingp
|
img altdone fascism wars srchttpswisdomofcrowdslivecontentimages202208202665fgsdljpgpcan semiliberal semiislamist semipopulist theres reason havent heard use terms nonsensical brings president bidens recent controversial hrefhttpstwittercomalexthompstatus1562919223696973824remarka philosophy trumpism magaism akin semifascism pponce introduce word fascism conversation comfortably assume cease productive mistake wading controversy hrefhttpstwittercomshadihamidstatus1563515723518865409s20tqi4dh_05jvewrawhduu4vaa tweeta took issue bidens characterization said wasnt good look kids got hrefhttpswwwdictionarycombrowseratioratioeda according custom ratioed youre supposed l l apparently means loss ppin reminded fascism debate old fascism george orwell best dry biting fashion pblockquoteit seen word fascism entirely meaningless conversation course wildly print heard applied farmers shopkeepers social credit corporal punishment foxhunting bullfighting 1922 committee 1941 committee kipling gandhi chiang kaishek homosexuality priestleys broadcasts youth hostels astrology women dogs know elseblockquotepsemifascism grates doesnt actually substantive content quotsemicommunismquot simply mean little bit communist somewhat communist saying little bit communist fact communist short start qualifier quotsemiquot ideology longer ideology question yes yes maybe im pedantic times longer fashionable associate words distinct intelligible meaning devotion words postmodernists bastard children derrida foucault pdiv dataplaceholdersubscribedivpokay thats way substantive preoccupations main objection straightforward sort thing biden said effectively saying tens millions trump supporters fascists precisely semifascists know controversial reason decide worth saying ppbut time thought didnt occur thought saying relatively banal innocuous especially disaster hillary clinton calling big chunk trump supporters deplorables trump president era btwpe wasnt similar elicit displeasure caution worry lessons hillarys misstep longer applicable couldnt sure deplorables emthenem doubts today ppmy brother texted saw tweets basically said shadi sympathize asked use word fascism bother substantive grounds soon found found frightened biden unwittingly qualified categorical statement introducing doubt true meaning thousands replies received try qualify bidens statement obvious argumentative gambit said creating straw man order destroy people including journalists leading publications adopted position tens millions americansperhaps 50 million morewere fact fascists supporters fascist ideology raises question difference actually fascist emsupporter fascismem ppthis strikes ridiculous argument clarify appeared confusion matter im doubting tens millions republicans wouldnt mind authoritarian outcome 2024 matter 2022 authoritarianism fascism ridiculousness like beauty terrorism eye beholder aside moment issue colors work ways immediately obvious words meant meaning tens millions supporters partythe emonly emother partyare fascists fascistic semifascistic use language national emergency believe opponents existential threat hold dear transform adversaries enemies start employing language existential threat easy justify taking extraordinary action suppress threat ppbut maybe im taking seriously maybe chill twitter real life anythingp
|
630fe16a76f559780cdfb1f5
|
Know Your Enemy: A Low, Dishonest Decade, with Nicole Hemmer
|
pa hrefimg srchttpswwwdissentmagazineorgwpcontentfiles_mf1661980868gingrich94featurejpgappa conversation about ipartisans the conservative revolutionaries who remade american politics in the 1990sip
|
pa hrefimg srchttpswwwdissentmagazineorgwpcontentfiles_mf1661980868gingrich94featurejpgappa conversation ipartisans conservative revolutionaries remade american politics 1990sip
|
630fe16e76f559780cdfb1f7
|
California Tries To Make It Illegal for Doctors To Spread COVID-19 'Misinformation'
|
div
picture
source sizesminwidth 600px 331px 100vw typeimagewebp srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202208doctorscovidmisinformationcalifornia2400x1350jpgwebp 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202208doctorscovidmisinformationcalifornia1200x675jpgwebp 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202208doctorscovidmisinformationcalifornia800x450jpgwebp 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202208doctorscovidmisinformationcalifornia600x338jpgwebp 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202208doctorscovidmisinformationcalifornia331x186jpgwebp 331w
source sizesminwidth 600px 331px 100vw typeimagejpeg srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202208doctorscovidmisinformationcalifornia2400x1350jpg 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202208doctorscovidmisinformationcalifornia1200x675jpg 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202208doctorscovidmisinformationcalifornia800x450jpg 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202208doctorscovidmisinformationcalifornia600x338jpg 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202208doctorscovidmisinformationcalifornia331x186jpg 331w
img width1200 altdoctors confer over a document srchttpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202208doctorscovidmisinformationcalifornia800x450jpg height675
picture
div
pthe state of california is attempting to outlaw doctors from communicating what authorities deem covid19 quotmisinformationquot to their patientsp
pab 2089 which passed the california legislature earlier this week designates the dissemination of quotmisinformation or disinformationquot relating to covid19 as quotunprofessional conductquot for doctors the a hrefhttpsleginfolegislaturecagovfacesbilltextclientxhtmlbill_id202120220ab2098text of the billa explains that its aim is to prevent doctors from giving patients information that contradicts the quotcontemporary scientific consensusquotp
pif california gov gavin newsom a democrat signs the bill doctors who violate its tenets could lose their licenses it is unclear whether the governor currently supports the billp
pquotmisinformationquot is a highly dubious and debatable category the scientific consensus has often expressed views relating to covid19 that were later contradicted official guidance with respect to masks has changed frequently during the early days of the pandemic white house coronavirus adviser anthony fauci initially downplayed the need for masks then for more than a year the scientific community urged people to wear emany emmask at all today it is widely believed that only highquality masks are offering meaningful protection at various stages of the masking discourse what many scientific experts had to say on the subject turned out to be inaccurate or at least incompletep
pthe same is true of the covid19 vaccines while they remain remarkable tools for preventing severe disease and death particularly among older and more vulnerable populations they do not substantially reduce covid19 case counts contrary to what was said about them in late 2020 and early 2021p
pscience is a deliberative process and medical professionals need to be allowed to dissent from mainstream orthodoxies and challenge dominant perspectives patients deserve expert care but its unreasonable for the government to compel ideological conformity in this fieldp
pbesides the state has shown a hrefhttpsreasoncom20210604lableakmisinformationmediafaucicovid19no particular aptitudea for a hrefhttpsreasoncom20220518disinformationboardninajankowicztaylorlorenzpausedhsdiscerning what constitutes genuine misinformationa on the contrary government actors have frequently instructed social media companies to be wary of perfectly legitimate points of view this happened with the lab leak theory which was brutally suppressed on social media at the behest of the government and it happened with emthe new yorkem empostems hunter biden laptop story which was wrongly branded a hrefhttpswwwpoliticocomnews20201019hunterbidenstoryrussiandisinfo430276russian disinformation by top law enforcement agentsa and punished accordinglyp
pits also likely that this bill violates the first amendment governments have the power to regulate medical care but the compelled speech component of ab 2089 would probably perturb the supreme court even some legal experts who support the bills goals concede that it will have a hard time surviving scrutinyp
pquotinitiatives like this will be challenged in court and will be hard to sustainquot michelle mello a professor of law and health policy at stanford university a hrefhttpswwwnytimescom20220829technologycaliforniadoctorscovidmisinformationhtmltolda emthe new york times emquotthat doesnt mean its not a good ideaquotp
ppolicing misinformation is a fraught task and the state inserting itself between doctors and their patients is usually a recipe for disaster newsom should let this bill diep
pthe post a relnofollow hrefhttpsreasoncom20220831californiatriestomakeitillegalfordoctorstospreadcovid19misinformationcalifornia tries to make it illegal for doctors to spread covid19 misinformationa appeared first on a relnofollow hrefhttpsreasoncomreasoncomap
|
div picture source sizesminwidth 600px 331px 100vw typeimagewebp srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202208doctorscovidmisinformationcalifornia2400x1350jpgwebp 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202208doctorscovidmisinformationcalifornia1200x675jpgwebp 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202208doctorscovidmisinformationcalifornia800x450jpgwebp 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202208doctorscovidmisinformationcalifornia600x338jpgwebp 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202208doctorscovidmisinformationcalifornia331x186jpgwebp 331w source sizesminwidth 600px 331px 100vw typeimagejpeg srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202208doctorscovidmisinformationcalifornia2400x1350jpg 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202208doctorscovidmisinformationcalifornia1200x675jpg 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202208doctorscovidmisinformationcalifornia800x450jpg 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202208doctorscovidmisinformationcalifornia600x338jpg 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202208doctorscovidmisinformationcalifornia331x186jpg 331w img width1200 altdoctors confer document srchttpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202208doctorscovidmisinformationcalifornia800x450jpg height675 picture div pthe state california attempting outlaw doctors communicating authorities deem covid19 quotmisinformationquot patientsp pab 2089 passed california legislature earlier week designates dissemination quotmisinformation disinformationquot relating covid19 quotunprofessional conductquot doctors hrefhttpsleginfolegislaturecagovfacesbilltextclientxhtmlbill_id202120220ab2098text billa explains aim prevent doctors giving patients information contradicts quotcontemporary scientific consensusquotp pif california gov gavin newsom democrat signs bill doctors violate tenets lose licenses unclear governor currently supports billp pquotmisinformationquot highly dubious debatable category scientific consensus expressed views relating covid19 later contradicted official guidance respect masks changed frequently early days pandemic white house coronavirus adviser anthony fauci initially downplayed need masks year scientific community urged people wear emanyemmask today widely believed highquality masks offering meaningful protection stages masking discourse scientific experts subject turned inaccurate incompletep pthe true covid19 vaccines remain remarkable tools preventing severe disease death particularly older vulnerable populations substantially reduce covid19 case counts contrary said late 2020 early 2021p pscience deliberative process medical professionals need allowed dissent mainstream orthodoxies challenge dominant perspectives patients deserve expert care unreasonable government compel ideological conformity fieldp pbesides state shown hrefhttpsreasoncom20210604lableakmisinformationmediafaucicovid19no particular aptitudea hrefhttpsreasoncom20220518disinformationboardninajankowicztaylorlorenzpausedhsdiscerning constitutes genuine misinformationa contrary government actors frequently instructed social media companies wary perfectly legitimate points view happened lab leak theory brutally suppressed social media behest government happened emthe new yorkem empostems hunter biden laptop story wrongly branded hrefhttpswwwpoliticocomnews20201019hunterbidenstoryrussiandisinfo430276russian disinformation law enforcement agentsa punished accordinglyp pits likely bill violates amendment governments power regulate medical care compelled speech component ab 2089 probably perturb supreme court legal experts support bills goals concede hard time surviving scrutinyp pquotinitiatives like challenged court hard sustainquot michelle mello professor law health policy stanford university hrefhttpswwwnytimescom20220829technologycaliforniadoctorscovidmisinformationhtmltoldaemthe new york times emquotthat doesnt mean good ideaquotp ppolicing misinformation fraught task state inserting doctors patients usually recipe disaster newsom let bill diep pthe post relnofollow hrefhttpsreasoncom20220831californiatriestomakeitillegalfordoctorstospreadcovid19misinformationcalifornia tries illegal doctors spread covid19 misinformationa appeared relnofollow hrefhttpsreasoncomreasoncomap
|
630fe18476f559780cdfb1fb
|
White House calls out DeSantis, Greene to defend semi-fascists comment
|
figure dataanvatoplayeridp3
div
divdiv
div
div datareactcomponentanvatovideoplayerdiv
figure
pwhite house press secretary karine jeanpierre defended president biden comparing the maga wing of the republican party to semifascism on wednesday by calling out republicans like florida gov ron desantis and rep marjorie taylor greene ga for their rhetoricp
prep marjorie taylor green has publicly expressed support for shooting prominent democratic elected officials and suggesting physically assaulting transgender school officials she said and just last week you had governor ron desantis suggest that dr [anthony] fauci should be physically assaultedp
pdesantis who is considered a top contender for the 2024 republican presidential nomination said in a recent speech that someone needs to chuck fauci across the potomac referring to the outgoing white house chief medical adviserp
pat a fundraising event hosted by the democratic national committee dnc in maryland on thursday biden a hrefhttpsthehillcomhomenewsadministration3616105bidensaysextrememagaphilosophyislikesemifascismlikened the extreme maga philosophya referring to former president trumps make american great again slogan to semifascismp
pjeanpierre also called out rep paul gosar rariz wednesday for posting videos depicting him attacking the president and members of congress and rep madison cawthorn rnc because he quothas said falsely if our election systems continue to be rigged and continue to be stolen then its going to lead to one place and thats bloodshedp
pand former president trump has done the same many many times she addedp
pbiden has received backlash from some republicans for the comparison to fascism including from new hampshire gov chris sununu who a hrefhttpsthehillcomhomenewssundaytalkshows3618594gopgovernorsaysbidenowesanapologytorepublicansaftersemifascistcommentcalled for biden to issue an apologya on sundayp
pwhen asked how biden differentiates between quotultramagaquot republicans and the average gop voter jeanpierre pointed to republicans in leadership positionsp
pthe president has been really clear about the leadership the maga republicans in leadership theyre the ones that have the platform theyre the ones who folks listen to in their own party she saidp
pshe added that biden named maryland gov larry hogan as a republican who is not part of the ultramaga ideology during his dnc remarks in maryland hogan who is retiring in 2023 has been critical of trump and trumpbacked candidates like the republican nominee for governor in his own state dan coxp
pthis is not a blanketed statement this is calling out what we have seen for some time since 2017 she said adding that the former president is an an authoritarian figurep
|
figure dataanvatoplayeridp3 div divdiv div div datareactcomponentanvatovideoplayerdiv figure pwhite house press secretary karine jeanpierre defended president biden comparing maga wing republican party semifascism wednesday calling republicans like florida gov ron desantis rep marjorie taylor greene ga rhetoricp prep marjorie taylor green publicly expressed support shooting prominent democratic elected officials suggesting physically assaulting transgender school officials said week governor ron desantis suggest dr [anthony] fauci physically assaultedp pdesantis considered contender 2024 republican presidential nomination said recent speech needs chuck fauci potomac referring outgoing white house chief medical adviserp pat fundraising event hosted democratic national committee dnc maryland thursday bidena hrefhttpsthehillcomhomenewsadministration3616105bidensaysextrememagaphilosophyislikesemifascismlikenedthe extreme maga philosophya referring president trumps american great slogan semifascismp pjeanpierre called rep paul gosar rariz wednesday posting videos depicting attacking president members congress rep madison cawthorn rnc quothas said falsely election systems continue rigged continue stolen going lead place thats bloodshedp pand president trump times addedp pbiden received backlash republicans comparison fascism including new hampshire gov chris sununu whoa hrefhttpsthehillcomhomenewssundaytalkshows3618594gopgovernorsaysbidenowesanapologytorepublicansaftersemifascistcommentcalled forbiden issue apologya sundayp pwhen asked biden differentiates quotultramagaquot republicans average gop voter jeanpierre pointed republicans leadership positionsp pthe president clear leadership maga republicans leadership theyre ones platform theyre ones folks listen party saidp pshe added biden named maryland gov larry hogan republican ultramaga ideology dnc remarks maryland hogan retiring 2023 critical trump trumpbacked candidates like republican nominee governor state dan coxp pthis blanketed statement calling seen time 2017 said adding president authoritarian figurep
|
630fe1c876f559780cdfb209
|
OnlySubs: The Sinking of the USS Twitter
|
pemonlysubs episode 105 the sinking of the uss twitterspan datatagposttitle spanemis now available exclusively for new discourses contributors on the following platformsbr
a relnoopener hrefhttpsnewdiscourseslocalscompost2664534thesinkingoftheusstwitteronlysubswithjameslindsayep105 target_blanklocalsabr
a relnoopener hrefhttpswwwpatreoncompostssinkingofuss71320516 target_blankpatreonabr
a relnoopener hrefhttpswwwsubscribestarcomposts688071 target_blanksubscribestarabr
a relnoopener hrefhttpsyoutubeyx2tethzasy target_blankyoutube membersabr
a relnoopener hrefhttpswwwthinkspotcomonline_contentnewdiscoursesthesinkingoftheusstwitteronlysubswithjameslindsayep105z2uql3bevent target_blankthinkspotap
pif we think about whats taking place in the world today as a new form of warfare and we think about the various instruments of that warfare in analogy to say naval vessels we might come to think of a social media platform like twitter as a kind of powerful battleship for the enemy forces of today the uss twitter drawing back to the previous world war for inspiration and insight in 1941 the allied forces sank the german ultrabattleship the bismarck sort of in that sinking in fact allies critically wounded the ship with a torpedo dropped from a lowflying airplane and the nazis sunk the ship themselves from within to prevent its capture is that what explains twitters behavior with rampant censorship bans lockouts suspensions and its open announcement of fortification of the upcoming election today this raises other questions do we really need twitter can conservatives strike a mortal blow against one of the enemys most formidable weapons join me in this latest episode of james lindsay onlysubs my subscribersonly podcast to explore some of these issues with mep
padditional episodes of the emonlysubs podcastem can be found a hrefhttpsnewdiscoursescomtagonlysubshereap
pthe post a relnofollow hrefhttpsnewdiscoursescom202208onlysubsthesinkingoftheusstwitteronlysubs the sinking of the uss twittera appeared first on a relnofollow hrefhttpsnewdiscoursescomnew discoursesap
|
pemonlysubs episode 105 sinking uss twitterspan datatagposttitlespanemis available exclusively new discourses contributors following platformsbr relnoopener hrefhttpsnewdiscourseslocalscompost2664534thesinkingoftheusstwitteronlysubswithjameslindsayep105 target_blanklocalsabr relnoopener hrefhttpswwwpatreoncompostssinkingofuss71320516 target_blankpatreonabr relnoopener hrefhttpswwwsubscribestarcomposts688071 target_blanksubscribestarabr relnoopener hrefhttpsyoutubeyx2tethzasy target_blankyoutube membersabr relnoopener hrefhttpswwwthinkspotcomonline_contentnewdiscoursesthesinkingoftheusstwitteronlysubswithjameslindsayep105z2uql3bevent target_blankthinkspotap pif think whats taking place world today new form warfare think instruments warfare analogy naval vessels come think social media platform like twitter kind powerful battleship enemy forces today uss twitter drawing previous world war inspiration insight 1941 allied forces sank german ultrabattleship bismarck sort sinking fact allies critically wounded ship torpedo dropped lowflying airplane nazis sunk ship prevent capture explains twitters behavior rampant censorship bans lockouts suspensions open announcement fortification upcoming election today raises questions need twitter conservatives strike mortal blow enemys formidable weapons join latest episode james lindsay onlysubs subscribersonly podcast explore issues mep padditional episodes emonlysubs podcastem found hrefhttpsnewdiscoursescomtagonlysubshereap pthe post relnofollow hrefhttpsnewdiscoursescom202208onlysubsthesinkingoftheusstwitteronlysubs sinking uss twittera appeared relnofollow hrefhttpsnewdiscoursescomnew discoursesap
|
630fe1ce76f559780cdfb20b
|
A Psychiatric Facility Punishes Residents With Painful Electric Shocks. Now It's Trying To Sue Its Critics.
|
div
picture
source sizesminwidth 600px 331px 100vw typeimagewebp srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202208psychiatricfacilitypunishesresidentsjpgwebp 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202208psychiatricfacilitypunishesresidents1200x675jpgwebp 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202208psychiatricfacilitypunishesresidents800x450jpgwebp 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202208psychiatricfacilitypunishesresidents600x338jpgwebp 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202208psychiatricfacilitypunishesresidents331x186jpgwebp 331w
source sizesminwidth 600px 331px 100vw typeimagejpeg srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202208psychiatricfacilitypunishesresidentsjpg 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202208psychiatricfacilitypunishesresidents1200x675jpg 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202208psychiatricfacilitypunishesresidents800x450jpg 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202208psychiatricfacilitypunishesresidents600x338jpg 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202208psychiatricfacilitypunishesresidents331x186jpg 331w
img width1200 altsilhouette of a child with a red background srchttpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202208psychiatricfacilitypunishesresidents800x450jpg height675
picture
div
pspanthespan a hrefhttpswwwjudgercorgourschoolhtmlspanjudge rotenberg centerspanaspan is a residential psychiatric institution in canton massachusetts since its founding in 1971 the rotenberg center has become infamous for its use of controversial methods to treat children and adults with behavioral problems and developmental disabilities quotstudentsquot at the center are subjected to contingent skin shock an extreme version of applied behavior analysis which is a common treatment for autism and other developmental conditionsspanp
pspanthe electric shocks given to individuals at the rotenberg center are severe according to one expert thespan a hrefhttpsneuroclasticcom900abaprofessionalshaveweighedinontheuseofelectroshockatjudgerotenbergcennterspanshocksspanaspan are at least six times more potent than the most powerful legal stun gun according to the foundation for individual rights and expression fire the centersspan a hrefhttpsd28htnjz2elwujcloudfrontnetwpcontentuploads20220830090152fireletterregardingneuroclasticceaseanddesistpdfspanpracticesspanaspan have been condemned by the united nations special rapporteur on torture and six residents have died while in the centers carespanp
pspandespite scandals according to firespan a hrefhttpsd28htnjz2elwujcloudfrontnetwpcontentuploads20220830090152fireletterregardingneuroclasticceaseanddesistpdfspanofficialsspanaspan at the rotenberg center have spent hundreds of thousands of dollars lobbying government bodies to keep the center open in 2020 the food and drug administration fda formallyspan a hrefhttpswwwfdagovnewseventspressannouncementsfdatakesrarestepbanelectricalstimulationdevicesselfinjuriousoraggressivebehaviorspanbannedspanaspan the electric shock devices used by the center because they quotpresent an unreasonable and substantial risk of illness or injuryquot however the center successfully sued reinstating its practices after a federal appeals courtspan a hrefhttpswwwcnncom20210716healthjudgerotenbergcenterappealscourtrulingindexhtmlspanfoundspanaspan that the fda did not have the authority to ban the centers shock devicesspanp
pspandisability rights groups havespan a hrefhttpsautisticadvocacyorgstoptheshockspanconsistently opposedspanaspan the rotenberg centers practices while their efforts have not succeeded so far shutting down the center remains a top priority for many autism rights groups and activists however one activist group now faces a lawsuit for speaking out against the centers practicesspanp
pa hrefhttpsneuroclasticcomspanemneuroclasticemspanaspan is a small nonprofit and publication that runs stories by autistic writers who cover topics pertaining to disability rights on its website the organization writes that it seeks quotto create a counterpoint to messaging about autism that presents the autistic neurotype as a disease or disorder or a checklist of deficitsquotspanp
pspanin august 2021 emneuroclasticem published quotspana hrefhttpsneuroclasticcom900abaprofessionalshaveweighedinontheuseofelectroshockatjudgerotenbergcennterspan900 aba professionals have weighed in on the use of electroshock at judge rotenberg centerspanaspanquot the survey found that 89 percent of surveyed clinicians quotstrongly opposedquot the practice and 70 percent of respondents quotbelieve the jrc should be shut downquot spanp
pspanon april 27 the rotenberg center responded by sending aspan a hrefhttpsd28htnjz2elwujcloudfrontnetwpcontentuploads20220829170541judgerotenbergcenterceaseanddesistlettertoneuroclasticpdfspanceaseanddesistspanaspan letter to emneuroclasticem claiming that the organizations statements quotare false and defamatory and are causing harm to jrcquot the letter singles out emneuroclasticems survey of aba professionals claiming that emneuroclasticem published a litany of false statements about the rotenberg centerspanp
pspanhowever quotall of neuroclastics statements are true or substantially true and neuroclastic believes them to be true based on publicly available sources that it cited at the time of publicationquot wrote fire attorney gabe walters in aspan a hrefhttpsd28htnjz2elwujcloudfrontnetwpcontentuploads20220830090152fireletterregardingneuroclasticceaseanddesistpdfspanresponsespanaspan to the ceaseanddesist letter walters continued quotthe other statements [the rotenberg center] identif[ies] are plainly matters of protected opinionquotspanp
pspanasspan a hrefhttpsd28htnjz2elwujcloudfrontnetwpcontentuploads20220830090152fireletterregardingneuroclasticceaseanddesistpdfspannotedspanaspan by fire many of the allegedly defamatory statements are in fact verifiable for example emneuroclasticem stated that the rotenberg center has shocked residents while they were tied down on the floor the center claims this is false however according to fire that statement is quotbased on a video of a resident strapped to a restraint board and shocked 31 times cbs evening news broadcast footage of the video nationallyquotspanp
pspanquotemneuroclasticem shouldnt face litigation for advocating for its mission which is to be a voice for autistic people the center is delivering painful electric shocks to autistic residents to try to suppress their autistic behaviors and emneuroclasticem is obviously opposed to that practice and speaks out about itquot walters tells spanispanreasonspanispan quotit cant enter one side of the debate on this public issue and then try to shut down the other side by intimidating them with a meritless defamation suitquotspanp
pthe post a relnofollow hrefhttpsreasoncom20220831apsychiatricfacilitypunishesresidentswithpainfulelectricshocksnowitstryingtosueitscriticsa psychiatric facility punishes residents with painful electric shocks now its trying to sue its criticsa appeared first on a relnofollow hrefhttpsreasoncomreasoncomap
|
div picture source sizesminwidth 600px 331px 100vw typeimagewebp srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202208psychiatricfacilitypunishesresidentsjpgwebp 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202208psychiatricfacilitypunishesresidents1200x675jpgwebp 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202208psychiatricfacilitypunishesresidents800x450jpgwebp 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202208psychiatricfacilitypunishesresidents600x338jpgwebp 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202208psychiatricfacilitypunishesresidents331x186jpgwebp 331w source sizesminwidth 600px 331px 100vw typeimagejpeg srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202208psychiatricfacilitypunishesresidentsjpg 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202208psychiatricfacilitypunishesresidents1200x675jpg 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202208psychiatricfacilitypunishesresidents800x450jpg 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202208psychiatricfacilitypunishesresidents600x338jpg 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202208psychiatricfacilitypunishesresidents331x186jpg 331w img width1200 altsilhouette child red background srchttpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202208psychiatricfacilitypunishesresidents800x450jpg height675 picture div pspanthespan hrefhttpswwwjudgercorgourschoolhtmlspanjudge rotenberg centerspanaspan residential psychiatric institution canton massachusetts founding 1971 rotenberg center infamous use controversial methods treat children adults behavioral problems developmental disabilities quotstudentsquot center subjected contingent skin shock extreme version applied behavior analysis common treatment autism developmental conditionsspanp pspanthe electric shocks given individuals rotenberg center severe according expert thespan hrefhttpsneuroclasticcom900abaprofessionalshaveweighedinontheuseofelectroshockatjudgerotenbergcennterspanshocksspanaspan times potent powerful legal stun gun according foundation individual rights expression fire centersspan hrefhttpsd28htnjz2elwujcloudfrontnetwpcontentuploads20220830090152fireletterregardingneuroclasticceaseanddesistpdfspanpracticesspanaspan condemned united nations special rapporteur torture residents died centers carespanp pspandespite scandals according firespan hrefhttpsd28htnjz2elwujcloudfrontnetwpcontentuploads20220830090152fireletterregardingneuroclasticceaseanddesistpdfspanofficialsspanaspan rotenberg center spent hundreds thousands dollars lobbying government bodies center open 2020 food drug administration fda formallyspan hrefhttpswwwfdagovnewseventspressannouncementsfdatakesrarestepbanelectricalstimulationdevicesselfinjuriousoraggressivebehaviorspanbannedspanaspan electric shock devices center quotpresent unreasonable substantial risk illness injuryquot center successfully sued reinstating practices federal appeals courtspan hrefhttpswwwcnncom20210716healthjudgerotenbergcenterappealscourtrulingindexhtmlspanfoundspanaspan fda authority ban centers shock devicesspanp pspandisability rights groups havespan hrefhttpsautisticadvocacyorgstoptheshockspanconsistently opposedspanaspan rotenberg centers practices efforts succeeded far shutting center remains priority autism rights groups activists activist group faces lawsuit speaking centers practicesspanp pa hrefhttpsneuroclasticcomspanemneuroclasticemspanaspan small nonprofit publication runs stories autistic writers cover topics pertaining disability rights website organization writes seeks quotto create counterpoint messaging autism presents autistic neurotype disease disorder checklist deficitsquotspanp pspanin august 2021 emneuroclasticem published quotspana hrefhttpsneuroclasticcom900abaprofessionalshaveweighedinontheuseofelectroshockatjudgerotenbergcennterspan900 aba professionals weighed use electroshock judge rotenberg centerspanaspanquot survey found 89 percent surveyed clinicians quotstrongly opposedquot practice 70 percent respondents quotbelieve jrc shut downquotspanp pspanon april 27 rotenberg center responded sending aspana hrefhttpsd28htnjz2elwujcloudfrontnetwpcontentuploads20220829170541judgerotenbergcenterceaseanddesistlettertoneuroclasticpdfspanceaseanddesistspanaspan letter emneuroclasticem claiming organizations statements quotare false defamatory causing harm jrcquot letter singles emneuroclasticems survey aba professionals claiming emneuroclasticem published litany false statements rotenberg centerspanp pspanhowever quotall neuroclastics statements true substantially true neuroclastic believes true based publicly available sources cited time publicationquot wrote fire attorney gabe walters aspana hrefhttpsd28htnjz2elwujcloudfrontnetwpcontentuploads20220830090152fireletterregardingneuroclasticceaseanddesistpdfspanresponsespanaspan ceaseanddesist letter walters continued quotthe statements [the rotenberg center] identif[ies] plainly matters protected opinionquotspanp pspanasspan hrefhttpsd28htnjz2elwujcloudfrontnetwpcontentuploads20220830090152fireletterregardingneuroclasticceaseanddesistpdfspannotedspanaspan fire allegedly defamatory statements fact verifiable example emneuroclasticem stated rotenberg center shocked residents tied floor center claims false according fire statement quotbased video resident strapped restraint board shocked 31 times cbs evening news broadcast footage video nationallyquotspanp pspanquotemneuroclasticem shouldnt face litigation advocating mission voice autistic people center delivering painful electric shocks autistic residents try suppress autistic behaviors emneuroclasticem obviously opposed practice speaks itquot walters tells spanispanreasonspanispan quotit cant enter debate public issue try shut intimidating meritless defamation suitquotspanp pthe post relnofollow hrefhttpsreasoncom20220831apsychiatricfacilitypunishesresidentswithpainfulelectricshocksnowitstryingtosueitscriticsa psychiatric facility punishes residents painful electric shocks trying sue criticsa appeared relnofollow hrefhttpsreasoncomreasoncomap
|
630fe1d076f559780cdfb20d
|
Artificial Intelligence Helps French Tax Authorities Find Thousands of Untaxed Swimming Pools
|
div
picture
source sizesminwidth 600px 331px 100vw typeimagewebp srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202208dreamstime_xl_27217662400x1350jpgwebp 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202208dreamstime_xl_27217661200x675jpgwebp 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202208dreamstime_xl_2721766800x450jpgwebp 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202208dreamstime_xl_2721766600x338jpgwebp 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202208dreamstime_xl_2721766331x186jpgwebp 331w
source sizesminwidth 600px 331px 100vw typeimagejpeg srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202208dreamstime_xl_27217662400x1350jpg 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202208dreamstime_xl_27217661200x675jpg 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202208dreamstime_xl_2721766800x450jpg 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202208dreamstime_xl_2721766600x338jpg 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202208dreamstime_xl_2721766331x186jpg 331w
img width1200 altswimming pool drone surveillance france taxes tax pools irs srchttpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202208dreamstime_xl_2721766800x450jpg height675
picture
div
pusing aerial photos and artificial intelligence french tax officials have reportedly identified more than 20000 previously untaxed residential swimming poolspotentially netting the french government a windfall of more than 10 million euros 10 millionp
pand that total likely represents only a fraction of the a hrefhttpsenwikipediaorgwikicheeseeating_surrender_monkeyscheeseeating tax cheatsa out there a hrefhttpswwwnytimescom20220830worldeuropefrancetaxespoolsartificialintelligencehtmlaccording toa emthe new york times emthe photoscanning ai tool developed in tandem by a french it firm and google has been deployed so far in just nine of the countys 96 administrative districts but it has been so successful that french officials are planning a national effort in the coming monthsp
pswimming pools matter because the french property tax system is based on the theoretical rental value of a home and its surrounding lands that means building additions to your house or improving the groundsfor example by adding a poolcan come with a costly tax bill according to emars technica ema new pool a hrefhttpsarstechnicacominformationtechnology202208francerevealshiddenswimmingpoolswithaitaxesthemadds about 200 eurosa to the average french property tax coffers the general directorate of public financetheir irs equivalentbelieves it could collect as much as 40 million euros in additional taxes when the ai tool is deployed across the rest of the country a hrefhttpswwwthevergecom202283023328442franceaiswimmingpooltaxaerialphotospera emthe vergeemp
pbecause this is france a lot of the political controversy stirred up by the use of aerial photos and ai to detect untaxed pools is not for the reasons you might expector perhaps emexactlyem for the reasons youd expect the emtimes ema hrefhttpswwwnytimescom20220830worldeuropefrancetaxespoolsartificialintelligencehtmlreportsa that the unions representing french tax collectors are opposed to the effort fearing that it will quotreplace field work by tax collectors and surveyorsquot with algorithmsp
pemars technicaem a hrefhttpsarstechnicacominformationtechnology202208francerevealshiddenswimmingpoolswithaitaxesthemnotesa that the french firm that developed the software is facing criticism for contracting with googlep
pa more efficient tax collection service that requires fewer bureaucrats isnt necessarily bad and americans dont have to worry about getting a bigger federal tax bill if they improve the value of their property though property taxes do fund other levels of government but even if the irs wont be spying on our backyards in the hopes of charging us extra next year theres a warning here about what happens when you give tax cops more resources and more power lots of people end up having to pay more in taxesp
pthe expected 87000 new agents that the irs will hire thanks to the recently passed inflation reduction act wont be literally sorting through photos of americans backyards but they will be sorting through americans emfinancialem backyards despite what democrats and a hrefhttpsreasoncom20220819factcheckingindustrycontinuesprovidingcoverforwhitehousesunbelievableirsclaimscompliant media quotfact checkersquota claimed in the runup to the bills passage there is a hrefhttpsreasoncom20220812dontbelievethewhitehousespromisesaboutwhothenewirswillauditlittle reason to believea the enhanced tax scrutiny will be focused exclusively on americans earning more than 400000 in fact about a hrefhttpswwwfinancesenategovimomediadocirs_enforcement_jct_analysispdfhalf of the socalled quottax gapquota that the bill envisions closing would have to come from americans earning less than 200000 annually according to a joint committee on taxation analysisp
pbigger tax authorities operating with more powerful technology will translate into higher tax bills for the poor suckers unlucky enough to live under those regimes thats true whether your quottax crimequot is having an unreported swimming pool or a hrefhttpsreasoncom20220830thisgrandmotherdidntsubmittheproperbankingformnowtheirswants21millionfromherfilling out the wrong forma at your bankp
pthe post a relnofollow hrefhttpsreasoncom20220831artificialintelligencehelpsfrenchtaxofficialsfindthousandsofuntaxedswimmingpoolsartificial intelligence helps french tax authorities find thousands of untaxed swimming poolsa appeared first on a relnofollow hrefhttpsreasoncomreasoncomap
|
div picture source sizesminwidth 600px 331px 100vw typeimagewebp srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202208dreamstime_xl_27217662400x1350jpgwebp 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202208dreamstime_xl_27217661200x675jpgwebp 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202208dreamstime_xl_2721766800x450jpgwebp 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202208dreamstime_xl_2721766600x338jpgwebp 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202208dreamstime_xl_2721766331x186jpgwebp 331w source sizesminwidth 600px 331px 100vw typeimagejpeg srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202208dreamstime_xl_27217662400x1350jpg 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202208dreamstime_xl_27217661200x675jpg 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202208dreamstime_xl_2721766800x450jpg 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202208dreamstime_xl_2721766600x338jpg 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202208dreamstime_xl_2721766331x186jpg 331w img width1200 altswimming pool drone surveillance france taxes tax pools irs srchttpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202208dreamstime_xl_2721766800x450jpg height675 picture div pusing aerial photos artificial intelligence french tax officials reportedly identified 20000 previously untaxed residential swimming poolspotentially netting french government windfall 10 million euros 10 millionp pand total likely represents fraction hrefhttpsenwikipediaorgwikicheeseeating_surrender_monkeyscheeseeating tax cheatsa hrefhttpswwwnytimescom20220830worldeuropefrancetaxespoolsartificialintelligencehtmlaccording toaemthe new york timesemthe photoscanning ai tool developed tandem french firm google deployed far countys 96 administrative districts successful french officials planning national effort coming monthsp pswimming pools matter french property tax system based theoretical rental value home surrounding lands means building additions house improving groundsfor example adding poolcan come costly tax bill according toemars technica ema new pool hrefhttpsarstechnicacominformationtechnology202208francerevealshiddenswimmingpoolswithaitaxesthemadds 200 eurosa average french property tax coffers general directorate public financetheir irs equivalentbelieves collect 40 million euros additional taxes ai tool deployed rest country hrefhttpswwwthevergecom202283023328442franceaiswimmingpooltaxaerialphotospera emthe vergeemp pbecause france lot political controversy stirred use aerial photos ai detect untaxed pools reasons expector emexactlyem reasons youd expect emtimesema hrefhttpswwwnytimescom20220830worldeuropefrancetaxespoolsartificialintelligencehtmlreportsa unions representing french tax collectors opposed effort fearing quotreplace field work tax collectors surveyorsquot algorithmsp pemars technicaem hrefhttpsarstechnicacominformationtechnology202208francerevealshiddenswimmingpoolswithaitaxesthemnotesa french firm developed software facing criticism contracting googlep pa efficient tax collection service requires fewer bureaucrats isnt necessarily bad americans dont worry getting bigger federal tax bill improve value property property taxes fund levels government irs wont spying backyards hopes charging extra year theres warning happens tax cops resources power lots people end having pay taxesp pthe expected 87000 new agents irs hire thanks recently passed inflation reduction act wont literally sorting photos americans backyards sorting americans emfinancialem backyards despite democrats hrefhttpsreasoncom20220819factcheckingindustrycontinuesprovidingcoverforwhitehousesunbelievableirsclaimscompliant media quotfact checkersquota claimed runup bills passage hrefhttpsreasoncom20220812dontbelievethewhitehousespromisesaboutwhothenewirswillauditlittle reason believea enhanced tax scrutiny focused exclusively americans earning 400000 fact hrefhttpswwwfinancesenategovimomediadocirs_enforcement_jct_analysispdfhalf socalled quottax gapquota bill envisions closing come americans earning 200000 annually according joint committee taxation analysisp pbigger tax authorities operating powerful technology translate higher tax bills poor suckers unlucky live regimes thats true quottax crimequot having unreported swimming pool hrefhttpsreasoncom20220830thisgrandmotherdidntsubmittheproperbankingformnowtheirswants21millionfromherfilling wrong forma bankp pthe post relnofollow hrefhttpsreasoncom20220831artificialintelligencehelpsfrenchtaxofficialsfindthousandsofuntaxedswimmingpoolsartificial intelligence helps french tax authorities find thousands untaxed swimming poolsa appeared relnofollow hrefhttpsreasoncomreasoncomap
|
630fe28576f559780cdfb236
|
Ukraine's Ripples
|
img altukraines ripples srchttpswwwamericanpurposecomcontentimages202208screenshot20220831at112052ampngpstrongrobert asahinastrong antony blinken told cnn in january that the purpose of sanctions is to deter aggression ironically at that point he was arguing emagainstem imposing sanctions on russia after putin invaded ukraine in february successive rounds of unprecedented sanctions by the united states and the eu have failed not only to deter russia but to stop the wars escalation meanwhile russia has responded by holding ukrainian exports hostage essentially weaponizing foodppso the question is what sanctions will accomplish in the long term since theyve mostly failed at their avowed purpose in the short term but also what will the international order look like down the road now that sanctions embargoes boycotts and other geoeconomic tools have effectively become weapons of war that is has the socalled neoliberalism of the past thirty yearswhich depends upon free movement of people and capital and technology and ideascome to an endppstrongstuart levey strongsanctions can be understood in tactical and strategic terms on the tactical side its clear that financial tools have become an important instrument of national security i was at the treasury department from 2004 to 2011 and initially there was skepticism about whether financial measures could be effective over time weve learned they can be if done wellpptheyre not magic however i think its unrealistic to believe they would have deterred putin from invading ukraine nonetheless they have inflicted pain thereby creating leverage for diplomacy with russia in the medium term there are a few important takeaways thus far first and to the biden administrations credit the response has been decidedly multilateral the united states and its allies have a wellestablished playbook to roll out sanctions and other financial measures efficiently effectively and quickly with an exception ill come to they showed some significant strength a wide variety of measuressanctioning banks and individuals imposing import and export restrictions restricting access to the society for worldwide interbank financial telecommunication swift banning travelthat normally would be disconnected were all exercised in a concerted waybr___steady_paywall___branother thing thats been done fairly well is the high level of focused effort to pursue corruption fighting corruption is often something where there is a lot of lip service paid everyone agrees that corruption is bad there is a un convention against it countries have signed up to all sorts of really greatsounding commitments but in general very little happens its significant that this time the west has gone after oligarchs who became wealthy or are sustaining their wealth by supporting putin it remains to be seen whether we can turn that effort into something lasting beyond a onetime tactic of targeting russia but certainly in the united states the united kingdom and in some other places theres been a reckoning as to why so much of this wealth has been stashed in our societiespdiv
span datapullquotewhile sanctions have been quick and pretty effective theres a gaping hole which essentially allows russia to continue to sell its oil and gas bringing in lots of hard currency including from europe stuart leveyspan
divpthe last point on the tactical side is the exception i referred to while sanctions have been quick and pretty effective theres a gaping hole in the sanctions we have imposed which essentially allows russia to continue to sell its oil and gas bringing in lots of hard currency including from europe there are other things that havent been done and ways sanctions can be improved but this is the really big problem that mutes their effectiveness overallppthe multilateral coalition that exists is imperfect a lot of countries havent joined the coalition including of course china but also india and other potential customers for russian oil and gas our traditional gulf allies saudi arabia and the uae have not been willing to cooperate by increasing production and lowering the price of oil so the united states still faces challenges making sanctions work just on a tactical levelppstrongfrancis fukuyamastrong i dont think people ever thought that sanctions by themselves would deter russia i think they were part of the calculation leading up to the war russia anticipated they would be hit with sanctions and they protected themselves by building up their foreign currency reserves to over 600 billion prior to the war they didnt anticipate other central banks freezing a lot of those assets but they clearly were worried and thought they had a way around anticipated sanctionsppstuart is right that the big problem is the energy exports russia still gets around 700 million a day in payments for oil and gas which is why the ruble hasnt fallen more than it has thats why russia can continue to fund its war machine whether europe can actually wean itself off of russian oil and gas remains to be seen theyve been making some progress in that direction i was part of a working group advising both the biden administration and the ukrainians about exactly what kinds of sanctions are necessary i think they have a pretty good plan not to ban imports but to impose tariffs on imports so that the russians dont capture a big differential between the global price and their production costs this also allows the europeans to move in the direction of cutting off russian oil and gas but in a more gradual fashion so they can start replacing those sources elsewhereppother sanctions that may be highly effective are the blocking of technology exports because a lot of russian military equipment depends actually on western technology the ukrainians shot down a russian military helicopter that had a garmin gps system russian aviation uses boeing jetliners and theyre now cut off from spare parts as time goes on these kinds of blockages are going to start cutting much more deeply into the russian perception of the costs of the war theyve undertakenph3alternative payment systems and digital currenciesh3pstrongslstrong i agree that cutting off technology has been critical and its been an important part of whats worked well the question of reserves however raises broader questions the rest of the worldparticularly chinawill be watching what sort of sanctions we put on russia and while we look at sanctions and financial measures as critical national security tools now other countries will be persuaded that they really must find a way to escape a system in which the united states can inflict this kind of pain relatively unilaterally remember theres no un security council resolution here as there was with iran and north korea this is a coalition of the willing sanctions regimeppif youre china you see that the west not only cut off russia from access to its central bank reserves but now the west is talking about confiscating those reserves in order to pay for the reconstruction of ukraine this may be justified under the circumstances but it will have longterm implications for how the chinese for example will react to the current norms in our financial system similarly the saudis or indians might be wondering if this could happen to themthat their central bank reserves could be frozen and confiscated these actions were always possible but the current steps are very strong so countries will be looking for ways to extricate themselves from the system that currently allows the united states to exercise coercive powerppi dont think the united states should be a hundred percent confident that it has the rest of the western world behind it in these matters even the europeans are pretty skeptical of us unilateral power in the financial system and have at times been resentful of it so we should flag this as potentially a mediumterm strategic challenge for the united statesppstrongffstrong underlying this issue is the position of the dollar as the worlds leading currency theres been discussion about alternatives to the dollar for as long as i can remember and nobodys really moved in that direction but if these central banks are going to be confiscating dollar reserves held by other central banks held by the us treasury thats a big incentive to start using currencies other than the dollarppthe advantages that the united states gets by being the worlds currency are enormous we get away with running such enormous budget deficits year after year because other countries are willing to hold their assets in dollars if theres a broad move away from that its going to raise interest rates domestically and make it much harder to fund deficits but whats the alternative the renminbi is not freely convertible the euro has problems and the japanese yen and swiss franc are relatively small players in global markets what are the prospects of the dollar losing its supremacy around the worldppstrongslstrong back in 2005 when i was a new under secretary at the treasury department and we instituted a unilateral sanction i got a pretty strong lecture from some senior people about how unilateral sanctions would undermine the dollar as the worlds reserve currency to date thats not been true youve seen whats happened in the intervening fifteen or sixteen years weve continued to act unilaterally and the dollar has remained strongfor exactly the reason you said there is no real alternative of course just because it hasnt happened yet doesnt mean it wont but the dollar is currently the worlds safest currency and it maintains its position for a variety of reasons including the overall strength of our economy and the rule of law in the united states thats where our real leverage rests nowpdiv
span datapullquoteright now [the us] could probably shape the development of a payment system based on digital currencies but if we stand back and let the chinese dominatethey are already well ahead of ustheres a risk we could lose our leverage stuart leveyspan
divpone thing we should be concerned about though is whether it is possible to develop an alternative payment system with blockchain and digital or cryptocurrencies creating an opportunity to move value without necessarily going in and out of dollars and therefore not having to clear transactions through the united states i was part of a working group at hoover about the chinese digital renminbi and how china is working on an infrastructure for such a payment system theres a risk china will want to develop payment rails free from us domination and therell be a lot of other countries willing and even eager to free themselves from the potential of us financial coercion if i were a policymaker in the united states right now i would be trying to make sure that as digital currencies develop we maintain the ability to impose and enforce sanctions right now we could probably shape the development of a payment system based on digital currencies but if we stand back and let the chinese dominatethey are already well ahead of ustheres a risk we could lose our leverage this is also why it is critical that any such payment system be properly regulatedppstrongffstrong the current meltdown in the cryptocurrency market does indicate the real dangers of this type of completely unregulated form of payment and for environmental reasons and because of the transaction costs crypto will never be a means of payment but it could be a store of value so even though youll never use bitcoin to pay for your gasoline at the pump you could use it to hold a few billion dollars in reservesppstrongslstrong there are ways to have high transactional volume on blockchains though not at the moment with bitcoin you cant just look at the limitations of bitcoin transactions there are digital stablecoins that could be used as payment tokens right now of course we just witnessed the collapse of a socalled algorithmic stablecoin that wasnt backed by anything but imagine a true stablecoina digital dollar backed by real assets you could use it as a token to move on the blockchain to make paymentsand potentially create an alternative payment networkppstablecoins are not big enough right now to support the massive volumes that are transacted but theoretically they could in fact this is the aspiration of many projects in the crypto space what is also being contemplated are central banks issuing their own digital tokens that could be moved very quickly on blockchains the fed is considering the possibility of issuing a digital dollar in the united states though its a long time away but meanwhile the private sector does have alternative digital currencies true stablecoins that could fill this roleppif that sort of payment system develops on blockchainbased rails the united states may not be able to implement sanctions effectively in the way that the traditional financial system does sanctions work in the traditional financial system because there are intermediaries along the way that know the parties to the transactions and scrutinize the transactions whos the counterparty whats the purpose of the transaction sanctions work because those intermediaries have real incentives to be careful the whole purpose of the blockchain is to eliminate those intermediaries and make the transactions frictionless allowing parties to transact without even revealing their true identity into the ecosystem and that is a risk to our sanctions programs and therefore to our national securityppstrongffstrong but would anybody ever trust a private issuer of stablecoins that wasnt heavily regulated by a government thats really the problem with existing stablecoinsthey claimed they had adequate reserves but they didnt actually reveal what they were or whether they really existed so would there have to be a government standing behind a stablecoin before people would truly trust itppstrongslstrong my position has always been that no issuer of a private stablecoin will ever be as trustworthy as the fed a digital dollar issued by the fed would be most trustworthy but sufficient auditing and transparency as to your reserves could make a private digital currency that people did trust if it had an audited reserve of a hundred percent of the value issued plus a capital buffer or fdic insurance even now there are billions and billions of dollars of stablecoins in circulation and some people are trusting themppstrongffstrong are the chinese actually trying to create a digital renminbi and if so wouldnt that mean losing control over their money supply or is this a parallel currency that will be used for transactions that will somehow be kept separate from the renminbippstrongslstrong my understanding is that it is a digital representation of the renminbi but with centralized control theres no aspiration for decentralization in china as youd imagine they are using some of the same technology but with a different set of values theyre telling people theyre going to preserve privacybut in fact that will mean that only the central authority will have all the information about the transactions and whos making themppat the moment this digital currency is intended for domestic purposes but the chinese are creating the infrastructure needed to make it interoperable internationally i believe they will eventually want to export this capability to countries who either want it or are coerced into taking it in the long term its part of an overall strategy for them to create a payment system where the united states doesnt have the ability to control thingsppchina has been pushing back a lot against us sanctions authorities theyve passed laws that make it a crime to honor us or other country sanctions in china because they want to exert their own market power their efforts in digital currencies are part of a larger strategy to get out from under a us dominated financial system my worry is that we are not taking that risk seriously enoughppstrongffstrong apart from the blockchain based digital currencies theres talk about an alternative payment system that the chinese have been trying to set up now that the russians are being excluded from swift could you say a little bit about how extensive that is and whether it actually could become an adequate alternative to swiftppstrongslstrong swift is a messaging system and theoretically china and russia can set up their own messaging system but i think the alternative to swift that the chinese are looking into will only have limited effectiveness who would want to join such a system maybe iran and russia and a few others but thats not the party everyone wants to be invited toppmy worry is that digital currencies might enable the chinese to create a larger partya payment system where they can attract others by arguing that politics dont play a role countries such as india might want to join that in order to escape a payment system where the united states and a few other countries can decide who gets to play even the europeans will be somewhat open to that my view is that this would not be in the interest of us national security that it is critical that we maintain our ability to protect the integrity of the financial system we want to support technological innovation but not sacrifice our national securityppstrongffstrong to return to sanctions the iran sanctions were thorough and effective because of secondary sanctions but weve not really moved in that direction in the case of russia is it impossible to contemplate themppstrongslstrong it certainly will not be easy we had an even broader coalition regarding iran as well as several un security council resolutions to rely upon think about the countries that are still doing business with russia india mexico indonesia brazil turkey south africa argentina uae saudi arabiaand of course china that is a lot of countries for us to say that we will sanction entities within them that continue to do business with russia so secondary sanctions are somewhat more challenging though not impossible you start by suggesting reduced transactions in exchange for not imposing secondary sanctionsph3corruption and democracyh3pstrongslstrong id like to return to corruption for a second theres this notion that fighting corruption is an important part of promoting liberalism and the rule of law yet some of the most authoritarian regimes are very adept at using the tools of anticorruption as a way to consolidate their own power think about xi jinping when he came into power the first thing he did was to get rid of midlevel leaders some of whom were undoubtedly corrupt an even better example is mohammed bin salman in saudi arabia who went on an anticorruption campaign when he came to power this was really popular with young people in saudi arabia so mbs has consolidated his power not just through fear but also through popularity how do you deal with the fact that anticorruption drives can be used so effectively by the most authoritarian regimesppstrongffstrong this has been a pet peeve of minethe assumption that the cure for corruption is more democracy and transparency and accountability thats not true just as an empirical historical matter you can get effective and noncorrupt government under an authoritarian regime the great bureaucracies that developed in germany or japan or south korea or britain all started in predemocratic times put in place by authoritarian regimes that wanted effective government charles tilleys classical theory was that war is actually what produces good clean government because you cant afford to have your incompetent cousin bleeding off money or running your army so i dont think theres any necessary connection between good government and democracyppchina and singapore are the best poster children for that everyone would concede that theyre pretty good at doing what they do but theyre clearly not democratically accountable some of the worst cases of corruption are actually democracies in which politicians have to give out favors that includes the united states in the 19supthsup century where we had a patronage system that was fed directly by the need of politicians to get people into the polls and vote for themppchris carruthers wrote a book about xi jinpings anticorruption drive in china as well as campaigns in other authoritarian countries carruthers concluded that xi jinping actually did reduce corruption in china his methods were not democratic but they were still effective as similar drives were in other authoritarian countries so we have to get out of this mindset that democratic elections and transparency mean effective government and lower levels of corruption corruption and anticorruption can occur in any regime good governance and anticorruption are achieved independently of democracyph3who winsh3pstrongslstrong if putin wins thats a disaster if putin loses in ukraine maybe he loses power at home and that could be good for russia but theres so much in the middle thats not clear cut how should we be planning for that should we be planning for a longterm sanctions regime that will last for years what can our relationship with russia be if putin remains in power its hard to imagine that these sanctions would ever get lifted even if they did eventually its hard to imagine that the private sector going back into russia if putin is still in powerppstrongrastrong this raises the strategic question that i wanted to get to which is what the world is going to look like postukraineparticularly if russia and china become an alliance exercising not just economic but military powerppstrongffstrong if the war devolves into a stalemate that will be a russian victory if russia holds onto southern ukraine ukraine will be choked economically a nonviable country putin will be able to say hes accomplished his goals more and more people in this country but especially in europe will begin peeling off from the coalition saying we need a ceasefire henry kissinger made that case at davos recentlypdiv
span datapullquoteif the war devolves into a stalemate that will be a russian victory if russia holds onto southern ukraine ukraine will be choked economically a nonviable country putin will be able to say hes accomplished his goals francis fukuyamaspan
divpthat is not a good outcome in my view which is why i think that we should up the ante and continue to supply things like the multiple launch rocket systems the ukrainians really need to beat back the russians those might not be decisive weapons but i would certainly support supplying them because ukraine needs to drive the russians out of the south of their country if there are a lot of voices in the west calling for a ceasefire then the politics get complicated because as im sure stuart knows its really hard to get rid of sanctionsppwithout a very clear outcome one way or the other well be in for an extended period where were continuing sanctions and russia is not triumphant but also not defeated thats going to make the world quite messyppstrongslstrong lets assume that russias not definitively defeated so we dont lift sanctions but russia continues to try to cooperate with china this plays into the dynamic we were talking about earlier where countries want to set up a way to operate outside of us coercion if i were in the us government now i would be trying to make sure that that kind of alternative financial mechanism doesnt become broader than a chinarussia channel were not going to be able to stop china and russia from doing whatever they want together but how do we make sure that we dont end up with other countries joining them i would be working hard to ensure that india and our other asian partners are not tempted to become part of this the risk is that the important national security benefit we have from dominating the financial system could deteriorate over time i dont think we can afford to be too relaxed about this threatppstrongrastrong stuart you talked earlier about inflicting pain but the pain is not just what we inflict on russia russia inflicts pain on to begin with europe regarding energy and africa and elsewhere regarding food so which way is the pain going hereppstrongslstrong you make a good point russia has leverage at the moment with respect to gas in europe and weve seen they have leverage over food this is a rough game as appalling as it is but given the brutality they have displayed we cant be surprised that theyre using food as a weapon lets put it this way we certainly are not going to be able to shame them into stopping we have to continue to use whatever tools we have to counter themppstrongrastrong speaking of food im reminded of thomas friedmans remark of twentyfive years ago which now seems comic that countries that could support a chain of mcdonalds wouldnt go to war with each other mcdonalds has now pulled out of russia but it seems to me that russia holds the cards not mcdonalds that is we care more about russia supplying food and oil than russia cares about us supplying mcdonaldsppstrongslstrong western businesses abandonment of russia is going to be painful and not easily reversible a lot of very big companies that are leaving wont be returning anytime soon even if the russians wanted them to and thats going to have longterm implications for russia even post putin i think that hes really inflicted damage on his society thereppeven if the ukrainians decided they wanted to sign a treaty or an armistice with russia and we lifted sanctions the private sectors not going to be comfortable doing business with putins regime we could end up in the same situation we had with iran after the joint comprehensive plan of action which was somewhat comical to me we entered into the iran deal and we lifted sanctions on hundreds of iranian entities but western banks said they would not be doing business again with entities that had been sanctioned ten minutes earlier for terrorism and proliferation then we had john kerry flying to europe to try to talk european banks into doing business with iran and of course he didnt persuade anyone i dont see how the private sector is going to return to doing business with putin in the futureppstrongrastrong on the other hand we have corporations like google and apple and disney kowtowing to chinese demands could something like that evolve with russiappstrongffstrong its hard to see china has such a broad diversified big economy the western interest in russia apart from the energy sector is pretty minimal theres only one russian consumer product that i purchase regularly thats vacuum tubes because in high end audio some of the best amplifiers are still tube amplifiers and russia is one of the few countries that still manufacture vacuum tubes however thats not a large part of the global economyppstrongrastrong still russia does account for 20 percent of nickel and 20 percent of agricultural products its a bigger player than we imagine when thinking of it as having an economy the size of spain in terms of purchasing power parity russia is actually more like germany than spainppstrongslstrong for big western companies i think frank is right that they have a strategic need to access the chinese market if they want to continue to grow very few of them depend on the russian market there may be some natural resources that we need from russia that wed have to work through but for these big multinationals chinas a more important market and china has much more leverage over these companies than russia doesppemthis conversation took place in the summer of 2022 and references to world events will reflect this timeframeemppppa hrefhttpswwwamericanpurposecomauthorsfrancisfukuyamastrongemfrancis fukuyamaemstrongaem chairman of the editorial board of emamerican purposeem is olivier nomellini senior fellow and director of the ford dorsey masters in international policy program at stanford universitys freeman spogli institute for international studies his latest book is emliberalism and its discontentsem 2022emppema hrefhttpswwwamericanpurposecomauthorsrobertasahinastrongrobert asahinastronga an editorial board member of emamerican purposeem has been editorinchief of broadway books and vice president of simon amp schuster he is author of emjust americans how japanese americans won a war at home and abroadem one of the emwashington postsem best nonfiction books of 2006emppa hrefhttpswwwamericanpurposecomauthorsstuartleveystrongemstuart leveyemstrongastrongem emstrongemwas most recently ceo of the diem association he previously served as under secretary for terrorism and financial intelligence at the us treasury department in the george w bush and obama administrationsemppemimage flickr a hrefhttpswwwflickrcomphotosganeshsundaresan51337765123inphotolist2mdxszrgwwqkhgnfjed2n6bomxjvgv6mgwwpv82nydl2w28bkvcbgwwqirrtz74dtqzk1e93ux8zmxrljzp2neqg8kazx68fvnpljxruicpdmcznqz3ovs61mqssmf8uj89nnmngwwpozs4fovcmxternmxrmbzmxrdv6mxrap2mxtwdamxtpzomxrujtmxrcptmxrfgtmxtbydmxtnjymxrvqbmxrqgfmxtxrymxtpt3mxrddamxrbjronrrqj2erfdgbmxtbjhmxrtctmxryyv6dda3bol7calmxrbdtmxrcfpganeshsundaresanaemppppp
|
img altukraines ripples srchttpswwwamericanpurposecomcontentimages202208screenshot20220831at112052ampngpstrongrobert asahinastrong antony blinken told cnn january purpose sanctions deter aggression ironically point arguing emagainstem imposing sanctions russia putin invaded ukraine february successive rounds unprecedented sanctions united states eu failed deter russia stop wars escalation russia responded holding ukrainian exports hostage essentially weaponizing foodppso question sanctions accomplish long term theyve failed avowed purpose short term international order look like road sanctions embargoes boycotts geoeconomic tools effectively weapons war socalled neoliberalism past thirty yearswhich depends free movement people capital technology ideascome endppstrongstuart levey strongsanctions understood tactical strategic terms tactical clear financial tools important instrument national security treasury department 2004 2011 initially skepticism financial measures effective time weve learned wellpptheyre magic think unrealistic believe deterred putin invading ukraine nonetheless inflicted pain creating leverage diplomacy russia medium term important takeaways far biden administrations credit response decidedly multilateral united states allies wellestablished playbook roll sanctions financial measures efficiently effectively quickly exception ill come showed significant strength wide variety measuressanctioning banks individuals imposing import export restrictions restricting access society worldwide interbank financial telecommunication swift banning travelthat normally disconnected exercised concerted waybr___steady_paywall___branother thing thats fairly high level focused effort pursue corruption fighting corruption lot lip service paid agrees corruption bad un convention countries signed sorts greatsounding commitments general little happens significant time west gone oligarchs wealthy sustaining wealth supporting putin remains seen turn effort lasting onetime tactic targeting russia certainly united states united kingdom places theres reckoning wealth stashed societiespdiv span datapullquotewhile sanctions quick pretty effective theres gaping hole essentially allows russia continue sell oil gas bringing lots hard currency including europe stuart leveyspan divpthe point tactical exception referred sanctions quick pretty effective theres gaping hole sanctions imposed essentially allows russia continue sell oil gas bringing lots hard currency including europe things havent ways sanctions improved big problem mutes effectiveness overallppthe multilateral coalition exists imperfect lot countries havent joined coalition including course china india potential customers russian oil gas traditional gulf allies saudi arabia uae willing cooperate increasing production lowering price oil united states faces challenges making sanctions work tactical levelppstrongfrancis fukuyamastrong dont think people thought sanctions deter russia think calculation leading war russia anticipated hit sanctions protected building foreign currency reserves 600 billion prior war didnt anticipate central banks freezing lot assets clearly worried thought way anticipated sanctionsppstuart right big problem energy exports russia gets 700 million day payments oil gas ruble hasnt fallen thats russia continue fund war machine europe actually wean russian oil gas remains seen theyve making progress direction working group advising biden administration ukrainians exactly kinds sanctions necessary think pretty good plan ban imports impose tariffs imports russians dont capture big differential global price production costs allows europeans direction cutting russian oil gas gradual fashion start replacing sources elsewhereppother sanctions highly effective blocking technology exports lot russian military equipment depends actually western technology ukrainians shot russian military helicopter garmin gps system russian aviation uses boeing jetliners theyre cut spare parts time goes kinds blockages going start cutting deeply russian perception costs war theyve undertakenph3alternative payment systems digital currenciesh3pstrongslstrong agree cutting technology critical important whats worked question reserves raises broader questions rest worldparticularly chinawill watching sort sanctions russia look sanctions financial measures critical national security tools countries persuaded find way escape system united states inflict kind pain relatively unilaterally remember theres un security council resolution iran north korea coalition willing sanctions regimeppif youre china west cut russia access central bank reserves west talking confiscating reserves order pay reconstruction ukraine justified circumstances longterm implications chinese example react current norms financial system similarly saudis indians wondering happen themthat central bank reserves frozen confiscated actions possible current steps strong countries looking ways extricate system currently allows united states exercise coercive powerppi dont think united states percent confident rest western world matters europeans pretty skeptical unilateral power financial system times resentful flag potentially mediumterm strategic challenge united statesppstrongffstrong underlying issue position dollar worlds leading currency theres discussion alternatives dollar long remember nobodys moved direction central banks going confiscating dollar reserves held central banks held treasury thats big incentive start currencies dollarppthe advantages united states gets worlds currency enormous away running enormous budget deficits year year countries willing hold assets dollars theres broad away going raise interest rates domestically harder fund deficits whats alternative renminbi freely convertible euro problems japanese yen swiss franc relatively small players global markets prospects dollar losing supremacy worldppstrongslstrong 2005 new secretary treasury department instituted unilateral sanction got pretty strong lecture senior people unilateral sanctions undermine dollar worlds reserve currency date thats true youve seen whats happened intervening sixteen years weve continued act unilaterally dollar remained strongfor exactly reason said real alternative course hasnt happened doesnt mean wont dollar currently worlds safest currency maintains position variety reasons including overall strength economy rule law united states thats real leverage rests nowpdiv span datapullquoteright [the us] probably shape development payment system based digital currencies stand let chinese dominatethey ahead ustheres risk lose leverage stuart leveyspan divpone thing concerned possible develop alternative payment system blockchain digital cryptocurrencies creating opportunity value necessarily going dollars having clear transactions united states working group hoover chinese digital renminbi china working infrastructure payment system theres risk china want develop payment rails free domination therell lot countries willing eager free potential financial coercion policymaker united states right trying sure digital currencies develop maintain ability impose enforce sanctions right probably shape development payment system based digital currencies stand let chinese dominatethey ahead ustheres risk lose leverage critical payment system properly regulatedppstrongffstrong current meltdown cryptocurrency market indicate real dangers type completely unregulated form payment environmental reasons transaction costs crypto means payment store value youll use bitcoin pay gasoline pump use hold billion dollars reservesppstrongslstrong ways high transactional volume blockchains moment bitcoin cant look limitations bitcoin transactions digital stablecoins payment tokens right course witnessed collapse socalled algorithmic stablecoin wasnt backed imagine true stablecoina digital dollar backed real assets use token blockchain paymentsand potentially create alternative payment networkppstablecoins big right support massive volumes transacted theoretically fact aspiration projects crypto space contemplated central banks issuing digital tokens moved quickly blockchains fed considering possibility issuing digital dollar united states long time away private sector alternative digital currencies true stablecoins fill roleppif sort payment system develops blockchainbased rails united states able implement sanctions effectively way traditional financial system sanctions work traditional financial system intermediaries way know parties transactions scrutinize transactions whos counterparty whats purpose transaction sanctions work intermediaries real incentives careful purpose blockchain eliminate intermediaries transactions frictionless allowing parties transact revealing true identity ecosystem risk sanctions programs national securityppstrongffstrong anybody trust private issuer stablecoins wasnt heavily regulated government thats problem existing stablecoinsthey claimed adequate reserves didnt actually reveal existed government standing stablecoin people truly trust itppstrongslstrong position issuer private stablecoin trustworthy fed digital dollar issued fed trustworthy sufficient auditing transparency reserves private digital currency people trust audited reserve percent value issued plus capital buffer fdic insurance billions billions dollars stablecoins circulation people trusting themppstrongffstrong chinese actually trying create digital renminbi wouldnt mean losing control money supply parallel currency transactions kept separate renminbippstrongslstrong understanding digital representation renminbi centralized control theres aspiration decentralization china youd imagine technology different set values theyre telling people theyre going preserve privacybut fact mean central authority information transactions whos making themppat moment digital currency intended domestic purposes chinese creating infrastructure needed interoperable internationally believe eventually want export capability countries want coerced taking long term overall strategy create payment system united states doesnt ability control thingsppchina pushing lot sanctions authorities theyve passed laws crime honor country sanctions china want exert market power efforts digital currencies larger strategy dominated financial system worry taking risk seriously enoughppstrongffstrong apart blockchain based digital currencies theres talk alternative payment system chinese trying set russians excluded swift little bit extensive actually adequate alternative swiftppstrongslstrong swift messaging system theoretically china russia set messaging system think alternative swift chinese looking limited effectiveness want join system maybe iran russia thats party wants invited toppmy worry digital currencies enable chinese create larger partya payment system attract arguing politics dont play role countries india want join order escape payment system united states countries decide gets play europeans somewhat open view interest national security critical maintain ability protect integrity financial system want support technological innovation sacrifice national securityppstrongffstrong return sanctions iran sanctions thorough effective secondary sanctions weve moved direction case russia impossible contemplate themppstrongslstrong certainly easy broader coalition iran un security council resolutions rely think countries business russia india mexico indonesia brazil turkey south africa argentina uae saudi arabiaand course china lot countries sanction entities continue business russia secondary sanctions somewhat challenging impossible start suggesting reduced transactions exchange imposing secondary sanctionsph3corruption democracyh3pstrongslstrong id like return corruption second theres notion fighting corruption important promoting liberalism rule law authoritarian regimes adept tools anticorruption way consolidate power think xi jinping came power thing rid midlevel leaders undoubtedly corrupt better example mohammed bin salman saudi arabia went anticorruption campaign came power popular young people saudi arabia mbs consolidated power fear popularity deal fact anticorruption drives effectively authoritarian regimesppstrongffstrong pet peeve minethe assumption cure corruption democracy transparency accountability thats true empirical historical matter effective noncorrupt government authoritarian regime great bureaucracies developed germany japan south korea britain started predemocratic times place authoritarian regimes wanted effective government charles tilleys classical theory war actually produces good clean government cant afford incompetent cousin bleeding money running army dont think theres necessary connection good government democracyppchina singapore best poster children concede theyre pretty good theyre clearly democratically accountable worst cases corruption actually democracies politicians favors includes united states 19supthsup century patronage system fed directly need politicians people polls vote themppchris carruthers wrote book xi jinpings anticorruption drive china campaigns authoritarian countries carruthers concluded xi jinping actually reduce corruption china methods democratic effective similar drives authoritarian countries mindset democratic elections transparency mean effective government lower levels corruption corruption anticorruption occur regime good governance anticorruption achieved independently democracyph3who winsh3pstrongslstrong putin wins thats disaster putin loses ukraine maybe loses power home good russia theres middle thats clear cut planning planning longterm sanctions regime years relationship russia putin remains power hard imagine sanctions lifted eventually hard imagine private sector going russia putin powerppstrongrastrong raises strategic question wanted world going look like postukraineparticularly russia china alliance exercising economic military powerppstrongffstrong war devolves stalemate russian victory russia holds southern ukraine ukraine choked economically nonviable country putin able hes accomplished goals people country especially europe begin peeling coalition saying need ceasefire henry kissinger case davos recentlypdiv span datapullquoteif war devolves stalemate russian victory russia holds southern ukraine ukraine choked economically nonviable country putin able hes accomplished goals francis fukuyamaspan divpthat good outcome view think ante continue supply things like multiple launch rocket systems ukrainians need beat russians decisive weapons certainly support supplying ukraine needs drive russians south country lot voices west calling ceasefire politics complicated im sure stuart knows hard rid sanctionsppwithout clear outcome way extended period continuing sanctions russia triumphant defeated thats going world messyppstrongslstrong lets assume russias definitively defeated dont lift sanctions russia continues try cooperate china plays dynamic talking earlier countries want set way operate outside coercion government trying sure kind alternative financial mechanism doesnt broader chinarussia channel going able stop china russia want sure dont end countries joining working hard ensure india asian partners tempted risk important national security benefit dominating financial system deteriorate time dont think afford relaxed threatppstrongrastrong stuart talked earlier inflicting pain pain inflict russia russia inflicts pain begin europe energy africa food way pain going hereppstrongslstrong good point russia leverage moment respect gas europe weve seen leverage food rough game appalling given brutality displayed cant surprised theyre food weapon lets way certainly going able shame stopping continue use tools counter themppstrongrastrong speaking food im reminded thomas friedmans remark twentyfive years ago comic countries support chain mcdonalds wouldnt war mcdonalds pulled russia russia holds cards mcdonalds care russia supplying food oil russia cares supplying mcdonaldsppstrongslstrong western businesses abandonment russia going painful easily reversible lot big companies leaving wont returning anytime soon russians wanted thats going longterm implications russia post putin think hes inflicted damage society thereppeven ukrainians decided wanted sign treaty armistice russia lifted sanctions private sectors going comfortable business putins regime end situation iran joint comprehensive plan action somewhat comical entered iran deal lifted sanctions hundreds iranian entities western banks said business entities sanctioned minutes earlier terrorism proliferation john kerry flying europe try talk european banks business iran course didnt persuade dont private sector going return business putin futureppstrongrastrong hand corporations like google apple disney kowtowing chinese demands like evolve russiappstrongffstrong hard china broad diversified big economy western interest russia apart energy sector pretty minimal theres russian consumer product purchase regularly thats vacuum tubes high end audio best amplifiers tube amplifiers russia countries manufacture vacuum tubes thats large global economyppstrongrastrong russia account 20 percent nickel 20 percent agricultural products bigger player imagine thinking having economy size spain terms purchasing power parity russia actually like germany spainppstrongslstrong big western companies think frank right strategic need access chinese market want continue grow depend russian market natural resources need russia wed work big multinationals chinas important market china leverage companies russia doesppemthis conversation took place summer 2022 references world events reflect timeframeemppppa hrefhttpswwwamericanpurposecomauthorsfrancisfukuyamastrongemfrancis fukuyamaemstrongaem chairman editorial board emamerican purposeem olivier nomellini senior fellow director ford dorsey masters international policy program stanford universitys freeman spogli institute international studies latest book emliberalism discontentsem 2022emppema hrefhttpswwwamericanpurposecomauthorsrobertasahinastrongrobert asahinastronga editorial board member emamerican purposeem editorinchief broadway books vice president simon amp schuster author emjust americans japanese americans won war home abroadem emwashington postsem best nonfiction books 2006emppa hrefhttpswwwamericanpurposecomauthorsstuartleveystrongemstuart leveyemstrongastrongem emstrongemwas recently ceo diem association previously served secretary terrorism financial intelligence treasury department george w bush obama administrationsemppemimage flickr hrefhttpswwwflickrcomphotosganeshsundaresan51337765123inphotolist2mdxszrgwwqkhgnfjed2n6bomxjvgv6mgwwpv82nydl2w28bkvcbgwwqirrtz74dtqzk1e93ux8zmxrljzp2neqg8kazx68fvnpljxruicpdmcznqz3ovs61mqssmf8uj89nnmngwwpozs4fovcmxternmxrmbzmxrdv6mxrap2mxtwdamxtpzomxrujtmxrcptmxrfgtmxtbydmxtnjymxrvqbmxrqgfmxtxrymxtpt3mxrddamxrbjronrrqj2erfdgbmxtbjhmxrtctmxryyv6dda3bol7calmxrbdtmxrcfpganeshsundaresanaemppppp
|
631132d6d68fd583b1555a9f
|
Guardrails of Democracy, Extended: Comparing Notes On The Team Libertarian Report
|
div
picture
source sizesminwidth 600px 331px 100vw typeimagewebp srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202207guardrailsncc1pngwebp 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202207guardrailsncc11200x675pngwebp 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202207guardrailsncc1800x450pngwebp 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202207guardrailsncc1600x338pngwebp 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202207guardrailsncc1331x186pngwebp 331w
source sizesminwidth 600px 331px 100vw typeimagejpeg srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202207guardrailsncc1png 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202207guardrailsncc11200x675png 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202207guardrailsncc1800x450png 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202207guardrailsncc1600x338png 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202207guardrailsncc1331x186png 331w
img width1200 altguardrails ncc srchttpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202207guardrailsncc1800x450png height675
picture
div
pimg sizesmaxwidth 300px 100vw 300px srchttpsd2eehagpk5cl65cloudfrontnetimgq60uploads202207guardrailsncc1300x169png alt width300 srcsethttpsd2eehagpk5cl65cloudfrontnetimgq60uploads202207guardrailsncc1300x169png 300w httpsd2eehagpk5cl65cloudfrontnetimgq60uploads202207guardrailsncc11024x576png 1024w httpsd2eehagpk5cl65cloudfrontnetimgq60uploads202207guardrailsncc1768x432png 768w httpsd2eehagpk5cl65cloudfrontnetimgq60uploads202207guardrailsncc11536x863png 1536w httpsd2eehagpk5cl65cloudfrontnetimgq60uploads202207guardrailsncc11200x675png 1200w httpsd2eehagpk5cl65cloudfrontnetimgq60uploads202207guardrailsncc1800x450png 800w httpsd2eehagpk5cl65cloudfrontnetimgq60uploads202207guardrailsncc1600x338png 600w httpsd2eehagpk5cl65cloudfrontnetimgq60uploads202207guardrailsncc1331x186png 331w httpsd2eehagpk5cl65cloudfrontnetimgq60uploads202207guardrailsncc1png 1580w classwpimage8194233 height169p
pone of the fun conditions of this project is that the three teams did not in any way collaborate with each other or get an advance look at what the others were going to say as a result some recommendations overlap between teams in a positive way some conflict and many others simply dont engage one way or the other for example we at team libertarian reached very similar conclusions to team progressive on reforming the electoral count act but a mostly opposite conclusion as prof foley has a hrefhttpssecurewebciscocom19toas3h_2tdvatwkrpm9avyukh6k4pce97ikxhsp0tivtei1tha6dpmgqztzsnizct_yf30ekahhh90jbp9co3x47un2bcc4y2y8cejaooeheubmlvud9xoza0mjhuozau2t8lsgpmwlg_2iryfnqc0wsoygcsmfdx7s11wyucsli_0xuq6vglbxn0s5yl9ekgwp0ooqmmm3nr3o3gtnl3kgu4gypxvy5klm_zslq1refnh5enzfwsi0j2ltzjx7_dt3szpn1cj_7ucjmkobk5x2kml_7ktn0enjzm5xkb4oxiah7ofjvw9haopzke8arbszb7dzwlopz_2lnnkgkmebmdvquo6s2tpmkf0ciflvztkandv3l0ehbvhebm0k735tsjemujfibnpta6o4ccmrnmlw3n6afpvq_ie4qylcbj64uq70jiallhttps3a2f2felectionlawblogorg2f3fp3d130490noteda on whether government should seek to regulate false statements about elections and although team conservatives comments on restricting presidential emergency powers both dovetail with ours and add useful detail few of our other recommendations engagep
palthough we and team conservative may have marched off in different directions i and many cato institute colleagues are on board with much of what they say runaway administrative agencies usurping legislative power a hrefhttpsnam11safelinksprotectionoutlookcomurlhttps3a2f2fwwwcatoorg2fpolicyreport2fnovember2fdecember20162fwhenbureaucratsmakelawsdata057c017cisomin40gmuedu7c8911a8c879494bfded8908da8bba1ff17c9e857255df574c47a0c00546460380cb7c07c07c6379759292067735737cunknown7ctwfpbgzsb3d8eyjwijoimc4wljawmdailcjqijoiv2lumziilcjbtii6ik1hawwilcjxvci6mn03d7c30007c7c7csdatajyiotw4b2zzpyuxfv91oz86bdpujfzk1fefl2fh2flpa3dreserved0yes a big problema congressional abdication of power stretching over for a halfcentury or more shifting responsibility to the president and the judiciary a hrefhttpsnam11safelinksprotectionoutlookcomurlhttps3a2f2fwwwcatoorg2fcommentary2fcongresscomplicittrumpspowergrabdata057c017cisomin40gmuedu7c8911a8c879494bfded8908da8bba1ff17c9e857255df574c47a0c00546460380cb7c07c07c6379759292067735737cunknown7ctwfpbgzsb3d8eyjwijoimc4wljawmdailcjqijoiv2lumziilcjbtii6ik1hawwilcjxvci6mn03d7c30007c7c7csdatava3jicqethbsagpykbxmb4bm5njpj8kbbdhtngptkzs3dreserved0definitelya i agree too that theres a decent case for making it at least a bit easier to amend the us constitution heres a a hrefhttpsnam11safelinksprotectionoutlookcomurlhttps3a2f2fwwwcatoorg2fsites2fcatoorg2ffiles2farticles2flynchtennlawreviewv78n3pdfdata057c017cisomin40gmuedu7c8911a8c879494bfded8908da8bba1ff17c9e857255df574c47a0c00546460380cb7c07c07c6379759292067735737cunknown7ctwfpbgzsb3d8eyjwijoimc4wljawmdailcjqijoiv2lumziilcjbtii6ik1hawwilcjxvci6mn03d7c30007c7c7csdatahjro8x9tbw2boipoj2jyvmg9svwtl2rze2yqjcq2bfpag3dreserved0cato fellow writing in 2011a proposing a modest reduction in the threshold number of states needed for proposing and ratifying an amendment the need to move past a broken primary system in which candidates with independent and crossover appeal get knocked out because they cant appease their partys most zealous base voters a hrefhttpsnam11safelinksprotectionoutlookcomurlhttps3a2f2fwwwcatoorg2fevents2fpoliticsindustryhowpoliticalinnovationcanbreakpartisangridlocksaveourdemocracydata057c017cisomin40gmuedu7c8911a8c879494bfded8908da8bba1ff17c9e857255df574c47a0c00546460380cb7c07c07c6379759292067735737cunknown7ctwfpbgzsb3d8eyjwijoimc4wljawmdailcjqijoiv2lumziilcjbtii6ik1hawwilcjxvci6mn03d7c30007c7c7csdatalrjrxv82b20xg46qemhxucnojwhvp7sofwxtwo8jzwn03dreserved0right againap
pon the topic of elections were also in agreement with team conservatives observation that campaign finance reforms have backfired and that we should be repealing such laws rather than adding more but lets also get real the election world wasted much of 2021 in a battle over whether democrats would succeed in ramming through an omnibus package expanding these laws yet further as a hrefhttpsnam11safelinksprotectionoutlookcomurlhttps3a2f2fwwwcatoorg2fpolicyreport2fnovember2fdecember20212fdosdontsdefendingdemocracydata057c017cisomin40gmuedu7c8911a8c879494bfded8908da8bba1ff17c9e857255df574c47a0c00546460380cb7c07c07c6379759292067735737cunknown7ctwfpbgzsb3d8eyjwijoimc4wljawmdailcjqijoiv2lumziilcjbtii6ik1hawwilcjxvci6mn03d7c30007c7c7csdataaeklkdwqhpvg6uo7iqyk12rtfoyya2byt68wa6ylhfmi3dreserved0ive argueda this package the socalled for the people act 1 put its a hrefhttpsnam11safelinksprotectionoutlookcomurlhttps3a2f2fwwwcatoorg2fblog2fhr1overstuffedskinnydata057c017cisomin40gmuedu7c8911a8c879494bfded8908da8bba1ff17c9e857255df574c47a0c00546460380cb7c07c07c6379759292067735737cunknown7ctwfpbgzsb3d8eyjwijoimc4wljawmdailcjqijoiv2lumziilcjbtii6ik1hawwilcjxvci6mn03d7c30007c7c7csdataz3uy9dxbzc2fg36y10z3jlretjs4a2by03qtnnwhlbgzu3dreserved0thumb in the eyea of libertarian and a hrefhttpsnam11safelinksprotectionoutlookcomurlhttps3a2f2fwwwcatoorg2fcommentary2fpartlyconstitutionalisntenoughsenateshouldrejectpeopleactdata057c017cisomin40gmuedu7c8911a8c879494bfded8908da8bba1ff17c9e857255df574c47a0c00546460380cb7c07c07c6379759292067735737cunknown7ctwfpbgzsb3d8eyjwijoimc4wljawmdailcjqijoiv2lumziilcjbtii6ik1hawwilcjxvci6mn03d7c30007c7c7csdatau5dlhe3qfb9hmkql0jeo2bgwrrzcs2sojj62bilv2fg2f8a3dreserved0constitutionalista principle and 2 was supremely irrelevant to the distinctive challenges of the events leading up to jan 6 shouldnt we focus on reform efforts that have a chance of doing relevant good between now and the next grave election crisis down the road which we might find ourselves in the middle of by a date as early as say 2024p
pwhich brings me to some policy disagreements with team conservative i cant say im persuaded by the idea of letting congress override presidential vetoes by simple majority vote as tennessee does the founders meant to establish serious checks and balances against the dangers of hasty legislation and gutting the power of the presidents veto would knock out one of the most important of those checks for what its worth my home state of maryland sets its vetooverride threshold at threefifths rather than twothirds not that im recommending that either on bringing back the legislative veto i share the a hrefhttpsnam11safelinksprotectionoutlookcomurlhttps3a2f2fwwwaeiorg2farticles2fthelegislativevetoafalseremedyforsystemoverload2fdata057c017cisomin40gmuedu7c8911a8c879494bfded8908da8bba1ff17c9e857255df574c47a0c00546460380cb7c07c07c6379759292067735737cunknown7ctwfpbgzsb3d8eyjwijoimc4wljawmdailcjqijoiv2lumziilcjbtii6ik1hawwilcjxvci6mn03d7c30007c7c7csdatayshw2brydlwpozeqx2ddxryky0kdghgjrkxnp0m5efqi3dreserved0misgivings about that innovation expressed by antonin scaliaa then editor of emregulationem many years agop
pnow on to team progressive on one major point we agree strongly its incredibly dangerous when a controlling faction of one of the two great political parties wrongly contends that honest and correctly tabulated elections were stolen or rigged the progressive report gives this problem a central place in its analysis and that seems right to mep
pyet there are differences of mood and terminology in our approaches as well as i commented on twitter a hrefhttpsnam11safelinksprotectionoutlookcomurlhttps3a2f2ftwittercom2fwalterolson2fstatus2f1561527432821313537data057c017cisomin40gmuedu7c8911a8c879494bfded8908da8bba1ff17c9e857255df574c47a0c00546460380cb7c07c07c6379759292069298107cunknown7ctwfpbgzsb3d8eyjwijoimc4wljawmdailcjqijoiv2lumziilcjbtii6ik1hawwilcjxvci6mn03d7c30007c7c7csdatajegcr2bh41ircebreudsum2b89lcrzxz62bcqfjelwx1so3dreserved0the other daya i continue to search for phrases other than quotbig liequot and quotelection denierquot that would let us criticize both these things without using terminology associated with youknowwhat millions of persons sincerely believe the false claims in question they are truly convinced that they not we are doing the right thing and standing up for fair and free elections there are some genuine villains out there feeding them lies as well as crazies irresponsibly stoking mass delusion but the ordinary believers are also our friends our relatives and our neighbors we cannot stop being those things to them if america is to gather back its wits and turn back down the road toward some semblance of unityp
pas to policy im a convinced advocate of rankedchoice voting but id caution that its advantages are relatively subtle it wont put out the fire of public disbelief in election results the fact is that in some key states election fabulists may presently be popular enough to win or at least put up a strong contest under whichever set of rules is used i also think the plainvanilla version of rcv sometimes called instantrunoff voting is better suited to todays america than the more complex quotroundrobinquot variant that foley recommendsp
pwe and team progressive likely part company on some issues of federalism and decentralization ned foley and ilya somin have already a hrefhttpssecurewebciscocom19toas3h_2tdvatwkrpm9avyukh6k4pce97ikxhsp0tivtei1tha6dpmgqztzsnizct_yf30ekahhh90jbp9co3x47un2bcc4y2y8cejaooeheubmlvud9xoza0mjhuozau2t8lsgpmwlg_2iryfnqc0wsoygcsmfdx7s11wyucsli_0xuq6vglbxn0s5yl9ekgwp0ooqmmm3nr3o3gtnl3kgu4gypxvy5klm_zslq1refnh5enzfwsi0j2ltzjx7_dt3szpn1cj_7ucjmkobk5x2kml_7ktn0enjzm5xkb4oxiah7ofjvw9haopzke8arbszb7dzwlopz_2lnnkgkmebmdvquo6s2tpmkf0ciflvztkandv3l0ehbvhebm0k735tsjemujfibnpta6o4ccmrnmlw3n6afpvq_ie4qylcbj64uq70jiallhttps3a2f2felectionlawblogorg2f3fp3d130490discussed this a bita as to a hrefhttpssecurewebciscocom1dpv1_8d5um8croawtpqqv7pzcsqk7x73xaftxpnt3worlba7n0f4rkmgmts66pxis4uhfs60lz4urw2ol8s2arwzocldu7fxjvmerghplxp2js9h6nppfncao8ufuaxjnpofpjzlizajaiaexoc0rdapjir1ylp5otbgua_qh0mbaavbrt5qwgw82sehbqsm_irzy4d5rdkmzp4pfd3ky1hklchvsvknf1ecfwmrw4phq_ch1qwpmjac9blhulxjaewmbrgseamtnxnyibds5q15ustitoggfzgh4j1aemk8ca_i02hp9rfnvebm1a9dunvdo7yfv6esy4cwhthqk6vc62ecgy6crkmwyctfbwuad7kztf7il_8dxidqqk9iojroxoafoobmtx2wumsspkjbryd0nejtcndhjcsotugqxqrkmuxtwjs54xp_99https3a2f2freasoncom2fvolokh2f20222f072f082fmoreonthenationalconstitutioncenterrestoringtheguardrailsofdemocracyproject2ffoot votinga and i suspect that our teams may also diverge on to what extent the federal government should play a greater role in supervising the states in election administration we caution against this at several pointsp
palso on the foleysomin exchange linked above ill mention for what its worth that im probably a little more positive about civics education than ilya is still i do recognize there can be difficult problems in legitimately educating the public about how the electoral system works on the one hand while avoiding the specter of taxpayerfunded propaganda campaigns on the other as an example of the challenges involved a hrefhttpssecurewebciscocom137ae_lhvvo_xiaiuyjhaqtkw6_ke9ods2z1gigfjjgxmw6wlfdikszhigdejoykoowsllhdeu27c0tnbsblnqrikv0hhmaulvjlgljd2jhnsscmj3cu_c7v09uh2hvnv1e994w6vimlpcaw3siqot5mu63klafmwdkwd810ejv8ufwddqanadnx_lulruv6jpmibgwoummhk8c8prdaxz83uvdisxhd39t1ym0ntkth_5lwafdeqj0bawltn4ouarbjfn8o70m8ndzlemb0hmp0vhdmryawjduzybkygycr4bvlqqn4_v3gljhgo4tirkhx8jqsgsfhxkxaqfgeymuymcojuvixdohj8ag5n8mtkdyre3b1mwioahynerp788vwg2vssr7eo9e8gge1umbezwhng7jxvhuhgnhynnog0hhfcsbdczsk4chttps3a2f2fsosnebraskagov2fsites2fsosnebraskagov2ffiles2fdoc2ffake2520vs2520fact2520march25202022_0pdfheres howa the nebraska secretary of state set about refuting myths and rumors about the 2020 countp
pthanks to the national constitution center for making possible this summers exchange of views with writers and scholars we respect and to the volokh conspiracy for hosting this shorter symposium this weekp
pthe post a relnofollow hrefhttpsreasoncomvolokh20220901guardrailsofdemocracyextendedcomparingnotesontheteamlibertarianreportguardrails of democracy extended comparing notes on the team libertarian reporta appeared first on a relnofollow hrefhttpsreasoncomreasoncomap
|
div picture source sizesminwidth 600px 331px 100vw typeimagewebp srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202207guardrailsncc1pngwebp 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202207guardrailsncc11200x675pngwebp 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202207guardrailsncc1800x450pngwebp 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202207guardrailsncc1600x338pngwebp 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202207guardrailsncc1331x186pngwebp 331w source sizesminwidth 600px 331px 100vw typeimagejpeg srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202207guardrailsncc1png 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202207guardrailsncc11200x675png 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202207guardrailsncc1800x450png 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202207guardrailsncc1600x338png 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202207guardrailsncc1331x186png 331w img width1200 altguardrails ncc srchttpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202207guardrailsncc1800x450png height675 picture div pimg sizesmaxwidth 300px 100vw 300px srchttpsd2eehagpk5cl65cloudfrontnetimgq60uploads202207guardrailsncc1300x169png alt width300 srcsethttpsd2eehagpk5cl65cloudfrontnetimgq60uploads202207guardrailsncc1300x169png 300w httpsd2eehagpk5cl65cloudfrontnetimgq60uploads202207guardrailsncc11024x576png 1024w httpsd2eehagpk5cl65cloudfrontnetimgq60uploads202207guardrailsncc1768x432png 768w httpsd2eehagpk5cl65cloudfrontnetimgq60uploads202207guardrailsncc11536x863png 1536w httpsd2eehagpk5cl65cloudfrontnetimgq60uploads202207guardrailsncc11200x675png 1200w httpsd2eehagpk5cl65cloudfrontnetimgq60uploads202207guardrailsncc1800x450png 800w httpsd2eehagpk5cl65cloudfrontnetimgq60uploads202207guardrailsncc1600x338png 600w httpsd2eehagpk5cl65cloudfrontnetimgq60uploads202207guardrailsncc1331x186png 331w httpsd2eehagpk5cl65cloudfrontnetimgq60uploads202207guardrailsncc1png 1580w classwpimage8194233 height169p pone fun conditions project teams way collaborate advance look going result recommendations overlapbetween teamsin positive way conflict simply dont engage way example team libertarian reached similar conclusions team progressive reforming electoral count act opposite conclusion prof foley hrefhttpssecurewebciscocom19toas3h_2tdvatwkrpm9avyukh6k4pce97ikxhsp0tivtei1tha6dpmgqztzsnizct_yf30ekahhh90jbp9co3x47un2bcc4y2y8cejaooeheubmlvud9xoza0mjhuozau2t8lsgpmwlg_2iryfnqc0wsoygcsmfdx7s11wyucsli_0xuq6vglbxn0s5yl9ekgwp0ooqmmm3nr3o3gtnl3kgu4gypxvy5klm_zslq1refnh5enzfwsi0j2ltzjx7_dt3szpn1cj_7ucjmkobk5x2kml_7ktn0enjzm5xkb4oxiah7ofjvw9haopzke8arbszb7dzwlopz_2lnnkgkmebmdvquo6s2tpmkf0ciflvztkandv3l0ehbvhebm0k735tsjemujfibnpta6o4ccmrnmlw3n6afpvq_ie4qylcbj64uq70jiallhttps3a2f2felectionlawblogorg2f3fp3d130490noteda government seek regulate false statements elections team conservatives comments restricting presidential emergency powers dovetail add useful detail recommendations engagep palthough team conservative marched different directions cato institute colleagues board runaway administrative agencies usurping legislative power hrefhttpsnam11safelinksprotectionoutlookcomurlhttps3a2f2fwwwcatoorg2fpolicyreport2fnovember2fdecember20162fwhenbureaucratsmakelawsdata057c017cisomin40gmuedu7c8911a8c879494bfded8908da8bba1ff17c9e857255df574c47a0c00546460380cb7c07c07c6379759292067735737cunknown7ctwfpbgzsb3d8eyjwijoimc4wljawmdailcjqijoiv2lumziilcjbtii6ik1hawwilcjxvci6mn03d7c30007c7c7csdatajyiotw4b2zzpyuxfv91oz86bdpujfzk1fefl2fh2flpa3dreserved0yes big problema congressional abdication power stretching halfcentury shifting responsibility president judiciary hrefhttpsnam11safelinksprotectionoutlookcomurlhttps3a2f2fwwwcatoorg2fcommentary2fcongresscomplicittrumpspowergrabdata057c017cisomin40gmuedu7c8911a8c879494bfded8908da8bba1ff17c9e857255df574c47a0c00546460380cb7c07c07c6379759292067735737cunknown7ctwfpbgzsb3d8eyjwijoimc4wljawmdailcjqijoiv2lumziilcjbtii6ik1hawwilcjxvci6mn03d7c30007c7c7csdatava3jicqethbsagpykbxmb4bm5njpj8kbbdhtngptkzs3dreserved0definitelya agree theres decent case making bit easier amend constitution heres hrefhttpsnam11safelinksprotectionoutlookcomurlhttps3a2f2fwwwcatoorg2fsites2fcatoorg2ffiles2farticles2flynchtennlawreviewv78n3pdfdata057c017cisomin40gmuedu7c8911a8c879494bfded8908da8bba1ff17c9e857255df574c47a0c00546460380cb7c07c07c6379759292067735737cunknown7ctwfpbgzsb3d8eyjwijoimc4wljawmdailcjqijoiv2lumziilcjbtii6ik1hawwilcjxvci6mn03d7c30007c7c7csdatahjro8x9tbw2boipoj2jyvmg9svwtl2rze2yqjcq2bfpag3dreserved0cato fellow writing 2011a proposing modest reduction threshold number states needed proposing ratifying amendment need past broken primary system candidates independent crossover appeal knocked cant appease partys zealous base voters hrefhttpsnam11safelinksprotectionoutlookcomurlhttps3a2f2fwwwcatoorg2fevents2fpoliticsindustryhowpoliticalinnovationcanbreakpartisangridlocksaveourdemocracydata057c017cisomin40gmuedu7c8911a8c879494bfded8908da8bba1ff17c9e857255df574c47a0c00546460380cb7c07c07c6379759292067735737cunknown7ctwfpbgzsb3d8eyjwijoimc4wljawmdailcjqijoiv2lumziilcjbtii6ik1hawwilcjxvci6mn03d7c30007c7c7csdatalrjrxv82b20xg46qemhxucnojwhvp7sofwxtwo8jzwn03dreserved0right againap pon topic elections agreement team conservatives observation campaign finance reforms backfired repealing laws adding lets real election world wasted 2021 battle democrats succeed ramming omnibus package expanding laws hrefhttpsnam11safelinksprotectionoutlookcomurlhttps3a2f2fwwwcatoorg2fpolicyreport2fnovember2fdecember20212fdosdontsdefendingdemocracydata057c017cisomin40gmuedu7c8911a8c879494bfded8908da8bba1ff17c9e857255df574c47a0c00546460380cb7c07c07c6379759292067735737cunknown7ctwfpbgzsb3d8eyjwijoimc4wljawmdailcjqijoiv2lumziilcjbtii6ik1hawwilcjxvci6mn03d7c30007c7c7csdataaeklkdwqhpvg6uo7iqyk12rtfoyya2byt68wa6ylhfmi3dreserved0ive argueda package socalled people act 1 hrefhttpsnam11safelinksprotectionoutlookcomurlhttps3a2f2fwwwcatoorg2fblog2fhr1overstuffedskinnydata057c017cisomin40gmuedu7c8911a8c879494bfded8908da8bba1ff17c9e857255df574c47a0c00546460380cb7c07c07c6379759292067735737cunknown7ctwfpbgzsb3d8eyjwijoimc4wljawmdailcjqijoiv2lumziilcjbtii6ik1hawwilcjxvci6mn03d7c30007c7c7csdataz3uy9dxbzc2fg36y10z3jlretjs4a2by03qtnnwhlbgzu3dreserved0thumb eyea libertarian hrefhttpsnam11safelinksprotectionoutlookcomurlhttps3a2f2fwwwcatoorg2fcommentary2fpartlyconstitutionalisntenoughsenateshouldrejectpeopleactdata057c017cisomin40gmuedu7c8911a8c879494bfded8908da8bba1ff17c9e857255df574c47a0c00546460380cb7c07c07c6379759292067735737cunknown7ctwfpbgzsb3d8eyjwijoimc4wljawmdailcjqijoiv2lumziilcjbtii6ik1hawwilcjxvci6mn03d7c30007c7c7csdatau5dlhe3qfb9hmkql0jeo2bgwrrzcs2sojj62bilv2fg2f8a3dreserved0constitutionalista principle 2 supremely irrelevant distinctive challenges events leading jan 6 shouldnt focus reform efforts chance relevant good grave election crisis road find middle date early 2024p pwhich brings policy disagreements team conservative cant im persuaded idea letting congress override presidential vetoes simple majority vote tennessee founders meant establish checks balances dangers hasty legislation gutting power presidents veto knock important checks worth home state maryland sets vetooverride threshold threefifths twothirds im recommending bringing legislative veto share hrefhttpsnam11safelinksprotectionoutlookcomurlhttps3a2f2fwwwaeiorg2farticles2fthelegislativevetoafalseremedyforsystemoverload2fdata057c017cisomin40gmuedu7c8911a8c879494bfded8908da8bba1ff17c9e857255df574c47a0c00546460380cb7c07c07c6379759292067735737cunknown7ctwfpbgzsb3d8eyjwijoimc4wljawmdailcjqijoiv2lumziilcjbtii6ik1hawwilcjxvci6mn03d7c30007c7c7csdatayshw2brydlwpozeqx2ddxryky0kdghgjrkxnp0m5efqi3dreserved0misgivings innovation expressed antonin scaliaa editor emregulationem years agop pnow team progressive major point agree strongly incredibly dangerous controlling faction great political parties wrongly contends honest correctly tabulated elections stolen rigged progressive report gives problem central place analysis right mep pyet differences mood terminology approaches commented twitter hrefhttpsnam11safelinksprotectionoutlookcomurlhttps3a2f2ftwittercom2fwalterolson2fstatus2f1561527432821313537data057c017cisomin40gmuedu7c8911a8c879494bfded8908da8bba1ff17c9e857255df574c47a0c00546460380cb7c07c07c6379759292069298107cunknown7ctwfpbgzsb3d8eyjwijoimc4wljawmdailcjqijoiv2lumziilcjbtii6ik1hawwilcjxvci6mn03d7c30007c7c7csdatajegcr2bh41ircebreudsum2b89lcrzxz62bcqfjelwx1so3dreserved0the daya continue search phrases quotbig liequot quotelection denierquot let criticize things terminology associated youknowwhat millions persons sincerely believe false claims question truly convinced right thing standing fair free elections genuine villains feeding lies crazies irresponsibly stoking mass delusion ordinary believers friends relatives neighbors stop things america gather wits turn road semblance unityp pas policy im convinced advocate rankedchoice voting id caution advantages relatively subtle wont fire public disbelief election results fact key states election fabulists presently popular win strong contest whichever set rules think plainvanilla version rcv called instantrunoff voting better suited todays america complex quotroundrobinquot variant foley recommendsp pwe team progressive likely company issues federalism decentralization ned foley ilya somin hrefhttpssecurewebciscocom19toas3h_2tdvatwkrpm9avyukh6k4pce97ikxhsp0tivtei1tha6dpmgqztzsnizct_yf30ekahhh90jbp9co3x47un2bcc4y2y8cejaooeheubmlvud9xoza0mjhuozau2t8lsgpmwlg_2iryfnqc0wsoygcsmfdx7s11wyucsli_0xuq6vglbxn0s5yl9ekgwp0ooqmmm3nr3o3gtnl3kgu4gypxvy5klm_zslq1refnh5enzfwsi0j2ltzjx7_dt3szpn1cj_7ucjmkobk5x2kml_7ktn0enjzm5xkb4oxiah7ofjvw9haopzke8arbszb7dzwlopz_2lnnkgkmebmdvquo6s2tpmkf0ciflvztkandv3l0ehbvhebm0k735tsjemujfibnpta6o4ccmrnmlw3n6afpvq_ie4qylcbj64uq70jiallhttps3a2f2felectionlawblogorg2f3fp3d130490discussed bita hrefhttpssecurewebciscocom1dpv1_8d5um8croawtpqqv7pzcsqk7x73xaftxpnt3worlba7n0f4rkmgmts66pxis4uhfs60lz4urw2ol8s2arwzocldu7fxjvmerghplxp2js9h6nppfncao8ufuaxjnpofpjzlizajaiaexoc0rdapjir1ylp5otbgua_qh0mbaavbrt5qwgw82sehbqsm_irzy4d5rdkmzp4pfd3ky1hklchvsvknf1ecfwmrw4phq_ch1qwpmjac9blhulxjaewmbrgseamtnxnyibds5q15ustitoggfzgh4j1aemk8ca_i02hp9rfnvebm1a9dunvdo7yfv6esy4cwhthqk6vc62ecgy6crkmwyctfbwuad7kztf7il_8dxidqqk9iojroxoafoobmtx2wumsspkjbryd0nejtcndhjcsotugqxqrkmuxtwjs54xp_99https3a2f2freasoncom2fvolokh2f20222f072f082fmoreonthenationalconstitutioncenterrestoringtheguardrailsofdemocracyproject2ffoot votinga suspect teams diverge extent federal government play greater role supervising states election administration caution pointsp palso foleysomin exchange linked ill mention worth im probably little positive civics education ilya recognize difficult problems legitimately educating public electoral system works hand avoiding specter taxpayerfunded propaganda campaignson example challenges involved hrefhttpssecurewebciscocom137ae_lhvvo_xiaiuyjhaqtkw6_ke9ods2z1gigfjjgxmw6wlfdikszhigdejoykoowsllhdeu27c0tnbsblnqrikv0hhmaulvjlgljd2jhnsscmj3cu_c7v09uh2hvnv1e994w6vimlpcaw3siqot5mu63klafmwdkwd810ejv8ufwddqanadnx_lulruv6jpmibgwoummhk8c8prdaxz83uvdisxhd39t1ym0ntkth_5lwafdeqj0bawltn4ouarbjfn8o70m8ndzlemb0hmp0vhdmryawjduzybkygycr4bvlqqn4_v3gljhgo4tirkhx8jqsgsfhxkxaqfgeymuymcojuvixdohj8ag5n8mtkdyre3b1mwioahynerp788vwg2vssr7eo9e8gge1umbezwhng7jxvhuhgnhynnog0hhfcsbdczsk4chttps3a2f2fsosnebraskagov2fsites2fsosnebraskagov2ffiles2fdoc2ffake2520vs2520fact2520march25202022_0pdfheres howa nebraska secretary state set refuting myths rumors 2020 countp pthanks national constitution center making possible summers exchange views writers scholars respect volokh conspiracy hosting shorter symposium weekp pthe post relnofollow hrefhttpsreasoncomvolokh20220901guardrailsofdemocracyextendedcomparingnotesontheteamlibertarianreportguardrails democracy extended comparing notes team libertarian reporta appeared relnofollow hrefhttpsreasoncomreasoncomap
|
631132d8d68fd583b1555aa1
|
Virginia Can't Force Bookstores To Card Kids for Books on Gender and Sexuality
|
div
picture
source sizesminwidth 600px 331px 100vw typeimagewebp srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202209judgebookbanjpgwebp 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202209judgebookban1200x675jpgwebp 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202209judgebookban800x450jpgwebp 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202209judgebookban600x338jpgwebp 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202209judgebookban331x186jpgwebp 331w
source sizesminwidth 600px 331px 100vw typeimagejpeg srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202209judgebookbanjpg 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202209judgebookban1200x675jpg 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202209judgebookban800x450jpg 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202209judgebookban600x338jpg 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202209judgebookban331x186jpg 331w
img width1200 altvirginia book ban effort thwarted by judge srchttpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202209judgebookban800x450jpg height675
picture
div
pspanon tuesday a virginia beach court dealt a serious blow to wouldbe bookbanners who were trying to restrict private bookstores from selling two books to minorsspanp
pspantheir lawsuit spana hrefhttpswwwacluorglegaldocumentpetitionersomnibusreplyoppositionrespondentsmotionsspantargetedspana ispangender queerspanispan by maia kobabe and spanispana court of mist and furyspanispan by sarah j maas spanispangender queer spanispanhas been at the spana hrefhttpswwwnytimescom20220831usvirginiaobscenitybookbanhtmlspancenterspanaspan of many bookbanning battles for its graphic sexual scenes particularly its visual illustrations of oral sex the petitioners spana hrefhttpswwwacluorglegaldocumentpetitionersomnibusreplyoppositionrespondentsmotionsspanarguedspanaspan that spanispana court of mist and furyspanispan is quotsexually offensive in naturequot for its illustrations of sexual acts and descriptions of quotabusive and intrusive sexual contactquot circuit judge pamela s baskervill who spana hrefhttpswwwwashingtonpostcomeducation20220830barnesandnoblevirginiabookbanspancame outspanaspan of retirement to try the case since all other judges recused themselves dismissed the suit on free speech and due process groundsspanp
pspanin may former congressional candidate tommy altman and state del tim anderson rvirginia beach his legal counsel spana hrefhttpswwwnytimescom20220831usvirginiaobscenitybookbanhtmlspanfiledspanaspan two petitions under virginias obscenity law to have the books spanspandeemed obscene for minors they spana hrefhttpswwwacluorglegaldocumentpetitionersomnibusreplyoppositionrespondentsmotionsspanattemptedspanaspan to require booksellers to obtain parental consent before selling those books to minorsspanp
pspanvirginia residents may spana hrefhttpslawlisvirginiagovvacodetitle182chapter8section182384textc2a7201822d384book20alleged20to20be20obscenespanfilespanaspan an obscenity petition when they believe someone quotis engaged in the sale or commercial distribution of any obscene bookquot an obscenity petition may spana hrefhttpslawlisvirginiagovvacodetitle182chapter8section182384textc2a7201822d384book20alleged20to20be20obscenespanresultspanaspan in the court issuing quota temporary restraining order against the sale or distributionquot of the book in question which then assumes knowledge of the restriction among those who distribute the title even before a full trial has taken placespanp
pspanin virginia spanispanobscenityspanispan a hrefhttpsreasoncomwpcontentuploads2022090257_001pdfinvolvesa quota shameful or morbid interest in nudity sexual conduct sexual excitement excretory functions or products thereof or sadomasochistic abusequot as its quotdominant theme or purposequot spanp
pspanquottaken as a wholequot a book must also a hrefhttpsreasoncomwpcontentuploads2022090257_001pdflacka quotserious literary artistic political or scientific valuequot to be considered obscenespanp
pspanaltman and anderson specifically spana hrefhttpsreasoncomwpcontentuploads202205inregenderqueerpdfspansoughtspanaspan to keep minors from purchasing spanispangender queer spanispanand spanispana court of mist and fury spanispanfrom barnes amp noble and independent a hrefhttpswwwnytimescom20220831usvirginiaobscenitybookbanhtmlsellersa barnes amp noble filed a brief supporting motion to dismiss the petitions a hrefhttpsreasoncomwpcontentuploads2022090257_001pdfnotinga that they fell quotwoefully short of the constitutional standards governing obscenityquotspanp
pspanfor one even though the petitions a hrefhttpsreasoncomwpcontentuploads2022090257_001pdfallegea the books have quotno serious literary artistic political or scientific value to minorsquot this is a conflation of quottwo statutes that employ different legal standardsquot though virginians may file petitions under the obscenity spana hrefhttpslawlisvirginiagovvacodetitle182chapter8section182384textc2a7201822d384book20alleged20to20be20obscenespanclausespanaspan nothing in that clause specifically names or applies to minors thus barnes amp noble a hrefhttpsreasoncomwpcontentuploads2022090257_001pdfargueda that the books could not be considered quotobscene onlyto juvenilesquotspanp
pspannor did the petitioners make an effective case that the books meet the emgeneralem standards for obscenity barnes amp nobles brief a hrefhttpsreasoncomwpcontentuploads2022090257_001pdfpoints outa that the petitions single out only small portions of the books spanspanas inappropriate for minors a hrefhttpsreasoncomwpcontentuploads2022090257_001pdfdefyinga the established standard to consider material quotas a wholequot in order to deem it obscenespanp
pspanthe petitions quotignore the language of the virginia statutes under which they were filed and assume that developments in first amendment law over the past sixtyfive years never occurredquot a hrefhttpsreasoncomwpcontentuploads2022090257_001pdfnotesa barnes amp nobles briefspanp
pspanbaskervill didnt actually determine whether the books were obscene for minors but she a hrefhttpsreasoncomwpcontentuploads202209cl221984_finalorder_signedpdfdida a hrefhttpsreasoncomwpcontentuploads202209cl221985_finalorder_signedpdffinda that the petitioners didnt quotallege facts sufficient to supportquot a general obscenity finding moreover baskervill a hrefhttpsreasoncomwpcontentuploads202209cl221985_finalorder_signedpdffounda that the virginia codes obscenity spana hrefhttpslawlisvirginiagovvacodetitle182chapter8section182384textc2a7201822d384book20alleged20to20be20obscenespanstatutespanaspan quotis unconstitutional on its facequot it quotauthorizes a prior restraint that violates the first amendment and the constitution of virginiaquot she wrote and quotviolates due process by authorizing judgment without notice to affected partiesquotspanp
pspanin some ways this case was an unprecedented extension of the modern culture wars a hrefhttpsreasoncomissueaugustseptember2022book fronta since 1973 the supreme court quothas accepted no cases involving literary obscenity nor has it found any book to be obscenequot a hrefhttpsreasoncomwpcontentuploads2022090257_001pdfnotesa barnes amp nobles brief spanspanthe virginia beach petitions also represent an unusual strategy by attempting to harness a littleused section of state law to block the distribution of certain books to minors they were attempts quotto manufacture jurisdictionquot by quotmashing togetherquot unrelated statutes according to the barnes amp noble a hrefhttpsreasoncomwpcontentuploads2022090257_001pdfbriefaspanp
pspanbut this case was especially notableand concerningsince the petitioners attempted to target private book distributors under a spanispancriminalspanispan statute rather than just affecting public schools where many book battles a hrefhttpsreasoncom20220709thedangerouslessonofbookbansinpublicschoollibrariestake placea these petitions aimed to limit activities in the private sphere regardless of what one thinks about the literary value of these two books or the age level for which theyre appropriate these circumstances alone are deeply troublingspanp
pthe post a relnofollow hrefhttpsreasoncom20220901virginiacantforcebookstorestocardkidsforbooksongenderandsexualityvirginia cant force bookstores to card kids for books on gender and sexualitya appeared first on a relnofollow hrefhttpsreasoncomreasoncomap
|
div picture source sizesminwidth 600px 331px 100vw typeimagewebp srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202209judgebookbanjpgwebp 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202209judgebookban1200x675jpgwebp 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202209judgebookban800x450jpgwebp 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202209judgebookban600x338jpgwebp 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202209judgebookban331x186jpgwebp 331w source sizesminwidth 600px 331px 100vw typeimagejpeg srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202209judgebookbanjpg 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202209judgebookban1200x675jpg 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202209judgebookban800x450jpg 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202209judgebookban600x338jpg 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202209judgebookban331x186jpg 331w img width1200 altvirginia book ban effort thwarted judge srchttpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202209judgebookban800x450jpg height675 picture div pspanon tuesday virginia beach court dealt blow wouldbe bookbanners trying restrict private bookstores selling books minorsspanp pspantheir lawsuit spana hrefhttpswwwacluorglegaldocumentpetitionersomnibusreplyoppositionrespondentsmotionsspantargetedspana ispangender queerspanispan maia kobabe spanispana court mist furyspanispan sarah j maas spanispangender queer spanispanhas spana hrefhttpswwwnytimescom20220831usvirginiaobscenitybookbanhtmlspancenterspanaspan bookbanning battles graphic sexual scenes particularly visual illustrations oral sex petitioners spana hrefhttpswwwacluorglegaldocumentpetitionersomnibusreplyoppositionrespondentsmotionsspanarguedspanaspan spanispana court mist furyspanispan quotsexually offensive naturequot illustrations sexual acts descriptions quotabusive intrusive sexual contactquot circuit judge pamela s baskervill spana hrefhttpswwwwashingtonpostcomeducation20220830barnesandnoblevirginiabookbanspancame outspanaspan retirement try case judges recused dismissed suit free speech process groundsspanp pspanin congressional candidate tommy altman state del tim anderson rvirginia beach legal counsel spana hrefhttpswwwnytimescom20220831usvirginiaobscenitybookbanhtmlspanfiledspanaspan petitions virginias obscenity law books spanspandeemed obscene minors spana hrefhttpswwwacluorglegaldocumentpetitionersomnibusreplyoppositionrespondentsmotionsspanattemptedspanaspan require booksellers obtain parental consent selling books minorsspanp pspanvirginia residents spana hrefhttpslawlisvirginiagovvacodetitle182chapter8section182384textc2a7201822d384book20alleged20to20be20obscenespanfilespanaspan obscenity petition believe quotis engaged sale commercial distribution obscene bookquot obscenity petition spana hrefhttpslawlisvirginiagovvacodetitle182chapter8section182384textc2a7201822d384book20alleged20to20be20obscenespanresultspanaspan court issuing quota temporary restraining order sale distributionquot book question assumes knowledge restriction distribute title trial taken placespanp pspanin virginia spanispanobscenityspanispan hrefhttpsreasoncomwpcontentuploads2022090257_001pdfinvolvesa quota shameful morbid interest nudity sexual conduct sexual excitement excretory functions products thereof sadomasochistic abusequot quotdominant theme purposequot spanp pspanquottaken wholequot book hrefhttpsreasoncomwpcontentuploads2022090257_001pdflacka quotserious literary artistic political scientific valuequot considered obscenespanp pspanaltman anderson specifically spana hrefhttpsreasoncomwpcontentuploads202205inregenderqueerpdfspansoughtspanaspan minors purchasing spanispangender queer spanispanand spanispana court mist fury spanispanfrom barnes amp noble independent hrefhttpswwwnytimescom20220831usvirginiaobscenitybookbanhtmlsellersa barnes amp noble filed brief supporting motion dismiss petitions hrefhttpsreasoncomwpcontentuploads2022090257_001pdfnotinga fell quotwoefully short constitutional standards governing obscenityquotspanp pspanfor petitions hrefhttpsreasoncomwpcontentuploads2022090257_001pdfallegea books quotno literary artistic political scientific value minorsquot conflation quottwo statutes employ different legal standardsquot virginians file petitions obscenity spana hrefhttpslawlisvirginiagovvacodetitle182chapter8section182384textc2a7201822d384book20alleged20to20be20obscenespanclausespanaspan clause specifically names applies minors barnes amp noble hrefhttpsreasoncomwpcontentuploads2022090257_001pdfargueda books considered quotobscene onlyto juvenilesquotspanp pspannor petitioners effective case books meet emgeneralem standards obscenity barnes amp nobles brief hrefhttpsreasoncomwpcontentuploads2022090257_001pdfpoints outa petitions single small portions books spanspanas inappropriate minors hrefhttpsreasoncomwpcontentuploads2022090257_001pdfdefyinga established standard consider material quotas wholequot order deem obscenespanp pspanthe petitions quotignore language virginia statutes filed assume developments amendment law past sixtyfive years occurredquot hrefhttpsreasoncomwpcontentuploads2022090257_001pdfnotesa barnes amp nobles briefspanp pspanbaskervill didnt actually determine books obscene minors hrefhttpsreasoncomwpcontentuploads202209cl221984_finalorder_signedpdfdida hrefhttpsreasoncomwpcontentuploads202209cl221985_finalorder_signedpdffinda petitioners didnt quotallege facts sufficient supportquot general obscenity finding baskervill hrefhttpsreasoncomwpcontentuploads202209cl221985_finalorder_signedpdffounda virginia codes obscenity spana hrefhttpslawlisvirginiagovvacodetitle182chapter8section182384textc2a7201822d384book20alleged20to20be20obscenespanstatutespanaspan quotis unconstitutional facequot quotauthorizes prior restraint violates amendment constitution virginiaquot wrote quotviolates process authorizing judgment notice affected partiesquotspanp pspanin ways case unprecedented extension modern culture wars hrefhttpsreasoncomissueaugustseptember2022book fronta 1973 supreme court quothas accepted cases involving literary obscenity found book obscenequot hrefhttpsreasoncomwpcontentuploads2022090257_001pdfnotesa barnes amp nobles brief spanspanthe virginia beach petitions represent unusual strategy attempting harness littleused section state law block distribution certain books minors attempts quotto manufacture jurisdictionquot quotmashing togetherquot unrelated statutes according barnes amp noble hrefhttpsreasoncomwpcontentuploads2022090257_001pdfbriefaspanp pspanbut case especially notableand concerningsince petitioners attempted target private book distributors spanispancriminalspanispan statute affecting public schools book battles hrefhttpsreasoncom20220709thedangerouslessonofbookbansinpublicschoollibrariestake placea petitions aimed limit activities private sphere regardless thinks literary value books age level theyre appropriate circumstances deeply troublingspanp pthe post relnofollow hrefhttpsreasoncom20220901virginiacantforcebookstorestocardkidsforbooksongenderandsexualityvirginia cant force bookstores card kids books gender sexualitya appeared relnofollow hrefhttpsreasoncomreasoncomap
|
631132dad68fd583b1555aa3
|
The Biden Administration Is Taking From the Poor and Giving to the Rich
|
div
picture
source sizesminwidth 600px 331px 100vw typeimagewebp srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202209laptopclassbidensubsidiesjpgwebp 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202209laptopclassbidensubsidies1200x675jpgwebp 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202209laptopclassbidensubsidies800x450jpgwebp 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202209laptopclassbidensubsidies600x338jpgwebp 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202209laptopclassbidensubsidies331x186jpgwebp 331w
source sizesminwidth 600px 331px 100vw typeimagejpeg srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202209laptopclassbidensubsidiesjpg 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202209laptopclassbidensubsidies1200x675jpg 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202209laptopclassbidensubsidies800x450jpg 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202209laptopclassbidensubsidies600x338jpg 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202209laptopclassbidensubsidies331x186jpg 331w
img width1200 altbright green money with someone on a laptop in the middle on a bright red background srchttpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202209laptopclassbidensubsidies800x450jpg height675
picture
div
pif you had any doubts that those in power have dropped the pretense of fighting for the working class you can dispense with them after president joe biden administrations latest concessions to the laptop class from student loan forgiveness to subsidies for people who drive pricey electric cars and profitable semiconductor company ceos this administration is working hard to shower its friends with handouts paid for by hardworking lowerwage americansp
pwe learned of the most outrageous handout of them all of course when biden announced that he willunilaterally mind you and for no apparent reason that i can seeextend the pause on student loan payments until the end of the year and forgive up to 10000 for those persons making less than 125000 a year this generosity with other peoples money extends up to 20000 for pell grant recipientsp
pas david stockman a former director of the congressional office of management and budget reported recently quotonly 37 of americans have a 4year college degree only 13 have graduate degrees and just 3 have a phd or similar professional degree yet a full 56 of student loan debt is held by people who went to grad school and 20 is owed by the tiny 3 sliver with phdsquotp
ppicture two young married lawyers who together earn just under 250000 and are on their way to making even more money in the future they will be able to collect from uncle joe a nice bonus of 40000 taken from the pockets of the many people who didnt go to collegeperhaps because they did not want to take on debtand from those who have responsibly already paid back their debtp
pits no wonder that so many leftleaning economists and policy wonks have loudly criticized this socalled student loan forgiveness emthe washington postem for instance editorialized that the decision is quotregressivequot quotexpensivequot and quotlikely inflationaryquot nullifying quotnearly a decades worth of deficit reduction from the inflation reduction actquotp
pmeanwhile jason furman who headed former president barack obamas council of economic advisers napalmed the plan in a brutal twitter thread he explained that thanks to bidens move interest rates would have to rise by an additional 50 to 75 basis points to counteract the added inflationary effect furman made clear that he regards this outcome as remarkably unfair and regressivep
pthen theres the inflation reduction acts gusher of green subsidies many of which disproportionately benefit wealthier americans take the extension of the tax credit of up to 7500 for the purchase of new electric vehicles for those buying used evs the tax credit is now 4000 little consolation for people who cant afford the luxury of buying electric cars which remain much pricier than their gasolinepowered alternatives the bill hopes to address this issue by making expensive ev cars ineligible for the credit but it counteracts this provision with a requirement that only cars assembled in the united states are eligiblep
pto underscore how disconnected policymakers are from average americans the vehicle credits are limited to those making less than 150000 annually single filing and 300000 joint filing presumably to avoid criticism for subsidizing the rich that still leaves about 93 percent of individuals or 97 percent of households able to seize the subsidy and given that its mainly been taxpayers with annual incomes over 100000 using the credit in the past this subsidy will mostly still serve a swath of fairly welloff peoplep
pbut politicians are not just showering higherincome individuals with subsidies they do the same for companies a quick look at the semiconductor subsidies in the chips act reveals that the wellpublicized 52 billion giveaway will benefit wellconnected and rich companiesp
pwe could go on and on with more examples such as democrats incessant demand to restore remarkably regressive state and local tax quotsaltquot deductions to their pre2017 heights the only persons who will gain are highincome earnersand their bigspending elected officialsin hightax blue states they lost parts of these deductions when the trump tax cuts were implemented and they want them backp
pif youre surprised by any of this you havent been paying attention to democrats recent record few are even pretending to be the party of anyone other than the privileged laptop classp
pstrongcopyright 2022 a relnoopener noreferrer hrefhttpcreatorscom datasaferedirecturlhttpswwwgooglecomurlqhttpcreatorscomampsourcegmailampust1662081311184000ampusgaovvaw2c7giw9nrahbtgmydjk12t target_blankcreatorscomastrongp
pthe post a relnofollow hrefhttpsreasoncom20220901thebidenadministrationistakingfromthepoorandgivingtotherichthe biden administration is taking from the poor and giving to the richa appeared first on a relnofollow hrefhttpsreasoncomreasoncomap
|
div picture source sizesminwidth 600px 331px 100vw typeimagewebp srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202209laptopclassbidensubsidiesjpgwebp 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202209laptopclassbidensubsidies1200x675jpgwebp 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202209laptopclassbidensubsidies800x450jpgwebp 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202209laptopclassbidensubsidies600x338jpgwebp 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202209laptopclassbidensubsidies331x186jpgwebp 331w source sizesminwidth 600px 331px 100vw typeimagejpeg srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202209laptopclassbidensubsidiesjpg 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202209laptopclassbidensubsidies1200x675jpg 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202209laptopclassbidensubsidies800x450jpg 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202209laptopclassbidensubsidies600x338jpg 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202209laptopclassbidensubsidies331x186jpg 331w img width1200 altbright green money laptop middle bright red background srchttpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202209laptopclassbidensubsidies800x450jpg height675 picture div pif doubts power dropped pretense fighting working class dispense president joe biden administrations latest concessions laptop class student loan forgiveness subsidies people drive pricey electric cars profitable semiconductor company ceos administration working hard shower friends handouts paid hardworking lowerwage americansp pwe learned outrageous handout course biden announced willunilaterally mind apparent reason seeextend pause student loan payments end year forgive 10000 persons making 125000 year generosity peoples money extends 20000 pell grant recipientsp pas david stockman director congressional office management budget reported recently quotonly 37 americans 4year college degree 13 graduate degrees 3 phd similar professional degree 56 student loan debt held people went grad school 20 owed tiny 3 sliver phdsquotp ppicture young married lawyers earn 250000 way making money future able collect uncle joe nice bonus 40000 taken pockets people didnt collegeperhaps want debtand responsibly paid debtp pits wonder leftleaning economists policy wonks loudly criticized socalled student loan forgiveness emthe washington postem instance editorialized decision quotregressivequot quotexpensivequot quotlikely inflationaryquot nullifying quotnearly decades worth deficit reduction inflation reduction actquotp pmeanwhile jason furman headed president barack obamas council economic advisers napalmed plan brutal twitter thread explained thanks bidens interest rates rise additional 50 75 basis points counteract added inflationary effect furman clear regards outcome remarkably unfair regressivep pthen theres inflation reduction acts gusher green subsidies disproportionately benefit wealthier americans extension tax credit 7500 purchase new electric vehicles buying evs tax credit 4000 little consolation people cant afford luxury buying electric cars remain pricier gasolinepowered alternatives bill hopes address issue making expensive ev cars ineligible credit counteracts provision requirement cars assembled united states eligiblep pto underscore disconnected policymakers average americans vehicle credits limited making 150000 annually single filing 300000 joint filing presumably avoid criticism subsidizing rich leaves 93 percent individuals 97 percent households able seize subsidy given mainly taxpayers annual incomes 100000 credit past subsidy serve swath fairly welloff peoplep pbut politicians showering higherincome individuals subsidies companies quick look semiconductor subsidies chips act reveals wellpublicized 52 billion giveaway benefit wellconnected rich companiesp pwe examples democrats incessant demand restore remarkably regressive state local tax quotsaltquot deductions pre2017 heights persons gain highincome earnersand bigspending elected officialsin hightax blue states lost parts deductions trump tax cuts implemented want backp pif youre surprised havent paying attention democrats recent record pretending party privileged laptop classp pstrongcopyright 2022 relnoopener noreferrer hrefhttpcreatorscom datasaferedirecturlhttpswwwgooglecomurlqhttpcreatorscomampsourcegmailampust1662081311184000ampusgaovvaw2c7giw9nrahbtgmydjk12t target_blankcreatorscomastrongp pthe post relnofollow hrefhttpsreasoncom20220901thebidenadministrationistakingfromthepoorandgivingtotherichthe biden administration taking poor giving richa appeared relnofollow hrefhttpsreasoncomreasoncomap
|
6311335ad68fd583b1555ab2
|
That was then, this is now
|
blockquoteppolands top politician said thursday that the government will seek equivalent of some 13 trillion in reparations from germany for the nazis world war ii invasion and occupation of his countryp
pwe will turn to germany to open negotiations on the reparations kaczynski said adding it will be a long and not an easy path but one day will bring successp
phe insisted the move would serve true polishgerman reconciliation that would be based on truthp
blockquote
pthat is a relnoopener hrefhttpsapnewscomarticlepolandgermanyworldwariiwarsaw49b0cf77745a7b1cabfaa884c3bf0035 target_blankan articlea from todayp
pthe post a relnofollow hrefhttpmarginalrevolutioncommarginalrevolution202209thatwasthenthisisnow37htmlthat was then this is nowa appeared first on a relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap
|
blockquoteppolands politician said thursday government seek equivalent 13 trillion reparations germany nazis world war ii invasion occupation countryp pwe turn germany open negotiations reparations kaczynski said adding long easy path day bring successp phe insisted serve true polishgerman reconciliation based truthp blockquote pthat relnoopener hrefhttpsapnewscomarticlepolandgermanyworldwariiwarsaw49b0cf77745a7b1cabfaa884c3bf0035 target_blankan articlea todayp pthe post relnofollow hrefhttpmarginalrevolutioncommarginalrevolution202209thatwasthenthisisnow37htmlthat nowa appeared relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap
|
631133cad68fd583b1555abf
|
Three Terms Communists Redefined to Subvert Society
|
pover the past two years tens of millions of americans have awakened to the fact that the dialectical left which includes communism achieves its agendas most effectively by strategically changing the meanings of words this is a tactic that is very effective a relnoopener hrefhttpsamznto3pwtokz target_blankuntil it is recognizeda at which point it rapidly becomes counterproductive because it is so obviously manipulative and so easily resisted by demanding clear definitions especially in policy documents the challenge is that there are a lot of words that our society depends upon which allows communist activists to move on from one word to another then to another as their language games get exposedp
psome of these strategic equivocations about the meanings of words are more impactful than others currently there are just three terms that have been profoundly subverted and are being used to transform our society by communists for communist ends these are eminclusionem emdemocracyem and emcitizenshipem all three are being redefined together understanding how this manipulation is taking place is key to neutralizing it and that starts with understanding how these three words are being strategically misused first lets discuss the general principle of how the communist or dialectical left redefines terms to achieve its endsp
h3the essence of critiqueh3
pthe method of the communist or dialectical left is critique which is the specific kind of criticism that characterizes critical theory critical theory if you dont know is the operative tool of the dominant strain of twentieth century marxist theory which is sometimes called critical marxism and is associated with the frankfurt school institute for social research what it refers to is identifying and reframing concepts in terms of marxist structural analysisp
pin general when critical marxists including the woke marxists of today say they are applying criticism to something or considering it in a critical way what they mean is that they are strategically redefining the key terms involved so that they are understood in terms of marxist sociopolitical analysis in other words theyre reframing the meanings of words so that they are to be understood in terms of alleged exclusionary power dynamics that benefit one class of people and oppress another class of people these critical marxists believe structure every aspect of society including how things are talked and thought about and critique is meant to subtly reframe thatp
pfor example consider the term justice which we often hear from critical marxists who claim to be in pursuit of social justice the notion of justice has to be shifted from a perspective of individuals finding fair treatment under the law in an impartial way to a new perspective where fairness takes into account a belief that the law is not and cannot be impartial and thus favors certain groups over others in its very construction as a result the law and its application has to be tilted in favor of those groups who are theorized to be structurally disadvantaged by the existing system so justice follows from an underlying but hidden assumption of a need for partiality to level the playing field the concept of meting out justice remains intact but impartiality under the law is replaced by intentional partiality under the law so that those marxist theory claims are structurally disadvantaged are given additional privileges relative to everyone elsep
pfor another example consider the term education the concept of education has to be understood and then redesigned according to this paradigm alsoas does emeverythingem in society critical marxism you see believes that the emvery terms of society itselfem are corrupt and structurally unjust and thus must be retooled to move the marginalized to the center and vice versa thus education is criticized for being an unjust credentialing mechanism that allows those who accept the unjust corrupt terms of the existing society to move into positions of power and authority from which they can ensure it reproduces itself a genuine education or a critical education then is a empolitical educationem that teaches people to understand society this way and to reject it at present we have been miseducating our children on these terms for at least thirty yearsp
pin both cases you can see that there has been a subtle shifting of the meaning of the term in question by criticizing it in a way that redefines it to the communist lefts advantage this process is how they subvert words institutions and even society itself now that we have a sense of how it works lets turn to three key terms the communist left is using to subvert andem transform emsociety itself into something wholly under their control these terms again are eminclusionem emdemocracyem and emcitizenshipem and they build upon one anotherp
h31 inclusionh3
pof all the words the woke marxists strategically misuse today few are more important than inclusion many people have awakened to the sense that something is badly wrong with that term and that it somehow indicates selective emexclusionem and theyre right now that you know the trick its easy to understand how it worksp
pto woke marxists eminclusionem expresses the idea that nobody is excluded emby virtue of the unjust power dynamics woke marxist theory describesem for them free societies with impartial laws dont address the underlying structural power dynamics that create emde factoem exclusion or a sense of not being fully welcome for example racial and sexual minorities and especially woke activists within those groups might be made to feel excluded they insist by virtue of a belief that straight white men are the defaults in many positions of authority or women might be excluded as a matter of circumstantial fact by the demands of motherhood which quickly and neatly explains many of their views about abortion rights and the recently published notion in the emnew york timesem that the a relnoopener hrefhttpswwwnytimescom20220826opinionsundaymaternalinstinctmythhtml target_blankmaterial instinct is a myth created by menathat is in marxian terms an oppressive ideological narrative that supports structural patriarchyp
pwhen huge entities like the world economic forum wef and united nations un say that their agenda is to transform the world to achieve a more sustainable and eminclusiveem future this is the subversion theyre relying upon people who marxist theory says have been or are being excludedie for them leftistsmust be actively emincludedem which requires emexcludingem everyone else either by limits to occupancy or by deliberate censorship and purgesp
h32 democracyh3
pdemocracy is supposed to be rule by the people something americas founding fathers had the good sense to realize was a bad idea not least because they were watching the democratic french revolution descend into murderous terror as they wrote the constitution rule by the people meansem all of the peopleem and communists have seized upon this idea to redefine democracy and stoke resentment about supposed structural disenfranchisement for over a centuryp
pin emthe state and societyem written in 1917 vladimir lenin explained that what we think of as democracy in capitalist societies is in fact bourgeois democracyrule by the empowered minority in the bourgeoisie democracy for an insignificant minority democracy for the rich that is the democracy of capitalist society he wrotep
p[i]n capitalist society we have a democracy that is curtailed wretched false a democracy only for the rich for the minority the dictatorship of the proletariat the period of transition to communism will for the first time create democracy for the people for the majority along with the necessary suppression of the exploiters of the minority communism alone is capable of providing really complete democracy and the more complete it is the sooner it will become unnecessary and wither away of its own accord lenin emthe state and societyem chapter 5p
plenin explained using critique that democratic voting in a capitalist society isnt truly democratic because it only serves the bourgeois minority democracy will only be genuine when everyone is equal which only occurs under communism in the meantime under socialist rule in the ussr a dictatorship of the proletariat will simulate true democracy by elevating the masses and suppressing the exploitersp
pin modern parlance what lenin is describing would bein fact emisemcalled inclusive democracy and it utilizes the exact same trick on the definition of inclusion to achieve its aims the underlying belief is that society is exploitative of certain groups who are in the majority and thus those people arent equal participants in the democratic process they have to be emmade equalem the contemporary term for this adjustment of enfranchisement opportunity and privilege is emequityem the term in lenins day which still has major purchase was emdemocratic socialismemp
pwhen we hear players in politics or the media say that open discussion threatens to create misinformation that threatens our democracy this is very likely to be what they are talking about never mind that we live in aem republicem not a democracy they view their democracythe only legitimate democracyas inclusive democracy and thus one that must adjust shares ie discriminate and suppress in order to achieve its aims as lenin pointed out its not that they want to be unfair its that they have to be in order to get their way so that their evils can wither away of their own accord when theyre no longer needed anymore when communism arrives spoiler communism never arrives its fakep
h33 citizenshiph3
pit will at this point surprise you none at all to find out that they have done the exact same critique to citizenship which usually denotes the relationship persons recognized as citizens have with the state in republics like the united states this relationship is that the state borrows political authority from the people and in exchange for that authority the state is to use it emonlyem to secure the inalienable rights of a free people among these life liberty and the pursuit of happiness which thomas jefferson believed followed naturally from the right to ones property communists do not like the right to private property in fact karl marx wrote in emthe communist manifestoem that communism can be summarized in a single sentence abolition of private propertyp
pfor woke marxists citizenship is the other side of the coin of democracycitizens are the people enfranchised and empowered to participate in a democracy therefore one is only a full citizen to the degree structural power doesnt disenfranchise that person whether through exclusion or as a matter of fact inclusive citizenship is a marxist model of citizenship that seeks to address this issue and thus to reframe what it means to be a citizen outside of any belief in an impartial state which it believes is impossible and is always organized to maintain the privilege power and advantage of the alreadyadvantagedp
pa key example of this issue has already been raised motherhood detracts from full citizenship by placing demands to the family not direct civic participation on women who become mothers the impositions of motherhood exclude women from full citizenship especially if they arent given complete authority and autonomy to decide if they will become or remain mothers inclusive citizenship would demand a reprioritization to increase the enfranchisement of women as a class in order to correct for this imposition not to mention their beliefs about structural patriarchy exclusion from power due to sexism and having to cope with misogyny similar impediments to full inclusive citizenship are believed to be imposed upon racial minorities sexual minorities and all other forms of minoritized groups by the structural power dynamics woke marxism exists to critique inclusive citizenship answers this alleged challenge by offering privileges to historically marginalized groups particularly leftist activists among them and suppressing others especially conservativesp
pby redefining citizenship though leftist activists can successfully subvert society entirely by rewriting its socalled social contract the agreement between the state and its citizens that holds society together citizenship as a concept writes the terms of the social contract by replacing citizenship with inclusive citizenship leftists create a social contract that inherently advantages leftism while intentionally disadvantaging everyone that opposes leftism this in turn creates the socialist democracy lenin insisted would pave the way to communism at which point true inclusion will finally arriveand we will finally have emsocial justiceemp
pin closing its worth noting that klaus schwab executive chairman of the world economic forum wrote in his 2022 book a relnoopener hrefhttpsamznto3cdft4b target_blankemthe great narrative for a better future the great reset book 2ema that his explicit goal is to rewrite the social contracts of societies around the globe what they should change to he writes would favor sustainability and inclusivity as primary values and the purpose of the great narrative is to foster this fundamental change in values at all levels of society in every society at once so that they can better cooperate on solving what he calls existential global challenges inclusive citizenship in other words will give way to emglobal citizenshipem which will have to be inclusive and redistributive by definition never mind i suppose that this has always been the stated aim of marxist communism from karl marxs earliest writings never mind indeedp
p p
pthe post a relnofollow hrefhttpsnewdiscoursescom202209threetermscommunistsredefinedtosubvertsocietythree terms communists redefined to subvert societya appeared first on a relnofollow hrefhttpsnewdiscoursescomnew discoursesap
|
pover past years tens millions americans awakened fact dialectical left includes communism achieves agendas effectively strategically changing meanings words tactic effective relnoopener hrefhttpsamznto3pwtokz target_blankuntil recognizeda point rapidly counterproductive obviously manipulative easily resisted demanding clear definitions especially policy documents challenge lot words society depends allows communist activists word language games exposedp psome strategic equivocations meanings words impactful currently terms profoundly subverted transform society communists communist ends eminclusionem emdemocracyem emcitizenshipem redefined understanding manipulation taking place key neutralizing starts understanding words strategically misused lets discuss general principle communist dialectical left redefines terms achieve endsp h3the essence critiqueh3 pthe method communist dialectical left critique specific kind criticism characterizes critical theory critical theory dont know operative tool dominant strain twentieth century marxist theory called critical marxism associated frankfurt school institute social research refers identifying reframing concepts terms marxist structural analysisp pin general critical marxists including woke marxists today applying criticism considering critical way mean strategically redefining key terms involved understood terms marxist sociopolitical analysis words theyre reframing meanings words understood terms alleged exclusionary power dynamics benefit class people oppress class people critical marxists believe structure aspect society including things talked thought critique meant subtly reframe thatp pfor example consider term justice hear critical marxists claim pursuit social justice notion justice shifted perspective individuals finding fair treatment law impartial way new perspective fairness takes account belief law impartial favors certain groups construction result law application tilted favor groups theorized structurally disadvantaged existing system justice follows underlying hidden assumption need partiality level playing field concept meting justice remains intact impartiality law replaced intentional partiality law marxist theory claims structurally disadvantaged given additional privileges relative elsep pfor example consider term education concept education understood redesigned according paradigm alsoas emeverythingem society critical marxism believes emvery terms society itselfem corrupt structurally unjust retooled marginalized center vice versa education criticized unjust credentialing mechanism allows accept unjust corrupt terms existing society positions power authority ensure reproduces genuine education critical education empolitical educationem teaches people understand society way reject present miseducating children terms thirty yearsp pin cases subtle shifting meaning term question criticizing way redefines communist lefts advantage process subvert words institutions society sense works lets turn key terms communist left subvert andem transform emsociety wholly control terms eminclusionem emdemocracyem emcitizenshipem build anotherp h31 inclusionh3 pof words woke marxists strategically misuse today important inclusion people awakened sense badly wrong term indicates selective emexclusionem theyre right know trick easy understand worksp pto woke marxists eminclusionem expresses idea excluded emby virtue unjust power dynamics woke marxist theory describesem free societies impartial laws dont address underlying structural power dynamics create emde factoem exclusion sense fully welcome example racial sexual minorities especially woke activists groups feel excluded insist virtue belief straight white men defaults positions authority women excluded matter circumstantial fact demands motherhood quickly neatly explains views abortion rights recently published notion emnew york timesem relnoopener hrefhttpswwwnytimescom20220826opinionsundaymaternalinstinctmythhtml target_blankmaterial instinct myth created menathat marxian terms oppressive ideological narrative supports structural patriarchyp pwhen huge entities like world economic forum wef united nations un agenda transform world achieve sustainable eminclusiveem future subversion theyre relying people marxist theory says excludedie leftistsmust actively emincludedem requires emexcludingem limits occupancy deliberate censorship purgesp h32 democracyh3 pdemocracy supposed rule people americas founding fathers good sense realize bad idea watching democratic french revolution descend murderous terror wrote constitution rule people meansem peopleem communists seized idea redefine democracy stoke resentment supposed structural disenfranchisement centuryp pin emthe state societyem written 1917 vladimir lenin explained think democracy capitalist societies fact bourgeois democracyrule empowered minority bourgeoisie democracy insignificant minority democracy rich democracy capitalist society wrotep p[i]n capitalist society democracy curtailed wretched false democracy rich minority dictatorship proletariat period transition communism time create democracy people majority necessary suppression exploiters minority communism capable providing complete democracy complete sooner unnecessary wither away accord lenin emthe state societyem chapter 5p plenin explained critique democratic voting capitalist society isnt truly democratic serves bourgeois minority democracy genuine equal occurs communism meantime socialist rule ussr dictatorship proletariat simulate true democracy elevating masses suppressing exploitersp pin modern parlance lenin describing bein fact emisemcalled inclusive democracy utilizes exact trick definition inclusion achieve aims underlying belief society exploitative certain groups majority people arent equal participants democratic process emmade equalem contemporary term adjustment enfranchisement opportunity privilege emequityem term lenins day major purchase emdemocratic socialismemp pwhen hear players politics media open discussion threatens create misinformation threatens democracy likely talking mind live aem republicem democracy view democracythe legitimate democracyas inclusive democracy adjust shares ie discriminate suppress order achieve aims lenin pointed want unfair order way evils wither away accord theyre longer needed anymore communism arrives spoiler communism arrives fakep h33 citizenshiph3 pit point surprise find exact critique citizenship usually denotes relationship persons recognized citizens state republics like united states relationship state borrows political authority people exchange authority state use emonlyem secure inalienable rights free people life liberty pursuit happiness thomas jefferson believed followed naturally right ones property communists like right private property fact karl marx wrote emthe communist manifestoem communism summarized single sentence abolition private propertyp pfor woke marxists citizenship coin democracycitizens people enfranchised empowered participate democracy citizen degree structural power doesnt disenfranchise person exclusion matter fact inclusive citizenship marxist model citizenship seeks address issue reframe means citizen outside belief impartial state believes impossible organized maintain privilege power advantage alreadyadvantagedp pa key example issue raised motherhood detracts citizenship placing demands family direct civic participation women mothers impositions motherhood exclude women citizenship especially arent given complete authority autonomy decide remain mothers inclusive citizenship demand reprioritization increase enfranchisement women class order correct imposition mention beliefs structural patriarchy exclusion power sexism having cope misogyny similar impediments inclusive citizenship believed imposed racial minorities sexual minorities forms minoritized groups structural power dynamics woke marxism exists critique inclusive citizenship answers alleged challenge offering privileges historically marginalized groups particularly leftist activists suppressing especially conservativesp pby redefining citizenship leftist activists successfully subvert society entirely rewriting socalled social contract agreement state citizens holds society citizenship concept writes terms social contract replacing citizenship inclusive citizenship leftists create social contract inherently advantages leftism intentionally disadvantaging opposes leftism turn creates socialist democracy lenin insisted pave way communism point true inclusion finally arriveand finally emsocial justiceemp pin closing worth noting klaus schwab executive chairman world economic forum wrote 2022 book relnoopener hrefhttpsamznto3cdft4b target_blankemthe great narrative better future great reset book 2ema explicit goal rewrite social contracts societies globe change writes favor sustainability inclusivity primary values purpose great narrative foster fundamental change values levels society society better cooperate solving calls existential global challenges inclusive citizenship words way emglobal citizenshipem inclusive redistributive definition mind suppose stated aim marxist communism karl marxs earliest writings mind indeedp pp pthe post relnofollow hrefhttpsnewdiscoursescom202209threetermscommunistsredefinedtosubvertsocietythree terms communists redefined subvert societya appeared relnofollow hrefhttpsnewdiscoursescomnew discoursesap
|
6312854208ef59509693d033
|
How did Biden go from zero to hero so quickly?
|
ppresident bidens abrupt move from the political outhouse to penthouse in a few short weeks has been headspinningp
phis approval ratings had been in a slump for nearly a year hitting a a hrefhttpswwwreuterscomworldusbidenapprovalratingfalls36matchingrecordlowreutersipsos20220719low in julya the dominant media narrative was that he and the democrats were accomplishing little despite having control of both congress and the white house and that voters would make them pay in the november midterms in fact as biden battled covid through late july some a hrefhttpswwwreuterscomworldusonedonesomedemocratssaybidenshouldnotseeksecondterm20220804democratsa even started saying he should not run for reelection in 2024 intimating that he was too old and unpopularp
pthen a hrefhttpspollquedupollreleasereleaseid3854things shifteda democrats pushed through several major bills including one on gun safety the a hrefhttpswwwwhitehousegovbriefingroomstatementsreleases20220809factsheetchipsandscienceactwilllowercostscreatejobsstrengthensupplychainsandcounterchinachips and science acta and the surprise 29 billion a hrefhttpswwwwhitehousegovbriefingroomstatementsreleases20220815bythenumberstheinflationreductionactinflation reduction acta and suddenly these along with bidens earlier legislative wins and foreign policy achievements drew a hrefhttpswwwnprorg2022081911184192714trillionhowthebidenadministrationslegislativesuccessesbecamerealityrenewed attentiona in news stories and praise from pundits and voters saying the president is giving democrats a hrefhttpswwwnytimescom20220828opinionbidendemocratsmidtermshtmlmomentuma heading into the fallp
pthe gazette asked a hrefhttpswwwhksharvardedufacultythomaspattersonthomas pattersona bradlee professor of government and the press at a hrefhttpswwwhksharvardeduharvard kennedy schoola who studied the medias coverage of the 2016 and 2020 presidential cycles to explain the hasty shift in tone on biden the interview has been edited for clarity and lengthp
h2qampah2
h3thomas pattersonh3
pspangazettespan all presidents go through ups and downs in the press but this 180degree shift on biden seemed unusually swift what happenedp
pspanpattersonspan the press always does this there is a meta narrative that settles into the news coverage and that frames even how journalists look at developments with some of the bills coming through the congress there was more talk about what was dropped out of them than what benefits were in them as if he was dealing with the same kind of congress that obama had obama up until sen edward kennedys death had a filibusterproof senate and a huge majority of the house biden has a very narrow house majority and unless you keep all the democrats together on these bills most times you dont have a chancep
ptheres almost no accounting of the context in which leadership is taking place thats been a longtime complaint about the press back to the hutchins commission of the late 40s theres very little context very little attempt to put into a shape and a form and background that gives people a more complete understanding they just go for the bottom line hes not doing all that wellp
pthose are longstanding tendencies and weaknesses in coverage and a lot of it goes to a space limitation they dont always have the time and space to dig into context to let people know whats actually going on so they go for the quick and easy which is boy did he screw this one up hes probably getting too much credit at the moment for the good things a lot of the turnaround is the dobbs decision the supreme court decision overturning roe v wadep
div
figure
div
div
img sizesminwidth 1384px 808px minwidth 1070px calc100vw 160px 66 minwidth 768px calc100vw 120px 75 minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads20220920220902_patterson_25001024x1024jpg width1024 altthomas patterson srcsethttpsnewsharvardeduwpcontentuploads20220920220902_patterson_25001024x1024jpg 1024w httpsnewsharvardeduwpcontentuploads20220920220902_patterson_2500300x300jpg 300w httpsnewsharvardeduwpcontentuploads20220920220902_patterson_2500150x150jpg 150w httpsnewsharvardeduwpcontentuploads20220920220902_patterson_2500768x768jpg 768w httpsnewsharvardeduwpcontentuploads20220920220902_patterson_25001536x1536jpg 1536w httpsnewsharvardeduwpcontentuploads20220920220902_patterson_25002048x2048jpg 2048w httpsnewsharvardeduwpcontentuploads20220920220902_patterson_25001350x1350jpg 1350w httpsnewsharvardeduwpcontentuploads20220920220902_patterson_25001600x1600jpg 1600w httpsnewsharvardeduwpcontentuploads20220920220902_patterson_2500500x500jpg 500w httpsnewsharvardeduwpcontentuploads20220920220902_patterson_2500250x250jpg 250w httpsnewsharvardeduwpcontentuploads20220920220902_patterson_25001500x1500jpg 1500w height1024 div
div
figcaption
pquotis biden maximizing a very bad situation he didnt get dealt a good hand has he done as much as he could possibly have done with that hand that should have been the question it was never the questionp
pfile photo by jon chaseharvard staff photographerp
figcaption
figure
div
div
div
div
pspangazettespan was this a justified reaction to a spate of significant news that occurred within two weeks or was it a case of the press caught flatfooted on two huge stories the inflation reduction act and the death of an alqaeda leader ayman alzawahiri that sparked a collective reevaluation of the prevailing narrative of an ineffectual white housep
pspanpattersonspan i think youre onto something here even if you go back and look at the abortion coverage and how biden was portrayed the reporting was all about why didnt he have executive orders already in place why was he behind the curve i wrote a book in the 90s about media narratives when your poll numbers are bad almost everything thats said about you is going to be bad because it fits the narrative so the press is always looking for where the weakness is that illustrates why youre stumbling around on the other hand when things are on the rise the press is picking out from all the things going on at any given time those things that shed someone in a good lightp
pspangazettespan what does this episode tell us about how the press covers politicsp
pspanpattersonspan if you think about political journalists they read each other they talk to each other a lot theres kind of a groupthink about where things are and then they have some common indicators and obviously with bidens poll numbers being in the tank its hard to tell a good story about a president but in some ways thats the point its the external environment that often drives the narrative as much as the realitiesp
pits died down recently but age was a very big subtheme of the narrative about biden i never saw a single story that ever connected his age to questions of how would a 50yearold have dealt with a senate that was 5050 there was no accounting for how much is age and how much is other factors but that became almost like gospel and then every time somebody talked about maybe we need to change horses in 2024 because of age suddenly because age is on the radar thats more likely to be a storyp
pall the things we know about cuetaking within journalism are always in play and go a long way to explain these things what studies have shown the economy is a very good example of this is usually the coverage is about a month or two behind the reality the press turnaround in bidens case was pretty fast but ordinarily when the conditions on the ground change it takes a while for that to work its way into the journalism narrative you started this narrative youre building off this narrative pieces that support it stand out more when they happen because that is the way youre looking at the world bidens weak things arent going well he didnt get that done you start to see those things we all do this this is the way our minds work its not just journalism were looking at normal human behavior herep
pspangazettespan has the coverage of president biden generally been more negative than warranted how does it compare to the way trump obama and other presidents were coveredp
pspanpattersonspan i think its journalism as usual even though i think hes had a tough ride those may seem contradictory but trump had a better hand his first year congress was more favorably balanced for republicans he didnt need all of them to get something done he got one big bill through that was the 2017 tax cuts and jobs bill biden has done a lot more than thatp
pits hard to compare him with obama democrats had large majorities then but they didnt deal with the dreamers they didnt deal with immigration reform they didnt deal with climate change in any significant way and yet obama got quite good coverage he also got much better coverage in 2008 than hillary clinton did the press really hammered her press was as much the reason she lost that election as obamap
pbill clinton in the first two years had a much better congress than biden he got quite a bit done but he had the better hand that in my mind means journalists have to look at the conditions under which presidents are operating once in a while like lbj in 65 franklin roosevelt in 33 you can do great things as president if you have huge majorities in the congress when you dont have this kind of majority you cant its just not possible so is biden maximizing a very bad situation he didnt get dealt a good hand has he done as much as he could possibly have done with that hand that should have been the question it was never the questionp
pspangazettespan the press came under heavy criticism by you and many others for coverage of the 2016 and 2020 elections which lessons remain unlearnedp
pspanpattersonspan if trump runs again throw the rulebook out journalism covered trump unlike anybody theyve covered before and its not a republican thing its much more the press as a watchdog of democratic norms its an undervalued role that they play and a really important one those supersede any kind of journalistic norm about fairness objectivity and the like at the moment the republicans have gone deep into the dark side of democracy so its a little hard for journalists to ignore that would really go against their centurieslong tradition this is about small d democracy this isnt about partisanship i do expect the press not to get into the he saidshe said false equivalencies and anytime that a party begins to engage in bigotry and use prejudice as a cudgel the press needs to call that out as a violation of democratic normspdivdivdiv
|
ppresident bidens abrupt political outhouse penthouse short weeks headspinningp phis approval ratings slump nearly year hitting hrefhttpswwwreuterscomworldusbidenapprovalratingfalls36matchingrecordlowreutersipsos20220719low julya dominant media narrative democrats accomplishing little despite having control congress white house voters pay november midterms fact biden battled covid late july hrefhttpswwwreuterscomworldusonedonesomedemocratssaybidenshouldnotseeksecondterm20220804democratsa started saying run reelection 2024 intimating old unpopularp pthen hrefhttpspollquedupollreleasereleaseid3854things shifteda democrats pushed major bills including gun safety hrefhttpswwwwhitehousegovbriefingroomstatementsreleases20220809factsheetchipsandscienceactwilllowercostscreatejobsstrengthensupplychainsandcounterchinachips science acta surprise 29 billion hrefhttpswwwwhitehousegovbriefingroomstatementsreleases20220815bythenumberstheinflationreductionactinflation reduction acta suddenly bidens earlier legislative wins foreign policy achievements drew hrefhttpswwwnprorg2022081911184192714trillionhowthebidenadministrationslegislativesuccessesbecamerealityrenewed attentiona news stories praise pundits voters saying president giving democrats hrefhttpswwwnytimescom20220828opinionbidendemocratsmidtermshtmlmomentuma heading fallp pthe gazette asked hrefhttpswwwhksharvardedufacultythomaspattersonthomas pattersona bradlee professor government press hrefhttpswwwhksharvardeduharvard kennedy schoola studied medias coverage 2016 2020 presidential cycles explain hasty shift tone biden interview edited clarity lengthp h2qampah2 h3thomas pattersonh3 pspangazettespan presidents ups downs press 180degree shift biden unusually swift happenedp pspanpattersonspan press meta narrative settles news coverage frames journalists look developments bills coming congress talk dropped benefits dealing kind congress obama obama sen edward kennedys death filibusterproof senate huge majority house biden narrow house majority democrats bills times dont chancep ptheres accounting context leadership taking place thats longtime complaint press hutchins commission late 40s theres little context little attempt shape form background gives people complete understanding line hes wellp pthose longstanding tendencies weaknesses coverage lot goes space limitation dont time space dig context let people know whats actually going quick easy boy screw hes probably getting credit moment good things lot turnaround dobbs decision supreme court decision overturning roe v wadep div figure div div img sizesminwidth 1384px 808px minwidth 1070px calc100vw 160px 66 minwidth 768px calc100vw 120px 75 minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads20220920220902_patterson_25001024x1024jpg width1024 altthomas patterson srcsethttpsnewsharvardeduwpcontentuploads20220920220902_patterson_25001024x1024jpg 1024w httpsnewsharvardeduwpcontentuploads20220920220902_patterson_2500300x300jpg 300w httpsnewsharvardeduwpcontentuploads20220920220902_patterson_2500150x150jpg 150w httpsnewsharvardeduwpcontentuploads20220920220902_patterson_2500768x768jpg 768w httpsnewsharvardeduwpcontentuploads20220920220902_patterson_25001536x1536jpg 1536w httpsnewsharvardeduwpcontentuploads20220920220902_patterson_25002048x2048jpg 2048w httpsnewsharvardeduwpcontentuploads20220920220902_patterson_25001350x1350jpg 1350w httpsnewsharvardeduwpcontentuploads20220920220902_patterson_25001600x1600jpg 1600w httpsnewsharvardeduwpcontentuploads20220920220902_patterson_2500500x500jpg 500w httpsnewsharvardeduwpcontentuploads20220920220902_patterson_2500250x250jpg 250w httpsnewsharvardeduwpcontentuploads20220920220902_patterson_25001500x1500jpg 1500w height1024 div div figcaption pquotis biden maximizing bad situation didnt dealt good hand possibly hand question questionp pfile photo jon chaseharvard staff photographerp figcaption figure div div div div pspangazettespan justified reaction spate significant news occurred weeks case press caught flatfooted huge stories inflation reduction act death alqaeda leader ayman alzawahiri sparked collective reevaluation prevailing narrative ineffectual white housep pspanpattersonspan think youre look abortion coverage biden portrayed reporting didnt executive orders place curve wrote book 90s media narratives poll numbers bad thats said going bad fits narrative press looking weakness illustrates youre stumbling hand things rise press picking things going given time things shed good lightp pspangazettespan episode tell press covers politicsp pspanpattersonspan think political journalists read talk lot theres kind groupthink things common indicators obviously bidens poll numbers tank hard tell good story president ways thats point external environment drives narrative realitiesp pits died recently age big subtheme narrative biden saw single story connected age questions 50yearold dealt senate 5050 accounting age factors like gospel time somebody talked maybe need change horses 2024 age suddenly age radar thats likely storyp pall things know cuetaking journalism play long way explain things studies shown economy good example usually coverage month reality press turnaround bidens case pretty fast ordinarily conditions ground change takes work way journalism narrative started narrative youre building narrative pieces support stand happen way youre looking world bidens weak things arent going didnt start things way minds work journalism looking normal human behavior herep pspangazettespan coverage president biden generally negative warranted compare way trump obama presidents coveredp pspanpattersonspan think journalism usual think hes tough ride contradictory trump better hand year congress favorably balanced republicans didnt need got big bill 2017 tax cuts jobs bill biden lot thatp pits hard compare obama democrats large majorities didnt deal dreamers didnt deal immigration reform didnt deal climate change significant way obama got good coverage got better coverage 2008 hillary clinton press hammered press reason lost election obamap pbill clinton years better congress biden got bit better hand mind means journalists look conditions presidents operating like lbj 65 franklin roosevelt 33 great things president huge majorities congress dont kind majority cant possible biden maximizing bad situation didnt dealt good hand possibly hand question questionp pspangazettespan press came heavy criticism coverage 2016 2020 elections lessons remain unlearnedp pspanpattersonspan trump runs throw rulebook journalism covered trump unlike anybody theyve covered republican thing press watchdog democratic norms undervalued role play important supersede kind journalistic norm fairness objectivity like moment republicans gone deep dark democracy little hard journalists ignore centurieslong tradition small d democracy isnt partisanship expect press saidshe said false equivalencies anytime party begins engage bigotry use prejudice cudgel press needs violation democratic normspdivdivdiv
|
6312855208ef59509693d037
|
White House requests $22.4B in COVID-19 funding, $3.9B in monkeypox funding
|
pthe white house is set to request 224 billion in funding for the ongoing covid19 response effort and 39 billion for the monkeypox response effort in the form of emergency funding from congress senior administration officials announced on fridayp
pthe updated request for covid19 funding is to meet immediate shortterm domestic needs including testing research and development of nextgeneration vaccines and therapeutics according to the white house it also would support the global response to covid19 and help to prepare for future variantsp
pwithout additional funding we will have to make more difficult decisions a senior administration official said on fridayp
pthe federal government on friday suspended the program for free covid19 tests to be sent to americans officials argued that a lack of funding has prevented them from adequately replenishing national stockpiles of athome tests they added that they issued a warning in march stating that without more funding they will miss critical needs p
pofficials said on friday that while there are some tests available in the stockpile there is not enough funding to get through a surge in the fall vaccines will be free into 2023 but the timeline for commercialization of vaccines going forward has had to be accelerated without fundingp
pthe request to fight monkeypox is to help ensure ready access to vaccinations testing treatment and operational support it also includes 600 million to help combat the spread globallyp
pthe request made ahead of the end of the fiscal year on sept 30 is for congress to address critical needs in the event of shortterm continuing resolution cr that lasts through the first quarter which includes october november and decemberp
pwith one month until the end of the fiscal year its clear that congress will first need to pass a shortterm continuing resolution cr to keep the federal government running and provide the time needed to reach an agreement on fullyear funding bills office of management and budget director shalanda young said in a blog post released friday p
pthats why today as part of our prudent planning for the end of the fiscal year we are providing technical assistance to congress on a shortterm crp
pthe white houses request also includes 137 billion to help ukraine amid the war with russia and funding to respond to natural disasters in states including kentucky california louisiana texas and othersp
|
pthe white house set request 224 billion funding ongoing covid19 response effort 39 billion monkeypox response effort form emergency funding congress senior administration officials announced fridayp pthe updated request covid19 funding meet immediate shortterm domestic needs including testing research development nextgeneration vaccines therapeutics according white house support global response covid19 help prepare future variantsp pwithout additional funding difficult decisions senior administration official said fridayp pthe federal government friday suspended program free covid19 tests sent americans officials argued lack funding prevented adequately replenishing national stockpiles athome tests added issued warning march stating funding miss critical needs p pofficials said friday tests available stockpile funding surge fall vaccines free 2023 timeline commercialization vaccines going forward accelerated fundingp pthe request fight monkeypox help ensure ready access vaccinations testing treatment operational support includes 600 million help combat spread globallyp pthe request ahead end fiscal year sept 30 congress address critical needsin event shortterm continuing resolution cr lasts quarter includes october november decemberp pwith month end fiscal year clear congress need pass shortterm continuing resolution cr federal government running provide time needed reach agreement fullyear funding billsoffice management budget director shalanda young said blog post released fridayp pthats today prudent planning end fiscal year providing technical assistance congress shortterm crp pthe white houses request includes 137 billion help ukraine amid war russia funding respond natural disasters states includingkentucky california louisiana texas othersp
|
6313d5e302ef6cfc4c3398c7
|
A Birthday Appreciation for Trade Economist Henry George — He Wrote Milton Friedman’s Favorite Book on International Trade
|
div classwpblockimage
figurea hrefhttpswwwaeiorgwpcontentuploads202009henrygeorgejpgx91208img alt width446 srchttpswwwaeiorgwpcontentuploads202009henrygeorgejpgx91208 classwpimage1008577632 height251afigurediv
pyesterday marked what would have been trade economist henry georges 183nd birthday he was born on september 2 in philadelphia in 1839 and he died on october 29 1897 to honor henry georges legacy and his significant contributions to advancing the principles of free trade and warning about the dangers of protectionism this is my annual tribute to one of the greatest trade economists of all time a relnoreferrer noopener hrefhttpsenwikipediaorgwikihenry_george target_blankhenry georgeap
pthe seven excerpts below are from henry georges 1886 book ema relnoreferrer noopener hrefhttpswwwamazoncomprotectionfreetradeexaminationinterestsdp0911312838refsr_1_1ieutf8qid1465749551sr81keywordshenrygeorgefreetrade target_blankprotection or free tradea emwhich was milton friedmans favorite book on trade according to emcato instituteems jim powell who wrote about the henry george classic in his 2016 emwall street journalem oped a relnoreferrer noopener hrefhttpswwwwsjcomarticlesmiltonfriedmansfavoritebookontrade1465597043 target_blankmilton friedmans favorite book on tradea friedman called it the most rhetorically brilliant book ever written on trade and it was also the first book to be read entirely into the congressional record according to powell emprotection or free tradeem was probably the best book on trade written by anyone in the americas and compared it to adam smiths emwealth of nationsem george mason economist a relnoreferrer noopener hrefhttpswwwtheamericaninterestcom20090501anticapitalistrerun target_blanktyler cowen wrote in 2009a that georges 1886 book remains perhaps the bestargued tract on free trade to this dayp
psome of the henry george quotes below italics added were featured in jim powells 2016 emwall street journalem oped but ive expanded on those by including some additional quotes from the full text of emprotection or free tradeem a relnoreferrer noopener hrefhttpwwweconliborglibraryypdbooksgeorgegrgpfthtml target_blankavailable online herea from emthe liberty fundem as i wrote last year this book should be required reading for donald trump peter navarro and all other protectionistsscarctityists who think that trade is winlose and who foolishly mistakenly and naively advocate tariffs and protectionism as a way to make the united states better off economicallyp
blockquote classwpblockquotep1 strongmaximize imports not exportsstrong if foreigners will bring us goods cheaper than we can make them ourselves we shall be the gainers the more we get in imports as compared with what we have to give in exports the better the trade for us and since foreigners are not liberal enough to give us their productions but will only let us have them in return for own productions how can they ruin our industry the only way they could ruin our industry would be by bringing us for nothing all we want so as to save us the necessity for work if this were possible ought it seem very dreadfulppstrong2 voluntary trade is mutually beneficial strongtrade is not invasion it does not involve aggression on one side and resistance on the other but mutual consent and gratification there cannot be a trade unless both parties agree to itpp3 strongexposing protectionist fallaciesstrong in a profitable international trade the value of imports will always exceed the value of the exports that pay for them just as in a profitable trading voyage the return cargo must exceed in value the cargo carried out this is possible to all the nations that are parties to commerce for in a normal trade commodities are carried from places where they are relatively cheap to places where they are relatively dear and their value is thus increased by the transportation so that a cargo arrived at its destination has a higher value than on leaving the port of its exportation but on the theory that a trade is profitable only when exports exceed imports the only way for all countries to trade profitably with one another would be to carry commodities from places where they are relatively dear to places where they are relatively cheap an international trade made up of such transactions as the exportation of manufactured ice from the west indies to new england and the exportation of hothouse fruits from new england to the west indies would enable all countries to export much larger values than they imported emon the same theory the more ships sunk at sea the better for the commercial world to have all the ships that left each country sunk before they could reach any other country would upon protectionist principles be the quickest means of enriching the whole world since all countries could then enjoy the maximum of exports with the minimum of importsempp4 strongexposing tariff fallaciesstrong to every trade there must be two parties who mutually desire to trade and whose actions are reciprocal no one can buy unless he can find someone willing to sell and no one can sell unless there is some other one willing to buy if americans did not want to buy foreign goods foreign goods could not be sold here even if there were no tariff the efficient cause of the trade which our tariff aims to prevent is the desire of americans to buy foreign goods not the desire of foreign producers to sell them thus protection really prevents what the protected themselves want to do it is not from foreigners that protection preserves and defends us it is from ourselvespp5 strongon the fallacy of protecting infant industriesstrong what are really infant industries have no more chance in the struggle for governmental encouragement than infant pigs with fullgrown swine about a mealtub not merely is the encouragement likely to go to industries that do not need it but is likely to go to industries that can be maintained only in this way and thus to cause absolute loss to the community by diverting labor and capital from remunerative industriespp6 strongprotectionism forcestrong trade does not require force free trade consists simply in letting people buy and sell as they want to buy and sell emit is protection that requires forceem for it consists in preventing people from doing what they want to do protective tariffs are as much applications of force as are blockading squadrons and their object is the sameto prevent trade the difference between the two is that blockading squadrons are a means whereby nations seek to prevent their enemies from trading protective tariffs are a means whereby nations attempt to prevent their own people from trading emwhat protection teaches us is to do to ourselves in time of peace what enemies seek to do to us in time of warempp7 strongon the fallacy of trade retaliationstrong and in the same way for any nation to restrict the freedom of its own citizens to trade because other nations so restrict the freedom of their citizens is a policy of the biting off ones nose to spite ones face order other nations may injure us by the imposition of taxes which tend to impoverish their own citizens for as denizens of the world it is to our real interest that all other denizens of the world should be prosperous but no other nation can thus injure us so much as we shall injure ourselves if we impose similar taxes upon our own citizens by way of retaliationpblockquote
pstronghappy birthday to henry georgestrong his brilliant and timeless insights about international trade protectionism and trade retaliation are just as fresh and relevant today as in the late 1800s maybe even more so today than ever before given the resurgence during trumps presidency of the popularity of the discredited trade theories of protectionism mercantilism and scarcityismp
pthe post a relnofollow hrefhttpswwwaeiorgcarpediemabirthdayappreciationfortradeeconomisthenrygeorgehewrotemiltonfriedmansfavoritebookoninternationaltradea birthday appreciation for trade economist henry george he wrote milton friedmans favorite book on international tradea appeared first on a relnofollow hrefhttpswwwaeiorgamerican enterprise institute aeiap
|
div classwpblockimage figurea hrefhttpswwwaeiorgwpcontentuploads202009henrygeorgejpgx91208img alt width446 srchttpswwwaeiorgwpcontentuploads202009henrygeorgejpgx91208 classwpimage1008577632 height251afigurediv pyesterday marked trade economist henry georges 183nd birthday born september 2 philadelphia 1839 died october 29 1897 honor henry georges legacy significant contributions advancing principles free trade warning dangers protectionism annual tribute greatest trade economists time relnoreferrer noopener hrefhttpsenwikipediaorgwikihenry_george target_blankhenry georgeap pthe seven excerpts henry georges 1886 book ema relnoreferrer noopener hrefhttpswwwamazoncomprotectionfreetradeexaminationinterestsdp0911312838refsr_1_1ieutf8qid1465749551sr81keywordshenrygeorgefreetrade target_blankprotection free tradea emwhich milton friedmans favorite book trade according emcato instituteems jim powell wrote henry george classic 2016 emwall street journalem oped relnoreferrer noopener hrefhttpswwwwsjcomarticlesmiltonfriedmansfavoritebookontrade1465597043 target_blankmilton friedmans favorite book tradea friedman called rhetorically brilliant book written trade book read entirely congressional record according powell emprotection free tradeem probably best book trade written americas compared adam smiths emwealth nationsem george mason economist relnoreferrer noopener hrefhttpswwwtheamericaninterestcom20090501anticapitalistrerun target_blanktyler cowen wrote 2009a georges 1886 book remains bestargued tract free trade dayp psome henry george quotes italics added featured jim powells 2016 emwall street journalem oped ive expanded including additional quotes text emprotection free tradeem relnoreferrer noopener hrefhttpwwweconliborglibraryypdbooksgeorgegrgpfthtml target_blankavailable online herea emthe liberty fundem wrote year book required reading donald trump peter navarro protectionistsscarctityists think trade winlose foolishly mistakenly naively advocate tariffs protectionism way united states better economicallyp blockquote classwpblockquotep1 strongmaximize imports exportsstrong foreigners bring goods cheaper shall gainers imports compared exports better trade foreigners liberal productions let return productions ruin industry way ruin industry bringing want save necessity work possible ought dreadfulppstrong2 voluntary trade mutually beneficial strongtrade invasion involve aggression resistance mutual consent gratification trade parties agree itpp3 strongexposing protectionist fallaciesstrong profitable international trade value imports exceed value exports pay profitable trading voyage return cargo exceed value cargo carried possible nations parties commerce normal trade commodities carried places relatively cheap places relatively dear value increased transportation cargo arrived destination higher value leaving port exportation theory trade profitable exports exceed imports way countries trade profitably carry commodities places relatively dear places relatively cheap international trade transactions exportation manufactured ice west indies new england exportation hothouse fruits new england west indies enable countries export larger values imported emon theory ships sunk sea better commercial world ships left country sunk reach country protectionist principles quickest means enriching world countries enjoy maximum exports minimum importsempp4 strongexposing tariff fallaciesstrong trade parties mutually desire trade actions reciprocal buy find willing sell sell willing buy americans want buy foreign goods foreign goods sold tariff efficient cause trade tariff aims prevent desire americans buy foreign goods desire foreign producers sell protection prevents protected want foreigners protection preserves defends ourselvespp5 strongon fallacy protecting infant industriesstrong infant industries chance struggle governmental encouragement infant pigs fullgrown swine mealtub merely encouragement likely industries need likely industries maintained way cause absolute loss community diverting labor capital remunerative industriespp6 strongprotectionism forcestrong trade require force free trade consists simply letting people buy sell want buy sell emit protection requires forceem consists preventing people want protective tariffs applications force blockading squadrons object sameto prevent trade difference blockading squadrons means nations seek prevent enemies trading protective tariffs means nations attempt prevent people trading emwhat protection teaches time peace enemies seek time warempp7 strongon fallacy trade retaliationstrong way nation restrict freedom citizens trade nations restrict freedom citizens policy biting ones nose spite ones face order nations injure imposition taxes tend impoverish citizens denizens world real interest denizens world prosperous nation injure shall injure impose similar taxes citizens way retaliationpblockquote pstronghappy birthday henry georgestrong brilliant timeless insights international trade protectionism trade retaliation fresh relevant today late 1800s maybe today given resurgence trumps presidency popularity discredited trade theories protectionism mercantilism scarcityismp pthe post relnofollow hrefhttpswwwaeiorgcarpediemabirthdayappreciationfortradeeconomisthenrygeorgehewrotemiltonfriedmansfavoritebookoninternationaltradea birthday appreciation trade economist henry george wrote milton friedmans favorite book international tradea appeared relnofollow hrefhttpswwwaeiorgamerican enterprise institute aeiap
|
6313d64702ef6cfc4c3398cf
|
Hume on the Rise And Progress of the Arts And Sciences
|
blockquotepavarice or the desire of gain is an universal passion which operates at all times in all places and upon all persons but curiosity or the love of knowledge has a very limited influence and requires youth leisure education genius and example to make it govern any person you will never want booksellers while there are buyers of books but there may frequently be readers where there are no authorspblockquote
pdavid hume explaining why its more difficult to a hrefhttpof20the20rise20and20progress20of20the20arts20and20sciencesexplain the progress of the arts and sciencea than economic progress even if the latter may depend on the former and here is hume on geography and the growth of the arts and sciencesp
blockquotepbut the divisions into small states are favourable to learning by stopping the progress of authority as well as that of power reputation is often as great a fascination upon men as sovereignty and is equally destructive to the freedom of thought and examination but where a number of neighbouring states have a great intercourse of arts and commerce their mutual jealousy keeps them from receiving too lightly the law from each other in matters of taste and of reasoning and makes them examine every work of art with the greatest care and accuracy the contagion of popular opinion spreads not so easily from one place to another it readily receives a check in some state or other where it concurs not with the prevailing prejudices and nothing but nature and reason or at least what bears them a strong resemblance can force its way through all obstacles and unite the most rival nations into an esteem and admiration of itp
pin china there seems to be a pretty considerable stock of politeness and science which in the course of so many centuries might naturally be expected to ripen into some thing more perfect and finished than what has yet arisen from them but china is one vast empire speaking one language governed by one law and sympathizing in the same manners the authority of any teacher such as confucius was propagated easily from one corner of the empire to the other none had courage to resist the torrent of popular opinion and posterity was not bold enough to dispute what had been universally received by their ancestors this seems to be one natural reason why the sciences have made so slow a progress in that mighty empirep
pif we consider the face of the globe europe of all the four parts of the world is the most broken by seas rivers and mountains and greece of all countries of europe hence these regions were naturally divided into several distinct governments and hence the sciences arose in greece and europe has been hitherto the most constant habitation of thempblockquote
psee tylers a hrefhttpswwwamazoncomgpproduct0674001885ieutf8tagmarginalrevol20linkcodeas2camp1789creative9325creativeasin0674001885in praise of commericial culturea for more humean themesp
pthe post a relnofollow hrefhttpmarginalrevolutioncommarginalrevolution202209humeontheriseandprogressoftheartsandscienceshtmlhume on the rise and progress of the arts and sciencesa appeared first on a relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap
|
blockquotepavarice desire gain universal passion operates times places persons curiosity love knowledge limited influence requires youth leisure education genius example govern person want booksellers buyers books frequently readers authorspblockquote pdavid hume explaining difficult hrefhttpof20the20rise20and20progress20of20the20arts20and20sciencesexplain progress arts sciencea economic progress depend hume geography growth arts sciencesp blockquotepbut divisions small states favourable learning stopping progress authority power reputation great fascination men sovereignty equally destructive freedom thought examination number neighbouring states great intercourse arts commerce mutual jealousy keeps receiving lightly law matters taste reasoning makes examine work art greatest care accuracy contagion popular opinion spreads easily place readily receives check state concurs prevailing prejudices nature reason bears strong resemblance force way obstacles unite rival nations esteem admiration itp pin china pretty considerable stock politeness science course centuries naturally expected ripen thing perfect finished arisen china vast empire speaking language governed law sympathizing manners authority teacher confucius propagated easily corner empire courage resist torrent popular opinion posterity bold dispute universally received ancestors natural reason sciences slow progress mighty empirep pif consider face globe europe parts world broken seas rivers mountains greece countries europe regions naturally divided distinct governments sciences arose greece europe hitherto constant habitation thempblockquote psee tylers hrefhttpswwwamazoncomgpproduct0674001885ieutf8tagmarginalrevol20linkcodeas2camp1789creative9325creativeasin0674001885in praise commericial culturea humean themesp pthe post relnofollow hrefhttpmarginalrevolutioncommarginalrevolution202209humeontheriseandprogressoftheartsandscienceshtmlhume rise progress arts sciencesa appeared relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap
|
6313d6a302ef6cfc4c3398dd
|
“Follow the science”
|
blockquotepto attend the 2023 assa annual meeting all registrants will be required to be vaccinated against covid19 and to have received at least one booster highquality masks ie kn95 or better will be required in all indoor conference spaces these requirements are planned for the wellbeing of all participantspblockquote
pthat is a relnoopener hrefhttpsconfaeaweborg target_blankfrom the aeaa reallyp
peven the arlington county public library is doing better than that did someone do a costbenefit analysis if so may i see it and if this is optimal why are no private american businesses following suit can you name one outside of some health care settings how far do you have to go to find an institution profit or nonprofit doing the samep
phow about allowing a members vote on this or should i just be happy that the aea is making itself irrelevant at such a rapid pace it is remarkable the speed at which the economics profession isnt really about economics any morep
pfor the pointer here i thank msp
pthe post a relnofollow hrefhttpmarginalrevolutioncommarginalrevolution202209followthesciencehtmlfollow the sciencea appeared first on a relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap
|
blockquotepto attend 2023 assa annual meeting registrants required vaccinated covid19 received booster highquality masks ie kn95 better required indoor conference spaces requirements planned wellbeing participantspblockquote pthat relnoopener hrefhttpsconfaeaweborg target_blankfrom aeaa reallyp peven arlington county public library better costbenefit analysis optimal private american businesses following suit outside health care settings far find institution profit nonprofit samep phow allowing members vote happy aea making irrelevant rapid pace remarkable speed economics profession isnt economics morep pfor pointer thank msp pthe post relnofollow hrefhttpmarginalrevolutioncommarginalrevolution202209followthesciencehtmlfollow sciencea appeared relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap
|
6313d6af02ef6cfc4c3398df
|
Water problems in Jackson, Mississippi
|
pi am now reading quite a few analyses of the problem and so few mention price even when written by economists i find a relnoopener hrefhttpsmississippitodayorg20210324whyjacksonswatersystemisbroken target_blankthis articlea somewhat usefulp
blockquotepwe are a city with very high levels of poverty and its difficult for us to raise the rates enough to do large scale replacement type projects and not make it unaffordable to live in the city of jackson said former city councilman melvin priester jrp
pyet the cost of jacksons poor quality water is still passed on to families who dont trust the tap and purchase bottled water which can cost a family of four 50100 a month to drink insteadp
pthe city raised water rates in 2013 but the siemens deal penned the same year came with an onslaught of problems including the installation of faulty water meters and meters that measured water in gallons instead of the correct cubic feet this made any benefits of the rate increase virtually impossible to seep
pthe results have been nonsensical over the past several years the city has mailed exorbitant bills to some customers and none to others sometimes the charges werent based on how much water a household used and other times city officials advised residents to a relnoreferrer noopener hrefhttpswwwjacksonfreepresscomnews2015nov24billsbillsbillsjacksonresidentsconfusedneww target_blankpay what they think they owea past officials said the city lacked the manpower and expertise in the billing department to manually rectify the account issues with any speedp
pin trying to protect people during the persistent billing blunders the city has at times instituted noshutoff policies which demonstrate compassion but havent helped to compel paymentp
ptoday more than 8000 customers or nearly onesixth of the citys customer base still arent receiving bills nearly 16000 customers owe more than 100 or are more than 90 days past due a city spokesperson told mississippi today jackson water customers owe a total of 903 millionp
pas a result the city continues to miss out on tens of millions of water revenues in 2016 when officials first uncovered the issue the citys actual water sewer collections during the previous year was a startling a relnoreferrer noopener hrefhttpswwwscribdcomdoc307112079jacksonwaterrevenuereport2016download target_blank32 less than projecteda a roughly 26 million shortfallpblockquote
pand most generallyp
blockquotepthe nature of local politics is that city governments will tend to neglect utilities until they break because theyre literally buried he said one of the things that is a perennial challenge for governments that operate water systems is that the quality of the water system is very hard for people to observe but the price is very easy for them to observepblockquote
pa relnoopener hrefhttpswwwwsjcomarticlesjacksonwatercrisisaginginfrastructure11662132216 target_blankfrom wsja here is some important background informationp
blockquotepunlike bridges roads and subway lines clean drinking water isnt primarily funded by taxes more than 90 of the average utilitys revenues come directly from constituents water billspblockquote
pin other words the price is too low and government failure is the reason why a higher price is no fun for a relatively poor set of jackson buyers but the citys per capita income is 22k or so and plenty of countries in that income range have satisfactory water systems where you can shower without closing your mouth you just have to get the institutions and incentives right it is remarkable to me how few people in the public sphere are making theses relatively straightforward pointsp
pthe post a relnofollow hrefhttpmarginalrevolutioncommarginalrevolution202209waterproblemsinjacksonmississippihtmlwater problems in jackson mississippia appeared first on a relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap
|
pi reading analyses problem mention price written economists find relnoopener hrefhttpsmississippitodayorg20210324whyjacksonswatersystemisbroken target_blankthis articlea somewhat usefulp blockquotepwe city high levels poverty difficult raise rates large scale replacement type projects unaffordable live city jackson said city councilman melvin priester jrp pyet cost jacksons poor quality water passed families dont trust tap purchase bottled water cost family 50100 month drink insteadp pthe city raised water rates 2013 siemens deal penned year came onslaught problems including installation faulty water meters meters measured water gallons instead correct cubic feet benefits rate increase virtually impossible seep pthe results nonsensical past years city mailed exorbitant bills customers charges werent based water household times city officials advised residents toa relnoreferrer noopener hrefhttpswwwjacksonfreepresscomnews2015nov24billsbillsbillsjacksonresidentsconfusedneww target_blankpay think oweapast officials said city lacked manpower expertise billing department manually rectify account issues speedp pin trying protect people persistent billing blunders city times instituted noshutoff policies demonstrate compassion havent helped compel paymentp ptoday 8000 customers nearly onesixth citys customer base arent receiving bills nearly 16000 customers owe 100 90 days past city spokesperson told mississippi today jackson water customers owe total 903 millionp pas result city continues miss tens millions water revenues 2016 officials uncovered issue citys actual water sewer collections previous year startlinga relnoreferrer noopener hrefhttpswwwscribdcomdoc307112079jacksonwaterrevenuereport2016download target_blank32 projecteda roughly 26 million shortfallpblockquote pand generallyp blockquotepthe nature local politics city governments tend neglect utilities break theyre literally buried said things perennial challenge governments operate water systems quality water system hard people observe price easy observepblockquote pa relnoopener hrefhttpswwwwsjcomarticlesjacksonwatercrisisaginginfrastructure11662132216 target_blankfrom wsja important background informationp blockquotepunlike bridges roads subway lines clean drinking water isnt primarily funded taxes 90 average utilitys revenues come directly constituents water billspblockquote pin words price low government failure reason higher price fun relatively poor set jackson buyers citys capita income 22k plenty countries income range satisfactory water systems shower closing mouth institutions incentives right remarkable people public sphere making theses relatively straightforward pointsp pthe post relnofollow hrefhttpmarginalrevolutioncommarginalrevolution202209waterproblemsinjacksonmississippihtmlwater problems jackson mississippia appeared relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap
|
6315277c8aabf6de0de5928b
|
Mandated vaccine boosters for the AEA meetings?
|
pyes a relnoopener hrefhttpsconfaeaweborg target_blankthe new aea regulationsa will mandate vaccine boosters for attendance at the new orleans meetings not just two jabs but yes boosters at least one of themp
pa relnoopener hrefhttpsmarginalrevolutioncommarginalrevolution202209followthesciencehtml target_blanklike the n95 or stronger mask mandatea this seems off base and possibly harmful to public health as well here are a few pointsp
p1 the regulations valorize booster with an older strain and count infection with a recent strain for nothing in fact the latter is considerably more valuable most of all to estimate a persons public safety impact on others so the regulations simply target the wrong variablep
p1b people who are boosted might even be less likely to have caught the newer strains presumably the boosters are at least somewhat useful thus they are potentially emmore dangerousem to others not less being on average immunologically more naive ideally you want a batch of attendees who just had covid two or three months agop
p2 a relnoopener hrefhttpswwwusnewscomnewshealthnewsarticles20220808undervaccinationnationcovidboostereffortstrugglinginus target_blankmore than threequarters of americansa have not had a booster to date very likely the percentage of potential aea attendees with boosters stands at a considerably higher level still this is a fairly exclusionary policy and pretty far from what most americans consider to be an acceptable regulationp
p2b to be clear i had my booster right away even though i expected it would make me sick for two days it did i am far from being antibooster i am glad i had my booster but i also understand full well the distinction between getting a booster at the time was the right decision and we should mandate booster shots today they are very different dont just positively mood affiliate with boosters think through the actual policiesp
p3 blacks are a relatively undervaccinated group and probably they are less boosted as well the same may or may not be true for black potential aea attendees but it is certainly possible after all the talk of dei and i for one would like to see more inclusion why are we making inclusion harder and for no good medical reasonp
p3b how about potential attendees from africa latin america and other regions where boosters are harder to come by what are their rates of being boosted do they all have to fly to america a few days earlier line up boosters and hope the ill effects wear off by the time of the meetings why are we doing this to themp
p3c will the same booster requirements be applied to hotel staff and contractors somehow i think not maybe that is a sign the boosters are not so important for conference wellbeing after allp
p4 many people are in a position right now where emthey should not boostem lets say you had covid a few months ago and are wondering if you should get a booster now or soon i looked into this recently and found the weight of opinion was that you should wait at least six months for your immune system to process the recent infection that did not seem to be settled science but rather a series of judgments admittedly with uncertainty so now lets take those people who were not boosted had a new strain of covid recently and want to go to the aea meetings the first two of three there cover ema lot of peopleem they have to get boosted and in expected value terms emboosting is bad for themem did this argument even occur to the decisionmakers at the aeap
p5 the aea mentions nothing about religious or other exceptions to the policy maybe there are under the table exceptions but really why not spell out the actual policy here and if there are no exceptions come right out and tell us and explain why so few other institutions have chosen the no exceptions path and why the aea should be different as a side note it is not so easy to process exceptions for the subset of the 13000 possible attendees who want them does the aea have this capacityp
pagain this is simply a poorly thought out policy whether for n95 masks or for boosters i hope the aea will discard it as soon as possible or how about a simple open poll of membership simple yes or not on the current proposalp
pthe post a relnofollow hrefhttpmarginalrevolutioncommarginalrevolution202209mandatedvaccineboostersfortheaeameetingshtmlmandated vaccine boosters for the aea meetingsa appeared first on a relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap
|
pyes relnoopener hrefhttpsconfaeaweborg target_blankthe new aea regulationsa mandate vaccine boosters attendance new orleans meetings jabs yes boosters themp pa relnoopener hrefhttpsmarginalrevolutioncommarginalrevolution202209followthesciencehtml target_blanklike n95 stronger mask mandatea base possibly harmful public health pointsp p1 regulations valorize booster older strain count infection recent strain fact considerably valuable estimate persons public safety impact regulations simply target wrong variablep p1b people boosted likely caught newer strains presumably boosters somewhat useful potentially emmore dangerousem average immunologically naive ideally want batch attendees covid months agop p2 relnoopener hrefhttpswwwusnewscomnewshealthnewsarticles20220808undervaccinationnationcovidboostereffortstrugglinginus target_blankmore threequarters americansa booster date likely percentage potential aea attendees boosters stands considerably higher level fairly exclusionary policy pretty far americans consider acceptable regulationp p2b clear booster right away expected sick days far antibooster glad booster understand distinction getting booster time right decision mandate booster shots today different dont positively mood affiliate boosters think actual policiesp p3 blacks relatively undervaccinated group probably boosted true black potential aea attendees certainly possible talk dei like inclusion making inclusion harder good medical reasonp p3b potential attendees africa latin america regions boosters harder come rates boosted fly america days earlier line boosters hope ill effects wear time meetings themp p3c booster requirements applied hotel staff contractors think maybe sign boosters important conference wellbeing allp p4 people position right emthey boostem lets covid months ago wondering booster soon looked recently found weight opinion wait months immune system process recent infection settled science series judgments admittedly uncertainty lets people boosted new strain covid recently want aea meetings cover ema lot peopleem boosted expected value terms emboosting bad themem argument occur decisionmakers aeap p5 aea mentions religious exceptions policy maybe table exceptions spell actual policy exceptions come right tell explain institutions chosen exceptions path aea different note easy process exceptions subset 13000 possible attendees want aea capacityp pagain simply poorly thought policy n95 masks boosters hope aea discard soon possible simple open poll membership simple yes current proposalp pthe post relnofollow hrefhttpmarginalrevolutioncommarginalrevolution202209mandatedvaccineboostersfortheaeameetingshtmlmandated vaccine boosters aea meetingsa appeared relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap
|
631528058aabf6de0de5929d
|
Insurance markets in everything
|
blockquotepxcel confirmed to contact denver7 that 22000 customers who had signed up for the a hrefhttpscomyxcelenergycomsresidentialheatingcoolingacrewardscolorado ac rewards programa were locked out of their smart thermostats for hours on tuesdayp
pits a voluntary program lets remember that this is something that customers choose to be a part of based on the incentives said emmett romine vice president of customer solutions and innovation at xcelp
pcustomers receive a 100 credit for enrolling in the program and 25 annually but romine said customers also agree to give up some control to save energy and money and make the system more reliablepblockquote
pbasically their ac was shut off and some of the homes had temperatures as high as 88 fahrenheit sounds like an ok arrangement to me here is a relnoopener hrefhttpswwwthedenverchannelcomnewscontactdenver7thousandsofxcelcustomerslockedoutofthermostatsduringenergyemergency target_blankthe full storya via tom hynesp
pthe post a relnofollow hrefhttpmarginalrevolutioncommarginalrevolution202209insurancemarketsineverything5htmlinsurance markets in everythinga appeared first on a relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap
|
blockquotepxcel confirmed contact denver7 22000 customers signed thea hrefhttpscomyxcelenergycomsresidentialheatingcoolingacrewardscolorado ac rewards programawere locked smart thermostats hours tuesdayp pits voluntary program lets remember customers choose based incentives said emmett romine vice president customer solutions innovation xcelp pcustomers receive 100 credit enrolling program 25 annually romine said customers agree control save energy money system reliablepblockquote pbasically ac shut homes temperatures high 88 fahrenheit sounds like ok arrangement relnoopener hrefhttpswwwthedenverchannelcomnewscontactdenver7thousandsofxcelcustomerslockedoutofthermostatsduringenergyemergency target_blankthe storya tom hynesp pthe post relnofollow hrefhttpmarginalrevolutioncommarginalrevolution202209insurancemarketsineverything5htmlinsurance markets everythinga appeared relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap
|
6316793ce0ccaf8716d42cb0
|
Liz Truss’s victory speech was crushingly banal
|
pthere was a moment in the second conservative leadership debate when a relnoreferrer noopener hrefhttpswwwnewstatesmancomtagliztruss target_blankliz trussa seemed to overcome her awkward speaking style that moment is long gone at a conference centre today a few hundred yards from parliament tory mps peers and staffers gathered to welcome their new leader many looked beleaguered after the eightweek contest the great and good of the conservative party shuffled around sharing holiday anecdotes to a soundtrack of light classical guitar a smiling tom tugendhat embraced people potential cabinet colleagues looked each other up and down on the sidelines thrse coffey strode down the aisle minutes before the start of proceedingsp
pthe chair of the party andrew stephenson took to the stage to declare that today marks the culmination of the conservative leadership election eliciting a few faint whoops from the front of the crowd the chairman of the 1922 committee graham brady perched behind stephenson gripping a giant blue folder containing the result as stephenson welcomed the candidates into the room a relnoreferrer noopener hrefhttpswwwnewstatesmancomtagliztruss target_blanktrussa bounced out from backstage with a grin a relnoreferrer noopener hrefhttpswwwnewstatesmancomtagrishisunak target_blanksunaka shuffled behind with a grimace hed forgotten to smile then remembered too latep
pwe knew truss had won but brady was there to tell us by how much fifty seven per cent to sunaks 43 per cent not quite the landslide the polls predicted her speech seemed written for a thumping victory not a relnoreferrer noopener hrefhttpswwwnewstatesmancomchartoftheday202209liztrussleadershipelectionwinvotes target_blankthe smallest winning margina in a tory leadership contest in over 20 years the result meant that shoring up unity in her party was key but that didnt seem to be her priority she didnt shake sunaks hand after the announcement her tribute to him was generic she positioned herself as johnsons acolyte and addressed boris directly he was she said a hero from kyiv to carlisle an honest appraisal of johnsons unpopularity in scotland but not a statement to bring together a party that had just defenestrated him p
pa question hanging over trusss victory is how quickly she can pivot from addressing the conservative party membership to the public today truss didnt speak to the electorate she spoke to her fans i know our beliefs resonate with the british people she said confidently by which she meant freedom the ability to control your own life [and] low taxes even if onlya relnoreferrer noopener hrefhttpswwwnewstatesmancompoliticsconservatives202208trussandsunakslurchtotherightjeopardises2019coalition target_blank 10 per centa of 2019 toryem emvoters view the latter as a priority levelling up wasnt mentioned she nodded to the energy crisis but kept it short at one point she said i will deliver for the nhs there was silence the crowd waited for details but none came so they applauded anywayp
pstrongem[see also a hrefhttpswwwnewstatesmancompoliticsconservatives202209wholiztrusscabinetpredictionswhat could liz trusss cabinet look like]aemstrongp
|
pthere moment second conservative leadership debate relnoreferrer noopener hrefhttpswwwnewstatesmancomtagliztruss target_blankliz trussa overcome awkward speaking style moment long gone conference centre today yards parliament tory mps peers staffers gathered welcome new leader looked beleaguered eightweek contest great good conservative party shuffled sharing holiday anecdotes soundtrack light classical guitar smiling tom tugendhat embraced people potential cabinet colleagues looked sidelines thrse coffey strode aisle minutes start proceedingsp pthe chair party andrew stephenson took stage declare today marks culmination conservative leadership election eliciting faint whoops crowd chairman 1922 committee graham brady perched stephenson gripping giant blue folder containing result stephenson welcomed candidates room relnoreferrer noopener hrefhttpswwwnewstatesmancomtagliztruss target_blanktrussa bounced backstage grin relnoreferrer noopener hrefhttpswwwnewstatesmancomtagrishisunak target_blanksunaka shuffled grimace hed forgotten smile remembered latep pwe knew truss won brady tell seven cent sunaks 43 cent landslide polls predicted speech written thumping victory relnoreferrer noopener hrefhttpswwwnewstatesmancomchartoftheday202209liztrussleadershipelectionwinvotes target_blankthe smallest winning margina tory leadership contest 20 years result meant shoring unity party key didnt priority didnt shake sunaks hand announcement tribute generic positioned johnsons acolyte addressed boris directly said hero kyiv carlisle honest appraisal johnsons unpopularity scotland statement bring party defenestrated himp pa question hanging trusss victory quickly pivot addressing conservative party membership public today truss didnt speak electorate spoke fans know beliefs resonate british people said confidently meant freedom ability control life [and] low taxes onlya relnoreferrer noopener hrefhttpswwwnewstatesmancompoliticsconservatives202208trussandsunakslurchtotherightjeopardises2019coalition target_blank 10 centa 2019 toryem emvoters view priority levelling wasnt mentioned nodded energy crisis kept short point said deliver nhs silence crowd waited details came applauded anywayp pstrongem[see hrefhttpswwwnewstatesmancompoliticsconservatives202209wholiztrusscabinetpredictionswhat liz trusss cabinet look like]aemstrongp
|
631679fae0ccaf8716d42cca
|
The Return of Privateering?
|
blockquotepa hrefhttpstexassignalcomlancegoodenwantstomakeprivateeringgreatagainimg sizesmaxwidth 300px 100vw 300px srchttpmarginalrevolutioncomwpcontentuploads202209confiance_kent_fight300x238jpg alt width300 srcsethttpmarginalrevolutioncomwpcontentuploads202209confiance_kent_fight300x238jpg 300w httpmarginalrevolutioncomwpcontentuploads202209confiance_kent_fight1024x812jpg 1024w httpmarginalrevolutioncomwpcontentuploads202209confiance_kent_fight768x609jpg 768w httpmarginalrevolutioncomwpcontentuploads202209confiance_kent_fightjpg 1514w classwpimage84234 height238texassignala rep lance gooden a republican who represents texas 5th district has introduced legislation that would allow us citizens to seize the yachts jets and other property belonging to russian oligarchs who have been sanctioned in response to the invasion of ukraine in other words privateeringp
pin the age of sail it was common for nations to issue letters of marque licensing private citizens to raid the shipping of enemy nations the practice died down in the 19th century with the paris declaration of 1856 outlawing privateers however the united states never signed the paris declaration and article i of the constitution gives congress the power to issue letters of marquep
pgoodens a hrefhttpsmcusercontentcombad9f5fdbb6d48e3db97b6099files4bea066c42cc9331e8014125ce93e956goodtx_081_xmlpdfbilla would require president biden to issue letters of marque to seize yachts and other assets belonging to sanctioned russian citizens goodens office even a hrefhttpswwwfoxnewscompoliticsgoodenamericansseizerussianyachtsplanesoligarchsukraineinvasionsaysa that letters of marque could be issued to hackers to go after russia in cyberspacepblockquote
pthere are three questions first should some russian citizens be sanctioned second should assets belonging to sanctioned russian citizens be seized third should privateers be able to do the seizing under a legal regime there is a lot of room for debate on the first two questions but oddly these questions arent debated sanctions of this kind are common and broadly regarded as legitimate although likely overused in my view the latter question arouses the most debate but is to me the easiest to answer sure why not privateering worked well in the wars of the 19th century and we could likely have saved trillions by using a hrefhttpsmarginalrevolutioncomsosamabountybounties in the war in afghanistanap
pheres a hrefhttpswwwindependentorgpdftirtir_11_04_06_tabarrokpdfmy paper on privateeringa and my story about the time a hrefhttpswwwwilsonquarterlycomquarterlywinter2011thesevenmillionthebountyhunterspursuitofjusticei went bounty hunting in baltimoreap
pthe post a relnofollow hrefhttpmarginalrevolutioncommarginalrevolution202209thereturnofprivateeringhtmlthe return of privateeringa appeared first on a relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap
|
blockquotepa hrefhttpstexassignalcomlancegoodenwantstomakeprivateeringgreatagainimg sizesmaxwidth 300px 100vw 300px srchttpmarginalrevolutioncomwpcontentuploads202209confiance_kent_fight300x238jpg alt width300 srcsethttpmarginalrevolutioncomwpcontentuploads202209confiance_kent_fight300x238jpg 300w httpmarginalrevolutioncomwpcontentuploads202209confiance_kent_fight1024x812jpg 1024w httpmarginalrevolutioncomwpcontentuploads202209confiance_kent_fight768x609jpg 768w httpmarginalrevolutioncomwpcontentuploads202209confiance_kent_fightjpg 1514w classwpimage84234 height238texassignala rep lance gooden republican represents texas 5th district introduced legislation allow citizens seize yachts jets property belonging russian oligarchs sanctioned response invasion ukraine words privateeringp pin age sail common nations issue letters marque licensing private citizens raid shipping enemy nations practice died 19th century paris declaration 1856 outlawing privateers united states signed paris declaration article constitution gives congress power issue letters marquep pgoodensa hrefhttpsmcusercontentcombad9f5fdbb6d48e3db97b6099files4bea066c42cc9331e8014125ce93e956goodtx_081_xmlpdfbillawould require president biden issue letters marque seize yachts assets belonging sanctioned russian citizens goodens office evena hrefhttpswwwfoxnewscompoliticsgoodenamericansseizerussianyachtsplanesoligarchsukraineinvasionsaysathat letters marque issued hackers russia cyberspacepblockquote pthere questions russian citizens sanctioned second assets belonging sanctioned russian citizens seized privateers able seizing legal regime lot room debate questions oddly questions arent debated sanctions kind common broadly regarded legitimate likely overused view question arousesthe debate easiest answer sure privateering worked wars 19th century likely saved trillions hrefhttpsmarginalrevolutioncomsosamabountybounties war afghanistanap pheres hrefhttpswwwindependentorgpdftirtir_11_04_06_tabarrokpdfmy paper privateeringa story thetime hrefhttpswwwwilsonquarterlycomquarterlywinter2011thesevenmillionthebountyhunterspursuitofjusticei went bounty hunting baltimoreap pthe post relnofollow hrefhttpmarginalrevolutioncommarginalrevolution202209thereturnofprivateeringhtmlthe return privateeringa appeared relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap
|
63191c276d70bd120426c7b8
|
Russ Roberts: Why Economists Are Irrelevant
|
div
picture
source sizesminwidth 600px 331px 100vw typeimagewebp srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202209russrobertseconomicsjpgwebp 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202209russrobertseconomics1200x675jpgwebp 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202209russrobertseconomics800x450jpgwebp 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202209russrobertseconomics600x338jpgwebp 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202209russrobertseconomics331x186jpgwebp 331w
source sizesminwidth 600px 331px 100vw typeimagejpeg srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202209russrobertseconomicsjpg 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202209russrobertseconomics1200x675jpg 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202209russrobertseconomics800x450jpg 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202209russrobertseconomics600x338jpg 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202209russrobertseconomics331x186jpg 331w
img width1200 altrussrobertseconomics srchttpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202209russrobertseconomics800x450jpg height675
picture
div
pspanquoti came to realize that economistsspanspantend to focus on things that can be measuredquot says russ roberts host of the longrunning podcast a hrefhttpswwwecontalkorgemecontalkema and author of the new book a hrefhttpswwwamazoncomexecobidosasin0593418255reasonmagazinea20iwild problemsia quotspanspandignity is hard to measure a sense of self is hard to measure belonging is hard to measure a feeling of transcendence is hard to measure matteringthat you are important that people look to you [these sorts of things are]spanspan about the life welllived and theyre not about getting the most out of your money theyre not about what the interest rates are next week and economists truthfully have virtually nothing to say about these thingsquotspanp
pspanroberts is an economist by training whose great theme over the past 40plus years has been the fundamental inadequacy of his chosen discipline to really comprehend what matters most to the people it seeks to explain and understand spanispanwild problems spanispandeals with the decisions that define ussuch as whether to marry whether to have kids and what kind of work to pursuethat dont yield to anything like easy costbenefit analysesspanp
pspani talk with roberts about how to navigate the increasing amount of choice most of us have gained over the past 50 years and how to make sense of a world that is richer than ever in material resources but seemingly lacking in deeper meaning we discuss spana hrefhttpsrussrobertsinfoaboutspanroberts own lifespanaspan from earning a phd in economics at the university of chicago in the 1970s to starting spana hrefhttpsrussrobertsinfoecontalkspanemecontalkemspanaspan one of the longestrunning podcasts around to becoming president of spana hrefhttpsshalemacilenspanshalem collegespanaspan a private liberal arts college in israel and the central role that religion plays in his lifespanp
pprevious emreasonem interviews with russ robertsp
pquota hrefhttpsreasoncomvideo20191031whythemiddleclassisbetteroffthanyouthinkwhy the middle class is better off than you thinkaquot october 31 2019p
pquota hrefhttpsreasoncompodcast20180426russrobertspodcastshould you be optimistic about americas futureaquot april 26 2018p
pquota hrefhttpsreasoncomvideo20141008russrobertsadam smiths surprising guide to happiness but not wealthaquot october 8 2014p
pquota hrefhttpsreasoncomvideo20121011russrobertsontheeconomicfalliciesowhy keynesians always get it wrong and most economists tooaquot october 11 2012p
pquota hrefhttpswwwyoutubecomwatchvasvcqxv31d4the price of everythingaquot october 23 2008p
pquota hrefhttpswwwyoutubecomwatchvjenieyd59eewhat you need to know about the bailoutaquot october 7 2008p
ptodays sponsorp
ul
lia hrefhttpsclubeverydaydosecomeveryday dosea is the coffee alternative i start my days with its made from nonpsychedelic mushrooms collagen and nootropics that elevate my mood sharpen my focus and give me an energy boost all without the jitters and digestive issues that come with drinking traditional coffee it tastes great too and is quick and easy to make try riskfree with a 60day moneyback guarantee a hrefhttpsclubeverydaydosecomby going here nowali
ul
pthe post a relnofollow hrefhttpsreasoncompodcast20220907russrobertswhyeconomistsareirrelevantruss roberts why economists are irrelevanta appeared first on a relnofollow hrefhttpsreasoncomreasoncomap
|
div picture source sizesminwidth 600px 331px 100vw typeimagewebp srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202209russrobertseconomicsjpgwebp 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202209russrobertseconomics1200x675jpgwebp 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202209russrobertseconomics800x450jpgwebp 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202209russrobertseconomics600x338jpgwebp 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202209russrobertseconomics331x186jpgwebp 331w source sizesminwidth 600px 331px 100vw typeimagejpeg srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202209russrobertseconomicsjpg 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202209russrobertseconomics1200x675jpg 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202209russrobertseconomics800x450jpg 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202209russrobertseconomics600x338jpg 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202209russrobertseconomics331x186jpg 331w img width1200 altrussrobertseconomics srchttpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202209russrobertseconomics800x450jpg height675 picture div pspanquoti came realize economistsspanspantend focus things measuredquot says russ roberts host longrunning podcast hrefhttpswwwecontalkorgemecontalkema author new book hrefhttpswwwamazoncomexecobidosasin0593418255reasonmagazinea20iwild problemsia quotspanspandignity hard measure sense self hard measure belonging hard measure feeling transcendence hard measure matteringthat important people look [these sorts things are]spanspan life welllived theyre getting money theyre interest rates week economists truthfully virtually thingsquotspanp pspanroberts economist training great theme past 40plus years fundamental inadequacy chosen discipline comprehend matters people seeks explain understand spanispanwild problems spanispandeals decisions define ussuch marry kids kind work pursuethat dont yield like easy costbenefit analysesspanp pspani talk roberts navigate increasing choice gained past 50 years sense world richer material resources seemingly lacking deeper meaning discuss spana hrefhttpsrussrobertsinfoaboutspanroberts lifespanaspan earning phd economics university chicago 1970s starting spana hrefhttpsrussrobertsinfoecontalkspanemecontalkemspanaspan longestrunning podcasts president spana hrefhttpsshalemacilenspanshalem collegespanaspan private liberal arts college israel central role religion plays lifespanp pprevious emreasonem interviews russ robertsp pquota hrefhttpsreasoncomvideo20191031whythemiddleclassisbetteroffthanyouthinkwhy middle class better thinkaquot october 31 2019p pquota hrefhttpsreasoncompodcast20180426russrobertspodcastshould optimistic americas futureaquot april 26 2018p pquota hrefhttpsreasoncomvideo20141008russrobertsadam smiths surprising guide happiness wealthaquot october 8 2014p pquota hrefhttpsreasoncomvideo20121011russrobertsontheeconomicfalliciesowhy keynesians wrong economists tooaquot october 11 2012p pquota hrefhttpswwwyoutubecomwatchvasvcqxv31d4the price everythingaquot october 23 2008p pquota hrefhttpswwwyoutubecomwatchvjenieyd59eewhat need know bailoutaquot october 7 2008p ptodays sponsorp ul lia hrefhttpsclubeverydaydosecomeveryday doseais coffee alternative start days nonpsychedelic mushrooms collagen nootropics elevate mood sharpen focus energy boost jitters digestive issues come drinking traditional coffee tastes great quick easy try riskfree 60day moneyback guaranteea hrefhttpsclubeverydaydosecomby going nowali ul pthe post relnofollow hrefhttpsreasoncompodcast20220907russrobertswhyeconomistsareirrelevantruss roberts economists irrelevanta appeared relnofollow hrefhttpsreasoncomreasoncomap
|
63191c296d70bd120426c7ba
|
Why Are Democrats Dragging Their Feet on the Electoral Count Reform Act?
|
div
picture
source sizesminwidth 600px 331px 100vw typeimagewebp srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202209zumaamericasthirtyfive309002scalede16625735474862400x1350jpgwebp 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202209zumaamericasthirtyfive309002scalede16625735474861200x675jpgwebp 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202209zumaamericasthirtyfive309002scalede1662573547486800x450jpgwebp 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202209zumaamericasthirtyfive309002scalede1662573547486600x338jpgwebp 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202209zumaamericasthirtyfive309002scalede1662573547486331x186jpgwebp 331w
source sizesminwidth 600px 331px 100vw typeimagejpeg srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202209zumaamericasthirtyfive309002scalede16625735474862400x1350jpg 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202209zumaamericasthirtyfive309002scalede16625735474861200x675jpg 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202209zumaamericasthirtyfive309002scalede1662573547486800x450jpg 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202209zumaamericasthirtyfive309002scalede1662573547486600x338jpg 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202209zumaamericasthirtyfive309002scalede1662573547486331x186jpg 331w
img width1200 altjoe biden speaks in front of a podium with the presidential seal with red and blue lighting in the background srchttpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202209zumaamericasthirtyfive309002scalede1662573547486800x450jpg height675
picture
div
pthe way president joe biden tells it republicans are already laying the groundwork to steal the 2024 presidential electionp
pquottheyre working right now as i speak in state after state to give power to decide elections in america to partisans and cronies empowering electiondeniers to undermine democracy itselfquot biden warned in a hrefhttpsreasoncom20220905inphiladelphiajoebidenpeddledacompetingbrandofauthoritarianisman ominousa and a hrefhttpsreasoncom20220907bidenandtrumpstokedivisionwhilecomplainingaboutitovertly politicala a hrefhttpswwwwhitehousegovbriefingroomspeechesremarks20220901remarksbypresidentbidenonthecontinuedbattleforthesoulofthenationspeecha in philadelphia last weekp
pfor biden former president donald trumps slapdash attempt to overturn the results of the 2020 election and the chaos that some of trumps supporters caused at the us capitol on january 6 2021 are harbingers of whats to come quoti will not stand by and watch elections in this country stolen by people who simply refuse to accept that they lostquot biden pledgedp
pin some regards this worry is a legitimate one fealty to trump and his notions about the results of the 2020 presidential election has become a potent litmus test within the republican party the results of this years primary elections have made that much clearp
paccording to an analysis by datanerds at emfivethirtyeightem a hrefhttpsprojectsfivethirtyeightcomrepublicanstrumpelectionfraud195 of the 529a gop candidates running for house senate governor secretary of state or attorney general this november have claimed that the 2020 election was stolen from trump or have taken actions including filing lawsuits or refusing to certify elections results that attempted to block bidens win a mere 71 republican candidates in those same races have said they accept the results of the 2020 election without reservations and the rest are somewhere in the middlep
pa sizable chunk of one of americas two major parties is now partially defined by its willingness not just to go along with trumps electiondenying scheme but to actively embrace it even if most of those candidates lose in november those numbers represent a potentially serious problem for the country heading into the presidential election in 2024p
pso bidens not emtotallyem wrong to be sounding the alarm about this but instead of a hrefhttpsreasoncom20220902trumpdisregardsdemocracywhilebidenignoresitsdangerslecturing votersa or trying to score political points maybe he could try giving that same speech to the democrats in charge of congressp
pits been months since a bipartisan group of senators unveiled the a hrefhttpswwwcollinssenategovimomediadocelectoral_count_reform_and_presidential_transition_improvement_act_of_2022pdfelectoral count reform and presidential transition improvement act of 2022a which is easily the most important and a hrefhttpsreasoncom20220613simplereformscouldpreventelectionchaosstraightforwarda way to prevent a repeat of what nearly happened in january 2021 the bill a hrefhttpsreasoncom20220721thesenateselectionreformbillissurprisinglylogicalandbipartisanwould address the procedural mechanismsa that trump and his allies sought to exploit to overturn the 2020 election it would head off future attempts by state lawmakers and governors to refuse to certify the results of a presidential election and it would clarify that the vice president a hrefhttpsreasoncom20220204mikepencetrumpiswrongihadnorighttooverturntheelectiondoes not have the powera to unilaterally reject the electoral college results as trump a hrefhttpswwwwashingtonpostcompolitics20210914newdetailsunderminepencessupposedheroturnjan6pressureda thenvice president mike pence to dop
pin short the bill doesnt a hrefhttpsreasoncom20210623federalizingelectionswontsavedemocracyoverhaul election rules in partisan waysa or tell states how to conduct elections but it does force states to abide by the results of the elections they conductp
pthats pretty important but the bill seems to be getting shifted to the back burner in congress even as democrats a hrefhttpstwittercompotusstatus1567524341386018817s12trjk_tl_qz63a2_e10gyf8wramp up their rhetorica about republicans trying to destroy democracyp
psen susan collins rmaine one of the bills sponsors quotwould like to see preelection consideration of electoral count act reformquot empoliticoem a hrefhttpswwwpoliticocomnews20220906democratsgaymarriageelection00054662reporteda earlier this week but for now democrats quotare committed to little other than confirming judges and funding the government after a surprisingly fruitful summer session of legislating on firearm access climate and taxes microchip manufacturing and veterans benefitsquot its also possible that senate majority leader chuck schumer dny will cancel a twoweek session scheduled for october so senators facing reelection this year can stay on the campaign trail according to the same empolitico empiecep
pprioritizing winning elections over actually safeguarding them yep that sounds about right after all democratic campaign operations a hrefhttpsreasoncom20220801petermeijerjohngibbsprimarymichigantrumpelectionpelosidcccspent heavilya to a hrefhttpsreasoncom20220518pennsylvaniademocratssaydougmastrianoisadangertodemocracywhydidtheyhelphimwinpromotea some trumploving electiondenying republicans a hrefhttpswwwcprorg20220722democratfundingattemptedinfluencecoloradorepublicanprimaryin primariesa a hrefhttpsreasoncom20220803thedemocraticestablishmentteamedupwithtrumptooustpetermeijerthis yeara while simultaneously warning that those same candidates are existential threats to american democracyp
pplaying those cynical games might help democrats win a few elections they would otherwise have lost but if congress doesnt find the time to pass the electoral count reform act before the end of the year theres little hope that it will ever reach bidens deskbecause republicans are a hrefhttpsprojectsfivethirtyeightcom2022electionforecasthouseexpecteda a hrefhttpswwwrealclearpoliticscomepolls2022houseelectionsmaphtmlto take controla of the house at least after the midtermsp
pbiden says republicans aim to use their attempted subversion of the 2020 election quotas preparation for the 2022 and 2024 electionsquot in ways that quotthreatens the very foundations of our republicquot all the more reason for congressional democrats and republicans who refuse to be complicit in trumps schemes to do the important work of shoring up those foundations now while they still have a chancep
pthe post a relnofollow hrefhttpsreasoncom20220907whyaredemocratsdraggingtheirfeetontheelectoralcountreformactwhy are democrats dragging their feet on the electoral count reform acta appeared first on a relnofollow hrefhttpsreasoncomreasoncomap
|
div picture source sizesminwidth 600px 331px 100vw typeimagewebp srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202209zumaamericasthirtyfive309002scalede16625735474862400x1350jpgwebp 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202209zumaamericasthirtyfive309002scalede16625735474861200x675jpgwebp 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202209zumaamericasthirtyfive309002scalede1662573547486800x450jpgwebp 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202209zumaamericasthirtyfive309002scalede1662573547486600x338jpgwebp 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202209zumaamericasthirtyfive309002scalede1662573547486331x186jpgwebp 331w source sizesminwidth 600px 331px 100vw typeimagejpeg srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202209zumaamericasthirtyfive309002scalede16625735474862400x1350jpg 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202209zumaamericasthirtyfive309002scalede16625735474861200x675jpg 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202209zumaamericasthirtyfive309002scalede1662573547486800x450jpg 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202209zumaamericasthirtyfive309002scalede1662573547486600x338jpg 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202209zumaamericasthirtyfive309002scalede1662573547486331x186jpg 331w img width1200 altjoe biden speaks podium presidential seal red blue lighting background srchttpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202209zumaamericasthirtyfive309002scalede1662573547486800x450jpg height675 picture div pthe way president joe biden tells republicans laying groundwork steal 2024 presidential electionp pquottheyre working right speak state state power decide elections america partisans cronies empowering electiondeniers undermine democracy itselfquot biden warned hrefhttpsreasoncom20220905inphiladelphiajoebidenpeddledacompetingbrandofauthoritarianisman ominousa hrefhttpsreasoncom20220907bidenandtrumpstokedivisionwhilecomplainingaboutitovertly politicala hrefhttpswwwwhitehousegovbriefingroomspeechesremarks20220901remarksbypresidentbidenonthecontinuedbattleforthesoulofthenationspeecha philadelphia weekp pfor biden president donald trumps slapdash attempt overturn results 2020 election chaos trumps supporters caused capitol january 6 2021 harbingers whats come quoti stand watch elections country stolen people simply refuse accept lostquot biden pledgedp pin regards worry legitimate fealty trump notions results 2020 presidential election potent litmus test republican party results years primary elections clearp paccording analysis datanerds emfivethirtyeightem hrefhttpsprojectsfivethirtyeightcomrepublicanstrumpelectionfraud195 529a gop candidates running house senate governor secretary state attorney general november claimed 2020 election stolen trump taken actions including filing lawsuits refusing certify elections results attempted block bidens win mere 71 republican candidates races said accept results 2020 election reservations rest middlep pa sizable chunk americas major parties partially defined willingness trumps electiondenying scheme actively embrace candidates lose november numbers represent potentially problem country heading presidential election 2024p pso bidens emtotallyem wrong sounding alarm instead hrefhttpsreasoncom20220902trumpdisregardsdemocracywhilebidenignoresitsdangerslecturing votersa trying score political points maybe try giving speech democrats charge congressp pits months bipartisan group senators unveiled hrefhttpswwwcollinssenategovimomediadocelectoral_count_reform_and_presidential_transition_improvement_act_of_2022pdfelectoral count reform presidential transition improvement act 2022a easily important hrefhttpsreasoncom20220613simplereformscouldpreventelectionchaosstraightforwarda way prevent repeat nearly happened january 2021 bill hrefhttpsreasoncom20220721thesenateselectionreformbillissurprisinglylogicalandbipartisanwould address procedural mechanismsa trump allies sought exploit overturn 2020 election head future attempts state lawmakers governors refuse certify results presidential election clarify vice president hrefhttpsreasoncom20220204mikepencetrumpiswrongihadnorighttooverturntheelectiondoes powera unilaterally reject electoral college results trump hrefhttpswwwwashingtonpostcompolitics20210914newdetailsunderminepencessupposedheroturnjan6pressureda thenvice president mike pence dop pin short bill doesnt hrefhttpsreasoncom20210623federalizingelectionswontsavedemocracyoverhaul election rules partisan waysa tell states conduct elections force states abide results elections conductp pthats pretty important bill getting shifted burner congress democrats hrefhttpstwittercompotusstatus1567524341386018817s12trjk_tl_qz63a2_e10gyf8wramp rhetorica republicans trying destroy democracyp psen susan collins rmaine bills sponsors quotwould like preelection consideration electoral count act reformquot empoliticoem hrefhttpswwwpoliticocomnews20220906democratsgaymarriageelection00054662reporteda earlier week democrats quotare committed little confirming judges funding government surprisingly fruitful summer session legislating firearm access climate taxes microchip manufacturing veterans benefitsquot possible senate majority leader chuck schumer dny cancel twoweek session scheduled october senators facing reelection year stay campaign trail according empolitico empiecep pprioritizing winning elections actually safeguarding yep sounds right democratic campaign operations hrefhttpsreasoncom20220801petermeijerjohngibbsprimarymichigantrumpelectionpelosidcccspent heavilya hrefhttpsreasoncom20220518pennsylvaniademocratssaydougmastrianoisadangertodemocracywhydidtheyhelphimwinpromotea trumploving electiondenying republicans hrefhttpswwwcprorg20220722democratfundingattemptedinfluencecoloradorepublicanprimaryin primariesa hrefhttpsreasoncom20220803thedemocraticestablishmentteamedupwithtrumptooustpetermeijerthis yearawhile simultaneously warning candidates existential threats american democracyp pplaying cynical games help democrats win elections lost congress doesnt find time pass electoral count reform act end year theres little hope reach bidens deskbecause republicans hrefhttpsprojectsfivethirtyeightcom2022electionforecasthouseexpecteda hrefhttpswwwrealclearpoliticscomepolls2022houseelectionsmaphtmlto controla house midtermsp pbiden says republicans aim use attempted subversion 2020 election quotas preparation 2022 2024 electionsquot ways quotthreatens foundations republicquot reason congressional democrats republicans refuse complicit trumps schemes important work shoring foundations chancep pthe post relnofollow hrefhttpsreasoncom20220907whyaredemocratsdraggingtheirfeetontheelectoralcountreformactwhy democrats dragging feet electoral count reform acta appeared relnofollow hrefhttpsreasoncomreasoncomap
|
631a6d5455ebc349b9f0c70e
|
ICE Almost Deported a 10-Year-Old Cancer Survivor and His Mom
|
div
picture
source sizesminwidth 600px 331px 100vw typeimagewebp srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202209ice10yearoldjpgwebp 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202209ice10yearold1200x675jpgwebp 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202209ice10yearold800x450jpgwebp 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202209ice10yearold600x338jpgwebp 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202209ice10yearold331x186jpgwebp 331w
source sizesminwidth 600px 331px 100vw typeimagejpeg srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202209ice10yearoldjpg 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202209ice10yearold1200x675jpg 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202209ice10yearold800x450jpg 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202209ice10yearold600x338jpg 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202209ice10yearold331x186jpg 331w
img width1200 alta child stands in front of barbed wire and a red background srchttpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202209ice10yearold800x450jpg height675
picture
div
pspanwhen carmen goff received a letter from immigration and customs enforcement ice last month asking her to visit the agencys memphis office she didnt have cause for concern it said she needed to provide new fingerprints pictures and documents and would be given new reporting dates she and her 10yearold son brandon who was previously a st jude cancer patient had been diligently reporting to the ice office since arriving in memphis years prior their green card application was in progressspanp
pspanthe letter quotdidnt set off any alarm bells for me because they explicitly said spanispanfor new reporting datesspanispan meaning were going to set you a future checkin datequot says lily axelrod an immigration attorney who represents the goffs quotbut that turned out to be a lie and they had already had her deportation flight bookedquotspanp
pspancarmen and brandon came to the us from honduras in november 2016 spana hrefhttpswwwcommercialappealcomstorynews20220902icedeportationsstjudepatientnearlydeportedicecasereflectsbiggerissues10328913002spanrequestingspanaspan asylum after crossing the southern border at that point brandon had recovered from leukemia which he was diagnosed with at just 18 months old carmen sought better economic circumstances and a better medical system for her son spana hrefhttpswwwcommercialappealcomstorynews20220902icedeportationsstjudepatientnearlydeportedicecasereflectsbiggerissues10328913002spanfearingspanaspan his cancer would return she also hoped to flee violence in honduras a gang had killed her stepfather when he refused to give them money she spana hrefhttpswwwcommercialappealcomstorynews20220902icedeportationsstjudepatientnearlydeportedicecasereflectsbiggerissues10328913002spantoldspanaspan memphisem the emspanispancommercial appealspanispanspanp
pspanimmigration authorities gave her a court date and a hrefhttpswwwcommercialappealcomstorynews20220902icedeportationsstjudepatientnearlydeportedicecasereflectsbiggerissues10328913002alloweda her to move to join relatives in the atlanta area unfortunately brandons cancer returned carmen brought him to st jude childrens research hospital in memphis which does not charge for treatment and he eventually recovered but their immigration status was on shaky groundspanp
pspanquotthe judge did not grant her asylum casequot says axelrod explaining that quotits pretty tough to win asylum casesquot because quotthe law is a messquot and quotthe standard for evidence is extremely highquot they didnt win their appeal either quotat that point carmen and her son brandon had a final order of removal from the judgequot axelrod explains quotbut the local ice office as they often do for cases that have some kind of a humanitarian elementallowed carmen to have whats called an order of supervisionquotspanp
pspanissued in 2019 that order allowed carmen to stay in memphis keeping her son in treatment and the two of them out of ice detention and deportation proceedings it required her to complete regular checkins with ice and keep the agency apprised of new documents or addresses which she did in the meantime carmen met and married jose guerrero a venezuelan immigrant who recently naturalized as a us citizen the couple began to file the necessary paperwork for marriagebased immigration relief making good progress the letter carmen received on august 1 didnt seem like anything to worry aboutspanp
pspancarmen reported to the ice office on august 11 with brandon in tow there spana hrefhttpswwwcommercialappealcomstorynews20220902icedeportationsstjudepatientnearlydeportedicecasereflectsbiggerissues10328913002spanaccordingspanaspan to emthe emspanispancommercial appealspanispan quotofficials told her to sign a documentshe doesnt know what it said because it was in englishquot the friend who had dropped carmen and brandon off became alarmed that they hadnt emerged from the office after a hrefhttpswwwcommercialappealcomstorynews20220902icedeportationsstjudepatientnearlydeportedicecasereflectsbiggerissues10328913002several hoursa and that carmen wasnt answering her cellphone quotwe were able to check and confirmthat she had been detainedquot says axelrod quotshe and her son were held in the ice office in memphis for a while and were not allowed to contact an attorney or contact a family memberquotspanp
pspanofficials then took carmen and brandon to the memphis airport quotwhere they told her that she was going to be flying to texasquotbut not that she and brandon were being deported axelrod explains axelrod contacted someone high on the ice chain of command in the region to note that agents had a st jude patient in custody axelrod sent ice officials the familys latest documentation from st jude where brandon was still undergoing annual checkups that backandforth culminated in ice letting carmen and brandon go home that eveningspanp
pspanquotit was really traumatizing for her as a mom more than anythingquot says axelrod quoteverybody wants the best for their kids and to be able to tell their kids that everything is ok she had that moment of not knowing what to tell him and not knowing how to protect himquotspanp
pspanlast year the biden administration spana hrefhttpswwwdhsgovnews20211129dhsbeginsimplementationimmigrationenforcementprioritiesspandirectedspanaspan ice to focus on deporting truly dangerous undocumented immigrantsthose entangled in terrorism or serious crimes for instancerather than the vast majority who lead peaceful and productive lives in the united states but in june us district court for the southern district of texas judge drew tipton spana hrefhttpswwwnprorg202206101104340619afederaljudgeintexasblocksamajordhspolicylimitingimmigrationenforcemspanblockedspanaspan that policyspanp
pspanaxelrod believes that carmen and brandons neardeportation wouldnt have happened if the biden administrations enforcement priorities were still in place quotmy theory is that during this period of injunction while there is no official guidance from on high local ice offices basically have the freedom to do what they want with their docketquot she says if the goal is quotto deport as many people as possiblethe easiest people to deport are people like carmen people who are going to show up to the ice office when you tell them to and who have already given you all their travel documents who you already know that theyre nonviolent and compliantquotspanp
pspanquotthis is sort of the lowhanging fruit in terms of effort expended to number of people deportedquot axelrod continuesspanp
pspanthe reversed enforcement guidance represents a significant blow to countless undocumented immigrants who have no criminal records face violence if forced to return to their home countries and have built their lives in the united states immigrants are already being spana hrefhttpswwwlatimescomcaliforniastory20220722iceresumesdeportingimmigrantsspandeportedspanaspan without notice oklahoma immigration attorney lorena rivas spana hrefhttpswwwlatimescomcaliforniastory20220722iceresumesdeportingimmigrantsspantoldspanaspan the spanispanlos angeles timesspanispan that had happened to one of her clients and she had heard of similar cases from other attorneys one woman was spana hrefhttpswwwcommercialappealcomstorynews20220902icedeportationsstjudepatientnearlydeportedicecasereflectsbiggerissues10328913002spandeportedspanaspan to mexico after a routine checkin in memphis along with three of her children who are us citizensspanp
pspanquotice is designed to do exactly thisquot says axelrod quotthats what our immigration laws allowquot though carmen and brandon ultimately werent deported other nonviolent vulnerable migrants might not be so luckyspanp
pthe post a relnofollow hrefhttpsreasoncom20220908icealmostdeporteda10yearoldcancersurvivorandhismomice almost deported a 10yearold cancer survivor and his moma appeared first on a relnofollow hrefhttpsreasoncomreasoncomap
|
div picture source sizesminwidth 600px 331px 100vw typeimagewebp srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202209ice10yearoldjpgwebp 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202209ice10yearold1200x675jpgwebp 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202209ice10yearold800x450jpgwebp 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202209ice10yearold600x338jpgwebp 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202209ice10yearold331x186jpgwebp 331w source sizesminwidth 600px 331px 100vw typeimagejpeg srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202209ice10yearoldjpg 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202209ice10yearold1200x675jpg 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202209ice10yearold800x450jpg 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202209ice10yearold600x338jpg 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202209ice10yearold331x186jpg 331w img width1200 alta child stands barbed wire red background srchttpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202209ice10yearold800x450jpg height675 picture div pspanwhen carmen goff received letter immigration customs enforcement ice month asking visit agencys memphis office didnt cause concern said needed provide new fingerprints pictures documents given new reporting dates 10yearold son brandon previously st jude cancer patient diligently reporting ice office arriving memphis years prior green card application progressspanp pspanthe letter quotdidnt set alarm bells explicitly said spanispanfor new reporting datesspanispan meaning going set future checkin datequot says lily axelrod immigration attorney represents goffs quotbut turned lie deportation flight bookedquotspanp pspancarmen brandon came honduras november 2016 spana hrefhttpswwwcommercialappealcomstorynews20220902icedeportationsstjudepatientnearlydeportedicecasereflectsbiggerissues10328913002spanrequestingspanaspan asylum crossing southern border point brandon recovered leukemia diagnosed 18 months old carmen sought better economic circumstances better medical system son spana hrefhttpswwwcommercialappealcomstorynews20220902icedeportationsstjudepatientnearlydeportedicecasereflectsbiggerissues10328913002spanfearingspanaspan cancer return hoped flee violence honduras gang killed stepfather refused money spana hrefhttpswwwcommercialappealcomstorynews20220902icedeportationsstjudepatientnearlydeportedicecasereflectsbiggerissues10328913002spantoldspanaspan memphisem emspanispancommercial appealspanispanspanp pspanimmigration authorities gave court date hrefhttpswwwcommercialappealcomstorynews20220902icedeportationsstjudepatientnearlydeportedicecasereflectsbiggerissues10328913002alloweda join relatives atlanta area unfortunately brandons cancer returned carmen brought st jude childrens research hospital memphis charge treatment eventually recovered immigration status shaky groundspanp pspanquotthe judge grant asylum casequot says axelrod explaining quotits pretty tough win asylum casesquot quotthe law messquot quotthe standard evidence extremely highquot didnt win appeal quotat point carmen son brandon final order removal judgequot axelrod explains quotbut local ice office cases kind humanitarian elementallowed carmen whats called order supervisionquotspanp pspanissued 2019 order allowed carmen stay memphis keeping son treatment ice detention deportation proceedings required complete regular checkins ice agency apprised new documents addresses meantime carmen met married jose guerrero venezuelan immigrant recently naturalized citizen couple began file necessary paperwork marriagebased immigration relief making good progress letter carmen received august 1 didnt like worry aboutspanp pspancarmen reported ice office august 11 brandon tow spana hrefhttpswwwcommercialappealcomstorynews20220902icedeportationsstjudepatientnearlydeportedicecasereflectsbiggerissues10328913002spanaccordingspanaspan emthe emspanispancommercial appealspanispan quotofficials told sign documentshe doesnt know said englishquot friend dropped carmen brandon alarmed hadnt emerged office hrefhttpswwwcommercialappealcomstorynews20220902icedeportationsstjudepatientnearlydeportedicecasereflectsbiggerissues10328913002several hoursa carmen wasnt answering cellphone quotwe able check confirmthat detainedquot says axelrod quotshe son held ice office memphis allowed contact attorney contact family memberquotspanp pspanofficials took carmen brandon memphis airport quotwhere told going flying texasquotbut brandon deported axelrod explains axelrod contacted high ice chain command region note agents st jude patient custody axelrod sent ice officials familys latest documentation st jude brandon undergoing annual checkups backandforth culminated ice letting carmen brandon home eveningspanp pspanquotit traumatizing mom anythingquot says axelrod quoteverybody wants best kids able tell kids ok moment knowing tell knowing protect himquotspanp pspanlast year biden administration spana hrefhttpswwwdhsgovnews20211129dhsbeginsimplementationimmigrationenforcementprioritiesspandirectedspanaspan ice focus deporting truly dangerous undocumented immigrantsthose entangled terrorism crimes instancerather vast majority lead peaceful productive lives united states june district court southern district texas judge drew tipton spana hrefhttpswwwnprorg202206101104340619afederaljudgeintexasblocksamajordhspolicylimitingimmigrationenforcemspanblockedspanaspan policyspanp pspanaxelrod believes carmen brandons neardeportation wouldnt happened biden administrations enforcement priorities place quotmy theory period injunction official guidance high local ice offices basically freedom want docketquot says goal quotto deport people possiblethe easiest people deport people like carmen people going ice office tell given travel documents know theyre nonviolent compliantquotspanp pspanquotthis sort lowhanging fruit terms effort expended number people deportedquot axelrod continuesspanp pspanthe reversed enforcement guidance represents significant blow countless undocumented immigrants criminal records face violence forced return home countries built lives united states immigrants spana hrefhttpswwwlatimescomcaliforniastory20220722iceresumesdeportingimmigrantsspandeportedspanaspan notice oklahoma immigration attorney lorena rivas spana hrefhttpswwwlatimescomcaliforniastory20220722iceresumesdeportingimmigrantsspantoldspanaspan spanispanlos angeles timesspanispan happened clients heard similar cases attorneys woman spana hrefhttpswwwcommercialappealcomstorynews20220902icedeportationsstjudepatientnearlydeportedicecasereflectsbiggerissues10328913002spandeportedspanaspan mexico routine checkin memphis children citizensspanp pspanquotice designed exactly thisquot says axelrod quotthats immigration laws allowquot carmen brandon ultimately werent deported nonviolent vulnerable migrants luckyspanp pthe post relnofollow hrefhttpsreasoncom20220908icealmostdeporteda10yearoldcancersurvivorandhismomice deported 10yearold cancer survivor moma appeared relnofollow hrefhttpsreasoncomreasoncomap
|
631a6d5655ebc349b9f0c710
|
Seattle Public School Teachers on Strike, Since 6-Figure Pay Isn't Good Enough
|
div
picture
source sizesminwidth 600px 331px 100vw typeimagewebp srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202209seattleteachersstrikejpgwebp 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202209seattleteachersstrike1200x675jpgwebp 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202209seattleteachersstrike800x450jpgwebp 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202209seattleteachersstrike600x338jpgwebp 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202209seattleteachersstrike331x186jpgwebp 331w
source sizesminwidth 600px 331px 100vw typeimagejpeg srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202209seattleteachersstrikejpg 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202209seattleteachersstrike1200x675jpg 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202209seattleteachersstrike800x450jpg 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202209seattleteachersstrike600x338jpg 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202209seattleteachersstrike331x186jpg 331w
img width1200 alttwo kids sit next to each other on a bench with an orange background srchttpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202209seattleteachersstrike800x450jpg height675
picture
div
pthe school year a hrefhttpswwwcnncom20220908uswashingtonstateteachersstrikeindexhtmldidnt start yesterdaya as planned for seattle public school students who have gotten an impromptu extension of their summer vacation due to striking teachersp
pthe seattle education association sea began its strike on september 7 demanding higher teachertostudent ratios particularly in special needs and multilingual classrooms laptops for teaching assistants andnaturallyhigher payp
pthe union a hrefhttpswwwseattleweaorgcontractsandbargaining2022bargainingupdates2022bargainingvaluesnotesa on its website that 93 percent of its members quotare working more than our assigned or contract hoursquot while a quarter of its members log an additional 10 hours per week meanwhile quotthe cost of living in seattle is skyrocketing shortages of educators are getting worse and our pay is not keeping pacequot argues sea accordingly seattle public schools sps quotmust pay all staff respectful wages and must address the unacceptably low wages for education support professionalsquotp
pbut public employee salaries are searchable for the state of washington and some 40 percent of sps fulltime teachers actually make more than 100000 per year according to 202021 salary data a hrefhttpswwwthecentersquarecomwashington40ofseattlesteachersmake100000plusstillwantrespectfulpayarticle_09c8b9c4fefe11ecb4414bd0239ba0e3htmlreporteda by emthe center square emand easily searchable a hrefhttpsfiscalwagovdvk12salariesaspxvia this databasea the pay scale for sps teachers which depends on tenure and educational attainment ranges from roughly 60000 to 123500 annually for a hrefhttpswwwseattleweaorgfile_viewerphpid2708175hour workdaysa 375hour workweeks and a shorter working year than people in the private sector typically endure thats not including pension benefits which can be quite generous depending on the number of years teachers log in the systemp
pits unclear what about these wages arent quotrespectfulquot but they are nevertheless one of the major sticking pointsemphasized repeatedly in materials the union has provided on its strikethat is preventing some 50000 students and families from starting the school yearp
pto be sure many teachers are now burdened by making up for lost instructional time that resulted from covid school closures something a hrefhttpsreasoncom20220823abelatedvindicationforschoolreopenersteachers unions played no small part in lobbying to extenda dealing with the challenge of learning loss with some a hrefhttpswwwk12waussitesdefaultfilespubliccommunications2022docs0322updatek4readinglevelspdf40 percent of k4 washington statea students not reading at grade level will be no small feat for teachers this school yearp
pstill while public employees attempt to negotiate pay and working conditions they want its public school parents who are left in the lurch with no viable alternatives and no real means of holding their school district accountableother than by taking the drastic step of pulling kids out of public school entirely a threat a hrefhttpswwwnytimescom20220517uspublicschoolsfallingenrollmenthtmlmore and more parents have made good ona over the last two yearsp
blockquote datawidth500 classtwittertweet datadnttrue
p langen dirltrthe customer as opposed to the employer feels the pain when government school employees strikep
pthe employer has no incentive to change to help teachers or studentsp
pschool choice would fix this problem by providing real accountabilityp
p corey a deangelis deangeliscorey a hrefhttpstwittercomdeangeliscoreystatus1567481737659224070ref_srctwsrc5etfwseptember 7 2022apblockquote
pp
pquoti have gone from a cheerleader for public schools to a believer in school choicequot one seattle public school parent who wishes to stay anonymous tells emreason quotemi have lost any faith i had in public sector unions top of scale teachers are making a ridiculous amount of money more than i make as a seniorlevel tech workerquot she adds emphasizing that while she didnt always feel this way the low quality of instruction provided by sps over the years has been dishearteningp
pquotmy kid should be in the second day of her senior year not playing video games on our couchquotp
pthe post a relnofollow hrefhttpsreasoncom20220908seattlepublicschoolteachersonstrikesince6figurepayisntgoodenoughseattle public school teachers on strike since 6figure pay isnt good enougha appeared first on a relnofollow hrefhttpsreasoncomreasoncomap
|
div picture source sizesminwidth 600px 331px 100vw typeimagewebp srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202209seattleteachersstrikejpgwebp 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202209seattleteachersstrike1200x675jpgwebp 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202209seattleteachersstrike800x450jpgwebp 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202209seattleteachersstrike600x338jpgwebp 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202209seattleteachersstrike331x186jpgwebp 331w source sizesminwidth 600px 331px 100vw typeimagejpeg srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202209seattleteachersstrikejpg 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202209seattleteachersstrike1200x675jpg 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202209seattleteachersstrike800x450jpg 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202209seattleteachersstrike600x338jpg 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202209seattleteachersstrike331x186jpg 331w img width1200 alttwo kids sit bench orange background srchttpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202209seattleteachersstrike800x450jpg height675 picture div pthe school year hrefhttpswwwcnncom20220908uswashingtonstateteachersstrikeindexhtmldidnt start yesterdaya planned seattle public school students gotten impromptu extension summer vacation striking teachersp pthe seattle education association sea began strike september 7 demanding higher teachertostudent ratios particularly special needs multilingual classrooms laptops teaching assistants andnaturallyhigher payp pthe union hrefhttpswwwseattleweaorgcontractsandbargaining2022bargainingupdates2022bargainingvaluesnotesa website 93 percent members quotare working assigned contract hoursquot quarter members log additional 10 hours week quotthe cost living seattle skyrocketing shortages educators getting worse pay keeping pacequot argues sea accordingly seattle public schools sps quotmust pay staff respectful wages address unacceptably low wages education support professionalsquotp pbut public employee salaries searchable state washington 40 percent sps fulltime teachers actually 100000 year according 202021 salary data hrefhttpswwwthecentersquarecomwashington40ofseattlesteachersmake100000plusstillwantrespectfulpayarticle_09c8b9c4fefe11ecb4414bd0239ba0e3htmlreporteda emthe center squareemand easily searchable hrefhttpsfiscalwagovdvk12salariesaspxvia databasea pay scale sps teachers depends tenure educational attainment ranges roughly 60000 123500 annually hrefhttpswwwseattleweaorgfile_viewerphpid2708175hour workdaysa 375hour workweeks shorter working year people private sector typically endure thats including pension benefits generous depending number years teachers log systemp pits unclear wages arent quotrespectfulquot major sticking pointsemphasized repeatedly materials union provided strikethat preventing 50000 students families starting school yearp pto sure teachers burdened making lost instructional time resulted covid school closures hrefhttpsreasoncom20220823abelatedvindicationforschoolreopenersteachers unions played small lobbying extenda dealing challenge learning loss hrefhttpswwwk12waussitesdefaultfilespubliccommunications2022docs0322updatek4readinglevelspdf40 percent k4 washington statea students reading grade level small feat teachers school yearp pstill public employees attempt negotiate pay working conditions want public school parents left lurch viable alternatives real means holding school district accountableother taking drastic step pulling kids public school entirely threat hrefhttpswwwnytimescom20220517uspublicschoolsfallingenrollmenthtmlmore parents good ona yearsp blockquote datawidth500 classtwittertweet datadnttrue p langen dirltrthe customer opposed employer feels pain government school employees strikep pthe employer incentive change help teachers studentsp pschool choice fix problem providing real accountabilityp p corey deangelis deangeliscorey hrefhttpstwittercomdeangeliscoreystatus1567481737659224070ref_srctwsrc5etfwseptember 7 2022apblockquote pp pquoti gone cheerleader public schools believer school choicequot seattle public school parent wishes stay anonymous tells emreason quotemi lost faith public sector unions scale teachers making ridiculous money seniorlevel tech workerquot adds emphasizing didnt feel way low quality instruction provided sps years dishearteningp pquotmy kid second day senior year playing video games couchquotp pthe post relnofollow hrefhttpsreasoncom20220908seattlepublicschoolteachersonstrikesince6figurepayisntgoodenoughseattle public school teachers strike 6figure pay isnt good enougha appeared relnofollow hrefhttpsreasoncomreasoncomap
|
631a6dbe55ebc349b9f0c719
|
Almost 40 Percent of College Students Feel Uncomfortable Sharing a Controversial Opinion in Class
|
div
picture
source sizesminwidth 600px 331px 100vw typeimagewebp srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202001collegehall_1161x653jpgwebp 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202001collegehall_1161x653jpgwebp 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202001collegehall_1161x653800x450jpgwebp 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202001collegehall_1161x653600x338jpgwebp 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202001collegehall_1161x653331x186jpgwebp 331w
source sizesminwidth 600px 331px 100vw typeimagejpeg srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202001collegehall_1161x653jpg 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202001collegehall_1161x653jpg 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202001collegehall_1161x653800x450jpg 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202001collegehall_1161x653600x338jpg 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202001collegehall_1161x653331x186jpg 331w
img width1200 altcollege students in a classroom srchttpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202001collegehall_1161x653800x450jpg height675
picture
div
pspanon wednesday the foundation for individual rights and expression fire released its annualspan a hrefhttpsrankingsthefireorgrankspancollege free speech rankingsspanaspan the rankings are derived from aspan a hrefhttpspublictableaucomappprofilecollegepulseviz2022collegefreespeechrankingsdata2022collegefreespeechrankingsdataspansurveyspanaspan of almost 45000 college students at over 200 universities in the united states the survey has been conducted since 2020 collecting a wide range of information about the campus political climate at a swath of universitiesspanp
pspanquotschools that have an administration thats very strong on free expression issuestypically have done well in the rankingsquot fire senior research fellow sean stevens tells spanispanreasonspanispan quotinterestingly a number of these schools in the top five for sure have some of the most ideologically diverse campusesquotspanp
pspanthe university of chicago took the top spot this yearspan a hrefhttpsrankingsthefireorgrankspanrankingspanaspan firspanspanstspanspan in the categories of administrative support which quotmeasures student perception of their colleges support for free speechquot and tolerance for speakers kansas state university took second place followed by purdue university mississippi state university and oklahoma state university with the exception of the university of chicago the top five schools were generally very ideologically diverse with neither liberals nor conservatives gaining more than a 21 ratiospanp
pspanaccording to thespan a hrefhttpspublictableaucomappprofilecollegepulseviz2022collegefreespeechrankingsdata2022collegefreespeechrankingsdataspansurvey resultsspanaspan released by fire both discomfort in expression and outright censoriousness of unpopular viewpoints continue to be common problems on american college campusesspanp
pspansixtyfour percentstrong strongof students were worried a misunderstanding of something they say or do could damage their reputation fortyeight percent spana hrefhttpspublictableaucomappprofilecollegepulseviz2022collegefreespeechrankingsdata2022collegefreespeechrankingsdataspanreportedspanaspan that they would be quotvery uncomfortablequot or quotsomewhat uncomfortablequot expressing their views on a controversial political topic to other students in a public space on campus thirtyeight percent expressed that they would be uncomfortable doing so during an inclass discussion and a hrefhttpspublictableaucomappprofilecollegepulseviz2022collegefreespeechrankingsdata2022collegefreespeechrankingsdataratesa of discomfort are comparable across racial categories 32 percent of black respondents 39 percent of white respondents and 37 percent of hispanic respondents felt that wariness about expressing themselves in class more than 40 percent of spanspanasian and american indian students reported discomfortspanp
pspanin contrast fire found that rates of discomfort varied widely across different political identifications twentyseven percent of students identifying as quotstrong democratsquotspan a hrefhttpspublictableaucomappprofilecollegepulseviz2022collegefreespeechrankingsdata2022collegefreespeechrankingsdataspanreportedspanaspan being quotsomewhatquot or quotveryquot uncomfortable to share their opinion on a controversial political topic during inclass discussion whereas 44 percent of quotstrong republicansquot did however despite the partisan divide discomfort about expressing opinions in class is present across the political spectrum ranging from affecting slightly more than one in four quotstrong democratquot respondents to one in two quotindependent lean republicanquot respondentsspanp
pspanmany students report a willingness to actively interfere with others ability to see controversial campus speakers with 32 percentspan a hrefhttpspublictableaucomappprofilecollegepulseviz2022collegefreespeechrankingsdata2022collegefreespeechrankingsdataspanfindingspanaspan it quotsometimesquot or quotalwaysquot acceptable to shout down a speaker to prevent them from speaking on campus only a small percentage of students reported that the use of violence to prevent an unpopular speaking event would be acceptable with 79 percent of students reporting that it would quotneverquot be acceptablespanp
pspanin fairness it is difficult to know what proportion of college students would actually participate in violence to stop an unpopular speech or participate in a speaker shoutdown even if they expressed conditional support for it in survey responses however such responses do give us a general idea of how likely some college students are to approve of such actions even if they had no intention of participating themselvesspanp
pspanthese new fire data provide yet more evidence that there is a twopronged a hrefhttpsreasoncom20220318newyorktimesamericafreespeechproblemfree speecha problem on american college campuses first many college campusesincluding public universitiesstill have strictspan a hrefhttpsreasoncom20211213thesecondgreatageofpoliticalcorrectnessspanspeech codesspanaspan that limit students free expression many schools are also prone to caving to pressure to censor public events or punishspan a hrefhttpsreasoncom20220812communitycollegeadminsfabricatedareasontotargetthesestudentsanticommunistpostersspanstudentsspanaspan andspan a hrefhttpsreasoncom20220715professorsuesuniversityofwashingtonoverlandacknowledgmentinvestigationspanfacultyspanaspan who make controversial statements these policies and actions present a clear danger to the speech rights of thousands of american college studentsspanp
pspanhowever a more subtle element of this problem also deserves attention even at schools that boast robust protections for student speech there is an increasing problem of students being too uncomfortable to actually operate under the protections theyve been given they still worry about expressing themselves on contentious topics and in common spacesspanp
pspana campus political climate unfriendly to the principles of free expression is a problem far greater than an uncomfortable social environment it poses a direct threat to students ability to learn how to think and how to form coherent opinions how can we expect a young person to understand why they believe something if they cant hear the other sides perspective in good faith the ability to consider a complex issue from multiple viewpoints is an incredibly important trait but with the current environment on many college campuses too many young people may have a difficult time developing itspanp
pthe post a relnofollow hrefhttpsreasoncom20220908almost40percentofcollegestudentsfeeluncomfortablesharingacontroversialopinioninclassalmost 40 percent of college students feel uncomfortable sharing a controversial opinion in classa appeared first on a relnofollow hrefhttpsreasoncomreasoncomap
|
div picture source sizesminwidth 600px 331px 100vw typeimagewebp srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202001collegehall_1161x653jpgwebp 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202001collegehall_1161x653jpgwebp 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202001collegehall_1161x653800x450jpgwebp 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202001collegehall_1161x653600x338jpgwebp 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202001collegehall_1161x653331x186jpgwebp 331w source sizesminwidth 600px 331px 100vw typeimagejpeg srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202001collegehall_1161x653jpg 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202001collegehall_1161x653jpg 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202001collegehall_1161x653800x450jpg 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202001collegehall_1161x653600x338jpg 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202001collegehall_1161x653331x186jpg 331w img width1200 altcollege students classroom srchttpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202001collegehall_1161x653800x450jpg height675 picture div pspanon wednesday foundation individual rights expression fire released annualspan hrefhttpsrankingsthefireorgrankspancollege free speech rankingsspanaspan rankings derived aspana hrefhttpspublictableaucomappprofilecollegepulseviz2022collegefreespeechrankingsdata2022collegefreespeechrankingsdataspansurveyspanaspan 45000 college students 200 universities united states survey conducted 2020 collecting wide range information campus political climate swath universitiesspanp pspanquotschools administration thats strong free expression issuestypically rankingsquot fire senior research fellow sean stevens tells spanispanreasonspanispan quotinterestingly number schools sure ideologically diverse campusesquotspanp pspanthe university chicago took spot yearspan hrefhttpsrankingsthefireorgrankspanrankingspanaspan firspanspanstspanspan categories administrative support quotmeasures student perception colleges support free speechquot tolerance speakers kansas state university took second place followed purdue university mississippi state university oklahoma state university exception university chicago schools generally ideologically diverse liberals conservatives gaining 21 ratiospanp pspanaccording thespan hrefhttpspublictableaucomappprofilecollegepulseviz2022collegefreespeechrankingsdata2022collegefreespeechrankingsdataspansurvey resultsspanaspan released fire discomfort expression outright censoriousness unpopular viewpoints continue common problems american college campusesspanp pspansixtyfour percentstrongstrongof students worried misunderstanding damage reputation fortyeight percent spana hrefhttpspublictableaucomappprofilecollegepulseviz2022collegefreespeechrankingsdata2022collegefreespeechrankingsdataspanreportedspanaspan quotvery uncomfortablequot quotsomewhat uncomfortablequot expressing views controversial political topic students public space campus thirtyeight percent expressed uncomfortable inclass discussion hrefhttpspublictableaucomappprofilecollegepulseviz2022collegefreespeechrankingsdata2022collegefreespeechrankingsdataratesa discomfort comparable racial categories 32 percent black respondents 39 percent white respondents 37 percent hispanic respondents felt wariness expressing class 40 percent spanspanasian american indian students reported discomfortspanp pspanin contrast fire found rates discomfort varied widely different political identifications twentyseven percent students identifying quotstrong democratsquotspan hrefhttpspublictableaucomappprofilecollegepulseviz2022collegefreespeechrankingsdata2022collegefreespeechrankingsdataspanreportedspanaspan quotsomewhatquot quotveryquot uncomfortable share opinion controversial political topic inclass discussion 44 percent quotstrong republicansquot despite partisan divide discomfort expressing opinions class present political spectrum ranging affecting slightly quotstrong democratquot respondents quotindependent lean republicanquot respondentsspanp pspanmany students report willingness actively interfere ability controversial campus speakers 32 percentspan hrefhttpspublictableaucomappprofilecollegepulseviz2022collegefreespeechrankingsdata2022collegefreespeechrankingsdataspanfindingspanaspan quotsometimesquot quotalwaysquot acceptable shout speaker prevent speaking campus small percentage students reported use violence prevent unpopular speaking event acceptable 79 percent students reporting quotneverquot acceptablespanp pspanin fairness difficult know proportion college students actually participate violence stop unpopular speech participate speaker shoutdown expressed conditional support survey responses responses general idea likely college students approve actions intention participating themselvesspanp pspanthese new fire data provide evidence twopronged hrefhttpsreasoncom20220318newyorktimesamericafreespeechproblemfree speecha problem american college campuses college campusesincluding public universitiesstill strictspan hrefhttpsreasoncom20211213thesecondgreatageofpoliticalcorrectnessspanspeech codesspanaspan limit students free expression schools prone caving pressure censor public events punishspan hrefhttpsreasoncom20220812communitycollegeadminsfabricatedareasontotargetthesestudentsanticommunistpostersspanstudentsspanaspan andspan hrefhttpsreasoncom20220715professorsuesuniversityofwashingtonoverlandacknowledgmentinvestigationspanfacultyspanaspan controversial statements policies actions present clear danger speech rights thousands american college studentsspanp pspanhowever subtle element problem deserves attention schools boast robust protections student speech increasing problem students uncomfortable actually operate protections theyve given worry expressing contentious topics common spacesspanp pspana campus political climate unfriendly principles free expression problem far greater uncomfortable social environment poses direct threat students ability learn think form coherent opinions expect young person understand believe cant hear sides perspective good faith ability consider complex issue multiple viewpoints incredibly important trait current environment college campuses young people difficult time developing itspanp pthe post relnofollow hrefhttpsreasoncom20220908almost40percentofcollegestudentsfeeluncomfortablesharingacontroversialopinioninclassalmost 40 percent college students feel uncomfortable sharing controversial opinion classa appeared relnofollow hrefhttpsreasoncomreasoncomap
|
631a6dd255ebc349b9f0c71b
|
Biden on Queen Elizabeth: 'She defined an era'
|
ppresident biden and first lady jill biden honored queen elizabeth ii on thursday calling her a steadying presence and a stateswoman of unmatched dignity following her deathp
pin a world of constant change she was a steadying presence and a source of comfort and pride for generations of britons including many who have never known their country without her an enduring admiration for queen elizabeth ii united people across the commonwealth biden said in a statementp
pthe queen died at the age of 96 ending the longest reign for a british head of state in history that included the administrations of 14 us presidents she died at balmoral castle her scottish estate buckingham palace announcedp
pbiden had been briefed on the queens health earlier on thursday and was receiving regular updates about her condition the bidens first met the queen in 1982 while on a senate delegation trip to the uk and met with her in june 2021 when she hosted them during an overseas tripp
pbiden in his statement commented that she deepened the special relationship between the us and ukp
pqueen elizabeth ii was a stateswoman of unmatched dignity and constancy who deepened the bedrock alliance between the united kingdom and the united states she helped make our relationship special he saidp
pshe helped americans commemorate both the anniversary of the founding of jamestown and the bicentennial of our independence and she stood in solidarity with the united states during our darkest days after 911 when she poignantly reminded us that grief is the price we pay for love he addedp
pbiden said he and the first lady look forward to a close relationship with the new king and queen consort and sent his condolences to their whole family he spoke with british prime minister liz truss during a video call with other leaders earlier on thursday and told her he was thinking of the queenp
pher legacy will loom large in the pages of british history and in the story of our world he said in his statementp
pbiden noted that the queen led the uk through the covid19 pandemic and spoke about the personal connection people felt with her during her life of servicep
pshe was the first british monarch to whom people all around the world could feel a personal and immediate connection whether they heard her on the radio as a young princess speaking to the children of the united kingdom or gathered around their televisions for her coronation or watched her final christmas speech or her platinum jubilee on their phones he saidp
pand she in turn dedicated her whole life to their service he addedp
|
ppresident biden lady jill biden honored queen elizabeth ii thursday calling steadying presence stateswoman unmatched dignity following deathp pin world constant change steadying presence source comfort pride generations britons including known country enduring admiration queen elizabeth ii united people commonwealth biden said statementp pthe queen died age 96 ending longest reign british head state history included administrations 14 presidents died balmoral castle scottish estate buckingham palace announcedp pbiden briefed queens health earlier thursday receiving regular updates condition bidens met queen 1982 senate delegation trip uk met june 2021 hosted overseas tripp pbiden statement commented deepened special relationship ukp pqueen elizabeth ii stateswoman unmatched dignity constancy deepened bedrock alliance united kingdom united states helped relationship special saidp pshe helped americans commemorate anniversary founding jamestown bicentennial independence stood solidarity united states darkest days 911 poignantly reminded grief price pay love addedp pbiden said lady look forward close relationship new king queen consort sent condolences family spoke british prime minister liz truss video leaders earlier thursday told thinking queenp pher legacy loom large pages british history story world said statementp pbiden noted queen led uk covid19 pandemic spoke personal connection people felt life servicep pshe british monarch people world feel personal immediate connection heard radio young princess speaking children united kingdom gathered televisions coronation watched final christmas speech platinum jubilee phones saidp pand turn dedicated life service addedp
|
631bbf00f89a59900d6eb9ae
|
This Alabama Woman Was Jailed for 3 Months Because She Smoked Pot While Pregnant
|
div
picture
source sizesminwidth 600px 331px 100vw typeimagewebp srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202209pregnantwomanalabamajpgwebp 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202209pregnantwomanalabama1200x675jpgwebp 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202209pregnantwomanalabama800x450jpgwebp 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202209pregnantwomanalabama600x338jpgwebp 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202209pregnantwomanalabama331x186jpgwebp 331w
source sizesminwidth 600px 331px 100vw typeimagejpeg srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202209pregnantwomanalabamajpg 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202209pregnantwomanalabama1200x675jpg 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202209pregnantwomanalabama800x450jpg 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202209pregnantwomanalabama600x338jpg 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202209pregnantwomanalabama331x186jpg 331w
img width1200 altsilhouette of a pregnant woman against a red background srchttpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202209pregnantwomanalabama800x450jpg height675
picture
div
pspana new report out of etowah county alabama reveals that a woman there was jailed for three months after admitting to smoking marijuana while pregnant the type of law that led to her incarceration is not unique to alabama and such punitive laws dont achieve their goal of promoting healthy pregnancies spanp
pspanaccording tospan a hrefhttpswwwalcomnews202209pregnantwomenheldformonthsinonealabamajailtoprotectfetusesfromdrugshtmlspanalspanspancomspanas amy spanyurkaninspanspan spanspanashley banks was arrested on may 25spanspan after being found with quota small amount of marijuanaquot and a pistol that she was not licensed to carry she admitted to having smoked marijuana on the day she found out she was pregnant which led to her being charged with the quotchemical endangermentquot of her fetus despite having a highrisk pregnancy the fact that she had admitted to smoking marijuana while pregnant landed banks in jail spanp
pspanunder alabama state law women arrested for drug use who are pregnant or have recently given birth can be charged with chemical endangerment which requires them to post a 10000 bond and go to rehab to regain their freedom spanp
pspanbanks was incarcerated for three months without being convicted of a crime during her incarceration she experienced quotbleed[ing] for five weeks in jail she said she also suffered from hunger and fainting spellsquot according to yurkanins report spanspanquottwo times specialists evaluated her for drug addiction and found [banks] didnt qualify for free addiction services offered through the statequot yurkanin adds that investigators told banks to claim she had a drug addiction so she could get into treatment and be bailed out of jail spanp
pspanbanks was finally released to community corrections on august 25spanspanspanp
pspanaccording to yurkanins investigation more than 150 etowah county women have been charged with quotchemical endangermentquot of their pregnancies even when their children are born healthy or do not test positive for drugs a 2015 a hrefhttpswwwpropublicaorgarticlewhenthewombisacrimescenepropublicaa investigation found that while other alabama counties tend to enforce the law only when an infant tests positive for drugs etowah county quotlaw enforcement officials have drawn what they call a line in the sand vowing to aggressively pursue all chemicalendangerment cases starting from pregnancyquot spanp
paccording to a 2022 report from the a hrefhttpswwwguttmacherorgstatepolicyexploresubstanceuseduringpregnancyguttmacher institutea quot24 states and the district of columbia consider substance use during pregnancy to be child abuse under civil childwelfare statutes and 3 consider it grounds for civil commitmentquot additionally quot25 states and the district of columbia require health care professionals to report suspected prenatal drug use and 8 states require them to test for prenatal drug exposure if they suspect drug usequotp
palabama as banks case demonstrates is especially punitive on this issue thats because the state supreme court has held that emanyem illicit drug use while pregnant is quotchemical endangermentquot of a child the south carolina supreme court established a similar precedent guttmacher notes when it ruled that quotmaternal acts endangering or likely to endanger the life comfort or health of a viable fetusquot constitute criminal child abusep
pthese laws are intended to protect fetuses but fail even on those grounds a hrefhttpswwwtandfonlinecomdoiabs1010801533256x2014900409a 2015 reporta by researcher rebecca stone concluded that quotpolicies that substanceusing women find threatening discourage them from seeking comprehensive medical treatment during their pregnanciesquotstrong strongwhats more jails and prisons are not favorable places to receive prenatal care according to a 2019 study from johns hopkins researchers in some states a hrefhttpsajphaphapublicationsorgdoi102105ajph2019305006at least 20 percenta of incarcerated womens pregnancies ended in miscarriage far more than the national a hrefhttpswwwmarchofdimesorgcomplicationsmiscarriageaspxaveragea of 10 percent to 15 percentp
pit is particularly risibleeven in a legal system that grants personhood to fetusesto punish pregnant women for using cannabis quotstudies on marijuana use during pregnancy are inconsistent and inconclusivequot emreasonem senior editor elizabeth nolan brown a hrefhttpsreasoncom20210422marijuanaandpregnancywhatdoesthesciencesayreported in 2021a quotbut cannabis is not known to be teratogenicthat is to cause birth defectsin humans the bulk of scientific evidence suggests that risks posed to developing fetuses are relatively minor and babies exposed to marijuana in utero still fall within normal ranges of outcomesquotp
pthe post a relnofollow hrefhttpsreasoncom20220909thisalabamawomanwasjailedfor3monthsbecauseshesmokedpotwhilepregnantthis alabama woman was jailed for 3 months because she smoked pot while pregnanta appeared first on a relnofollow hrefhttpsreasoncomreasoncomap
|
div picture source sizesminwidth 600px 331px 100vw typeimagewebp srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202209pregnantwomanalabamajpgwebp 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202209pregnantwomanalabama1200x675jpgwebp 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202209pregnantwomanalabama800x450jpgwebp 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202209pregnantwomanalabama600x338jpgwebp 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202209pregnantwomanalabama331x186jpgwebp 331w source sizesminwidth 600px 331px 100vw typeimagejpeg srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202209pregnantwomanalabamajpg 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202209pregnantwomanalabama1200x675jpg 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202209pregnantwomanalabama800x450jpg 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202209pregnantwomanalabama600x338jpg 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202209pregnantwomanalabama331x186jpg 331w img width1200 altsilhouette pregnant woman red background srchttpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202209pregnantwomanalabama800x450jpg height675 picture div pspana new report etowah county alabama reveals woman jailed months admitting smoking marijuana pregnant type law led incarceration unique alabama punitive laws dont achieve goal promoting healthy pregnanciesspanp pspanaccording tospan hrefhttpswwwalcomnews202209pregnantwomenheldformonthsinonealabamajailtoprotectfetusesfromdrugshtmlspanalspanspancomspanas amy spanyurkaninspanspan spanspanashley banks arrested 25spanspan found quota small marijuanaquot pistol licensed carry admitted having smoked marijuana day found pregnant led charged quotchemical endangermentquot fetus despite having highrisk pregnancy fact admitted smoking marijuana pregnant landed banks jailspanp pspanunder alabama state law women arrested drug use pregnant recently given birth charged chemical endangerment requires post 10000 bond rehab regain freedomspanp pspanbanks incarcerated months convicted crime incarceration experienced quotbleed[ing] weeks jail said suffered hunger fainting spellsquot according yurkanins reportspanspanquottwo times specialists evaluated drug addiction found [banks] didnt qualify free addiction services offered statequot yurkanin adds investigators told banks claim drug addiction treatment bailed jailspanp pspanbanks finally released community corrections august 25spanspanspanp pspanaccording yurkanins investigation 150 etowah county women charged quotchemical endangermentquot pregnancies children born healthy test positive drugs 2015 hrefhttpswwwpropublicaorgarticlewhenthewombisacrimescenepropublicaa investigation found alabama counties tend enforce law infant tests positive drugs etowah county quotlaw enforcement officials drawn line sand vowing aggressively pursue chemicalendangerment cases starting pregnancyquot spanp paccording 2022 report hrefhttpswwwguttmacherorgstatepolicyexploresubstanceuseduringpregnancyguttmacher institutea quot24 states district columbia consider substance use pregnancy child abuse civil childwelfare statutes 3 consider grounds civil commitmentquot additionally quot25 states district columbia require health care professionals report suspected prenatal drug use 8 states require test prenatal drug exposure suspect drug usequotp palabama banks case demonstrates especially punitive issue thats state supreme court held emanyem illicit drug use pregnant quotchemical endangermentquot child south carolina supreme court established similar precedent guttmacher notes ruled quotmaternal acts endangering likely endanger life comfort health viable fetusquot constitute criminal child abusep pthese laws intended protect fetuses fail grounds hrefhttpswwwtandfonlinecomdoiabs1010801533256x2014900409a 2015 reporta researcher rebecca stone concluded quotpolicies substanceusing women find threatening discourage seeking comprehensive medical treatment pregnanciesquotstrongstrongwhats jails prisons favorable places receive prenatal care according 2019 study johns hopkins researchers states hrefhttpsajphaphapublicationsorgdoi102105ajph2019305006at 20 percenta incarcerated womens pregnancies ended miscarriage far national hrefhttpswwwmarchofdimesorgcomplicationsmiscarriageaspxaveragea 10 percent 15 percentp pit particularly risibleeven legal system grants personhood fetusesto punish pregnant women cannabis quotstudies marijuana use pregnancy inconsistent inconclusivequot emreasonem senior editor elizabeth nolan brown hrefhttpsreasoncom20210422marijuanaandpregnancywhatdoesthesciencesayreported 2021a quotbut cannabis known teratogenicthat cause birth defectsin humans bulk scientific evidence suggests risks posed developing fetuses relatively minor babies exposed marijuana utero fall normal ranges outcomesquotp pthe post relnofollow hrefhttpsreasoncom20220909thisalabamawomanwasjailedfor3monthsbecauseshesmokedpotwhilepregnantthis alabama woman jailed 3 months smoked pot pregnanta appeared relnofollow hrefhttpsreasoncomreasoncomap
|
631d1117fffb92a35a6377d8
|
2022 as the year of AI?
|
pthat is the topic of a relnoopener hrefhttpswwwbloombergcomopinionarticles20220909artificialintelligencewillbeagreatequalizercmpidsocialflowtwitterbusinessutm_campaignsocialfloworganicutm_sourcetwitterutm_mediumsocialutm_contentbusinesssrefhtohjx5y target_blankmy latest bloomberg columna here is one excerptp
blockquote
pbut the benefits of ai do not accrue only to those in the technology sector ai makes many goods and services cheaper and that in turn benefits the poor and disadvantaged if software routes packages and shipments more efficiently then transportation costs will be lower if software and ai programs help economize on the use of electricity then it will be easier to mitigate climate change as computational biology improves health care the sick will benefitp
pthe people who least need ai are the superrich they already can hire armies of servants to manage their obligations schedules and so on they do not need to economize on the use of human labor the rest of us do whether directly or indirectly through the businesses we patronizep
panother benefit for lowerincome groups is that current manifestations of ai do not usually displace the jobs of the poor many poor individuals hold jobs in the service sector or perform manual labor those tasks are either hard to automate a robot gardener or because wages are low less profitable to automatep
pit may be true that the costs of ai in the labor force displaced jobs are more visible than the benefits of ai new jobs and lower prices so its not surprising if ai is not entirely popularp
blockquote
precommendedp
pthe post a relnofollow hrefhttpmarginalrevolutioncommarginalrevolution2022092022astheyearofaihtml2022 as the year of aia appeared first on a relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap
|
pthat topic relnoopener hrefhttpswwwbloombergcomopinionarticles20220909artificialintelligencewillbeagreatequalizercmpidsocialflowtwitterbusinessutm_campaignsocialfloworganicutm_sourcetwitterutm_mediumsocialutm_contentbusinesssrefhtohjx5y target_blankmy latest bloomberg columna excerptp blockquote pbut benefits ai accrue technology sector ai makes goods services cheaper turn benefits poor disadvantaged software routes packages shipments efficiently transportation costs lower software ai programs help economize use electricity easier mitigate climate change computational biology improves health care sick benefitp pthe people need ai superrich hire armies servants manage obligations schedules need economize use human labor rest directly indirectly businesses patronizep panother benefit lowerincome groups current manifestations ai usually displace jobs poor poor individuals hold jobs service sector perform manual labor tasks hard automate robot gardener wages low profitable automatep pit true costs ai labor force displaced jobs visible benefits ai new jobs lower prices surprising ai entirely popularp blockquote precommendedp pthe post relnofollow hrefhttpmarginalrevolutioncommarginalrevolution2022092022astheyearofaihtml2022 year aia appeared relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap
|
631d1123fffb92a35a6377da
|
US Economic Freedom is Falling
|
pimg sizesmaxwidth 768px 100vw 768px srchttpmarginalrevolutioncomwpcontentuploads202209averageeconomicfreedomrating768x7471png alt width768 srcsethttpmarginalrevolutioncomwpcontentuploads202209averageeconomicfreedomrating768x7471png 768w httpmarginalrevolutioncomwpcontentuploads202209averageeconomicfreedomrating768x7471300x292png 300w classwpimage84282 height747p
pa big drop in economic freedom mostly due to pandemic policies not surprising but will we recover this is from the just releaseda hrefhttpswwwfraserinstituteorgstudieseconomicfreedomoftheworld2022annualreport economic freedom of the world 2022 annual reportap
pthe post a relnofollow hrefhttpmarginalrevolutioncommarginalrevolution202209useconomicfreedomisfallinghtmlus economic freedom is fallinga appeared first on a relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap
|
pimg sizesmaxwidth 768px 100vw 768px srchttpmarginalrevolutioncomwpcontentuploads202209averageeconomicfreedomrating768x7471png alt width768 srcsethttpmarginalrevolutioncomwpcontentuploads202209averageeconomicfreedomrating768x7471png 768w httpmarginalrevolutioncomwpcontentuploads202209averageeconomicfreedomrating768x7471300x292png 300w classwpimage84282 height747p pa big drop economic freedom pandemic policies surprising recover releaseda hrefhttpswwwfraserinstituteorgstudieseconomicfreedomoftheworld2022annualreport economic freedom world 2022 annual reportap pthe post relnofollow hrefhttpmarginalrevolutioncommarginalrevolution202209useconomicfreedomisfallinghtmlus economic freedom fallinga appeared relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap
|
631d116afffb92a35a6377e6
|
The fall of Los Angeles
|
pthe post a relnofollow hrefhttpswwwspikedonlinecom20220910thefalloflosangelesthe fall of los angelesa appeared first on a relnofollow hrefhttpswwwspikedonlinecomspikedap
|
pthe post relnofollow hrefhttpswwwspikedonlinecom20220910thefalloflosangelesthe fall los angelesa appeared relnofollow hrefhttpswwwspikedonlinecomspikedap
|
631d11ccfffb92a35a6377f4
|
Do conservatives believe in a dangerous world?
|
pone recent study says nop
blockquotepdecades of research suggest a correlation between belief in a dangerous world and political conservatism however research relied on a scale that may overemphasize certain types of dangers furthermore few other world beliefs have been investigated such that fundamental worldview differences between liberals and conservatives remain largely unknown a preregistered study of nine samples in i 5461 mostly us americans found a negligible association between a newly improved measure of generalized dangerous world belief and conservatism and that the original scale emphasized certain dangers more salient to conservatives eg societal decline over others most salient for liberals eg injustice across many measures of political attitudes other world beliefssuch as beliefs that the world is hierarchical intentional just and worth exploringeach explained several times more variance than dangerous world belief this suggests the relevance of dangerous world belief to political attitudes has been overstated and examining other world beliefs may yield insightspblockquote
pthat is a relnoopener hrefhttpsjournalssagepubcomdoi10117719485506221119324 target_blankfrom jeremy dw clinton and nicholas kerrya i do not think you should overindex on these new results but in general you should start seeing this literature as increasingly dubiousp
pthe post a relnofollow hrefhttpmarginalrevolutioncommarginalrevolution202209doconservativesbelieveinadangerousworldhtmldo conservatives believe in a dangerous worlda appeared first on a relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap
|
pone recent study says nop blockquotepdecades research suggest correlation belief dangerous world political conservatism research relied scale overemphasize certain types dangers furthermore world beliefs investigated fundamental worldview differences liberals conservatives remain largely unknown preregistered study samples ini5461 americans found negligible association newly improved measure generalized dangerous world belief conservatism original scale emphasized certain dangers salient conservatives eg societal decline salient liberals eg injustice measures political attitudes world beliefssuch beliefs world hierarchical intentional worth exploringeach explained times variance dangerous world belief suggests relevance dangerous world belief political attitudes overstated examining world beliefs yield insightspblockquote pthat relnoopener hrefhttpsjournalssagepubcomdoi10117719485506221119324 target_blankfrom jeremy dw clinton nicholas kerrya think overindex new results general start seeing literature increasingly dubiousp pthe post relnofollow hrefhttpmarginalrevolutioncommarginalrevolution202209doconservativesbelieveinadangerousworldhtmldo conservatives believe dangerous worlda appeared relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap
|
631e622a0bb12b72fd6b6cfe
|
The forthcoming rate of economic growth?
|
blockquotepwith the current pace of development in ai and as demos turn into full featured products and services i can see the overall us gdp growth rising from recent avg 23 to 20 in 10 years this is a seismic shift which is really hard to think and reason aboutpblockquote
pthat is a relnoopener hrefhttpstwittercommobav0status1566821955033911302 target_blankfrom mohammad bavariana somehow i do not think that will be the case even in my most technologically optimistic moments as brad delong stresses the second industrial revolution starting about 1870 was the true one and we woke up fifty years later to an entirely different world based on electricity and consumer society and extreme physical mobility yet i am not aware of any extreme gdp or productivity stats during the intermediate period in fact the numbers i have seen seem a littlemediocre i say side with the reality not with the numbers but this is one of the questions i wish was studied much more is it simply the case that stringing together a series of qualitatively discrete changes inevitably will outrace our ability to measure itp
pby the way it seems the new malaria vaccine a relnoopener hrefhttpswwwbbccomnewshealth62797776 target_blankworks pretty wellap
pthe post a relnofollow hrefhttpmarginalrevolutioncommarginalrevolution202209theforthcomingrateofeconomicgrowthhtmlthe forthcoming rate of economic growtha appeared first on a relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap
|
blockquotepwith current pace development ai demos turn featured products services overall gdp growth rising recent avg 23 20 10 years seismic shift hard think reason aboutpblockquote pthat relnoopener hrefhttpstwittercommobav0status1566821955033911302 target_blankfrom mohammad bavariana think case technologically optimistic moments brad delong stresses second industrial revolution starting 1870 true woke years later entirely different world based electricity consumer society extreme physical mobility aware extreme gdp productivity stats intermediate period fact numbers seen littlemediocre reality numbers questions wish studied simply case stringing series qualitatively discrete changes inevitably outrace ability measure itp pby way new malaria vaccine relnoopener hrefhttpswwwbbccomnewshealth62797776 target_blankworks pretty wellap pthe post relnofollow hrefhttpmarginalrevolutioncommarginalrevolution202209theforthcomingrateofeconomicgrowthhtmlthe forthcoming rate economic growtha appeared relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap
|
631e62650bb12b72fd6b6d06
|
Goodbye, Globalization?
|
div
picture
source sizesminwidth 600px 331px 100vw typeimagewebp srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202208featuredreznerjpgwebp 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202208featuredreznerjpgwebp 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202208featuredrezner800x450jpgwebp 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202208featuredrezner600x338jpgwebp 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202208featuredrezner331x186jpgwebp 331w
source sizesminwidth 600px 331px 100vw typeimagejpeg srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202208featuredreznerjpg 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202208featuredreznerjpg 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202208featuredrezner800x450jpg 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202208featuredrezner600x338jpg 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202208featuredrezner331x186jpg 331w
img width1200 altillustration of a globe in a giant hand srchttpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202208featuredrezner800x450jpg height675
picture
div
pat the dawn of the 21st century countries in both the global south and the former communist bloc were falling over each other to lower their trade barriers liberalize their capital markets and encourage their best and brightest to study in the west multinational firms were expanding their supply chains to bring workers from mexico china vietnam india and russia into their fold the internet had created entirely new ways for information to cross borders labor productivity was soaring and global poverty was fallingp
pus politicians largely embraced this trend republicans and democrats cooperated to negotiate trade agreements with both longtime friends and former foes all this took place in a context of public optimism in january 2000 69 percent of americans told gallup they were satisfied with the countrys directionp
ptwo decades later things have not quite worked out the way many champions of free trade hoped at the end of president bill clintons administration neither china nor russia turned into liberal free market democracies two decades of unending war have been peppered by financial crises populist uprisings and pandemics russias invasion of ukraine and the ensuing sanctions are merely the latest shock to the systemp
pcountries are now falling over each other to erect new barriers to trade impose capital controls and restrict migration flows us politicians have embraced this trend too the strongest throughline between the donald trump and joe biden presidencies has been their hostility to economic openness all this is taking place in a context of public pessimism in march just 22 percent of americans told gallup they were satisfied with the countrys directionp
pthe souring of the 21st century has triggered accusations and recriminations about who bears responsibility for the end of quotthe end of historyquot free trade advocates note the enormous benefits that economic liberalization has brought to the global economy and decry the rise of neomercantilism in the united states and elsewhere but free trades critics offer a challenging rebuttal they argue the last two decades have exposed the internal contradictions of neoliberalism as they see it were witnessing the natural response of societies buffeted by the vicissitudes of the free market economic openness sowed the seeds of its own destructionp
pthere is a kernel of truth to this but a kernel of truth is not the whole truth and globalizations proponents do not need to completely rethink their priors the benefits of trade and international engagement persist even in the current erap
padvocates of free markets still have a strong case to make and they need to make it this particular argument against an open global economy has been made before when it triumphed the result was world warp
h2polanyis challengeh2
pto understand the intellectual roots of todays resistance to free markets the book to examine is karl polanyis emthe great transformationemp
ppolanyi writing in 1944 wanted to understand how the world had arrived at a low moment of depression fascism and war where writers like fa hayek saw socialisms rise as a tragic result of state interference in free markets polanyi viewed it as the ineluctable backlash against those same markets volatilityp
pthere are three arguments in emthe great transformationem that require recognition and response from free market enthusiasts first polanyi pushed back vigorously against the assumption that unregulated markets were the quotnaturalquot state of the world governments take concerted action polanyi noted to maintain the modern capitalist systemp
pone presentday example is intellectual property rights to incentivize innovation and creativity governments enforce laws that protect trademarks patents and copyrights if the state did not do that innovation would be lower but diffusion would be much more rapid as films software and pharmaceuticals would be pirated almost immediately the tradeoff of more innovation for less diffusion might be worth it but getting there requires purposive government actionp
ppolanyis second argument was that the ultimate result of laissez faire policies is quotthe demolition of societyquot according to emthe great transformationem human beings inevitably resist efforts to turn labor into a commodity market liberalization would produce rising inequality and then polanyis predictions turned rather gloomy quotrobbed of the protective covering of cultural institutions human beings would perish from the effect of social exposure they would die as the victims of acute social dislocation through vice perversion crime and starvation nature would be reduced to its elements neighborhoods and landscapes defiled rivers polluted military safety jeopardized the power to produce food and raw materials destroyedquotp
pfinally polanyi described what he called the quotdouble movementquot if the state consciously tried to create a marketplace disembedded from the rest of society it would trigger blowback against markets exactly how that double movement manifested itself could vary while socialists might call for expanded state support of the less fortunate another possible response would be xenophobic nationalism polanyi drew a straight line from 19th century globalization to the horrors of the 1930s and 40sp
phow accurate is all this in describing the current moment if we look at the united states we can see undeniable similarities the hidden shocks from liberalizing trade with china and migration from latin america combined with the very prominent shock of the 2008 financial crisis produced a lot of social disruption in the last 15 years throw in climate change a pandemic and greatpower rivalries and suddenly polanyis hyperbolic description of a society ravaged by the market starts to sound familiarp
pconsciously or unconsciously both leftwing and rightwing critics of the global economy rely on polanyis logic to connect the dots between neoliberalism and the current state of the world in february journalist glenn greenwald argued that canadian trucker protests were quota long time in the makingquot saying the underlying discontent reflected quotmass widespread anger and even hatred toward the neoliberal ruling class throughout the westquot that sentiment he said was bound to quotfind stillmore extreme expressionsquotp
ptucker carlsons rants on fox news are often premised on a similar logic in april for example he claimed that quotneoliberalism is looting with a smokescreen of race and gender politics so you wont notice that it happenedquot that ideology he said is quota cover for the distribution of wealth a distribution that has become more lopsided in our age than at any age everquot representing quota shocking discredit to capitalismquotp
h2testing the bicycle theoryh2
pthe great transformation is an important critique and it is unsurprising that people like greenwald and carlson have gravitated to some form of its arguments still there are clear problems with applying it to the modern worldp
pto begin with the countries that heeded polanyis warnings the most are facing the most severe populist blowback the entire ethos of the european union was to integrate the continents economies while supplying an ample social safety net for those in need despite these efforts to cushion the markets effects 21st century populism was percolating in europe well before trump won the american presidency particularly in the countries with the strongest social safety nets hostility to economic migration has been a recurring theme of european politics for the last two decades from fears of quotpolish plumbersquot inundating western europe to more recent backlashes against syrian and afghan refugees even nordic states such as sweden have turned far more nativist in the last decade it seems implausible to blame laissez faire capitalism for this blowbackp
presearch on the rise of populism provides further reason to be skeptical of that thesis most analyses of support for brexit and trumpmost prominently from political scientists pippa norris and ronald ingleharthave found that cultural backlash was the predominant factor to put it crudely workingclass whites reacted to perceived losses in social and economic standing by embracing a reactionary brand of politics and blaming immigrants and minorities for their troubles as cas mudde one of the deans of populism research wrote a few years ago the debate between cultural backlash and economic anxiety was debated by populist scholars for decades and settled in favor of the cultural backlash hypothesisp
palso contrary to polanyis thesis most americans have not turned against globalization in the united states there is a striking mismatch between the way politicians talk about how voters think about trade and immigration and the way voters actually think about these issuesp
paccording to the politicians americans are fed up with the jobdestroying impact of international trade and the wagelowering impact of immigration that take was apparent in congress response to bidens first state of the union address the biggest applause line was the presidents promise that quotwhen we use taxpayer dollars to rebuild america we are going to buy american buy american products to support american jobsquotp
ppolling data paint a different picture in 2021 according to gallup 79 percent of americans viewed trade positivelya record number while that percentage dropped to 63 percent in 2022 it was still considerably higher than it was during the heyday of globalization in the late 1990s gallups results on immigration are similar from 2000 to 2022 the percentage of americans who wanted more immigration more than tripled while the percentage who wanted less immigration fell by nearly halfp
pbut even if hostility to globalization does not appeal to the median american voter it does have some appeal to the pivotal american voter in the last few election cycles the key to victory has been through the rust belt and that meant demonstrating fealty to the idea that america used to be great before globalization furthermore supporters of free trade and immigration do not place a high priority on those issues while its salience for opponents is much higher that explains why us trade representative katherine tai is convinced that hillary clinton lost in 2016 in no small part due to the transpacific partnership a proposed trade pact among the united states and 11 other countriesp
pin response to this political reality successive administrations have taken whacks at the open global economy the trump administration withdrew from the transpacific partnership sabotaged the world trade organization wto raised tariffs across a wide variety of goods launched a trade war with china and expended significant effort to reduce migration to the united states the biden administration has continued most of these policiesp
pno progress has been made on reviving the wto as a force for trade liberalization there has been a moratorium on new trade deals tai has insisted despite all evidence to the contrary that the china tariffs provide bargaining leverage so the trade war with china persists the biden administration has made scant effort to increase immigration flowsp
pthe two administrations signature foreign economic deals reflect their resistance to the open global economy the trump administration renegotiated the north american free trade agreement which became the more restrictive united statesmexicocanada agreement usmca the biden administration launched the indopacific economic framework for prosperity to entice partners away from excessive dependence on china the most telling fact about this proposed agreement is that it does not include what trade negotiators call quotmarket accessquotie reduced import barriers this is a trade deal with no additional trade in itp
palthough critics like greenwald and carlson attack the current administration as neoliberal bidens team is just as prone to repeating polanyis critique as they are quotto bidens officialsquot empolitico emnoted in may quotthe last four decades of neoliberal economic policypursued through tax cuts weaker regulations and proglobalization trade dealsare largely to blame for todays spiraling inequality and economic nationalismquotp
pthe response to russias unprovoked invasion of ukraine intensified the attack on global openness the unprecedented sanctions imposed on russia have segmented the global economy increasing food and fuel prices more than 700 multinational corporations pulled back from their operations in russia far exceeding what was legally required the longer the war goes on the more permanent the spike in geopolitical risk seems little wonder that a host of investment letters joined blackrocks larry fink in warning that russias invasion quothas put an end to the globalization we have experienced over the last three decadesquotp
ponce upon a time when the united states was the international leader of trade liberalization policy wonks talked about the quotbicycle theoryquot of trade negotiations the metaphor was simple for all the benefits of freer trade ideological and interestgroup opposition to it was always strong if trade negotiators continued to push for greater openness the trade bicycle would maintain speed and be easy to ride but if momentum stalled the whole edifice would tip over like a bicycle that slows to a crawl protectionist forces would agitate for exceptions carveouts and restrictions making the global economy less and less freep
pin the next few years we will find out if the bicycle theory was right because it is safe to say that us economic liberalization has ground to a halt thanks to polanyis double movement over the past five years the united states and the global economy have halted the push toward openness and are trending toward closurep
h2making economies less resilienth2
pthe great transformation posited that a shift toward unregulated markets would trigger a social backlash leading to a reregulated economy but what happens when a more protectionist economy creates its own forms of economic malaise maybe the next double movement will force a return to a more open economyp
pinflation is the most obvious way that increased protectionism has been a drag on the us economy one underrated benefit of an a hrefhttpsreasoncomvideo20220817thetruthaboutglobalizationopen global economya is that trade increases productivity which allows the economy to grow at a faster rate without triggering price hikes this is particularly true of the united states greater demand for goods can be absorbed by greater imports greater demand for labor can be met by a large influx of foreign workersp
pduring the pandemic years the federal government sustained demand through fiscal and monetary stimulus it paid considerably less attention to the supply side of the ledger helping fuel a surge of inflation unseen since the 1970sp
pamericans continued to buy imported goods at record levels regardless of the tariffs and that contributed to rising prices the peterson institute for international economics estimates that if the united states ended the trade war with china eliminated steel and aluminum tariffs and ended softwood lumber duties on canada the inflation rate would be cut by 13 percentage points quotremoving the china tariffs is the singlelargest policy lever to bring down inflation that president biden hasquot economist jason furman declared in april within the biden administration both treasury secretary janet yellen and nowformer deputy national security adviser daleep singh suggested lifting tariffs as one way of fighting shortterm inflationp
pby itself trade liberalization will ameliorate inflation but not cure it indeed many critics of globalization argue that the global supply chain stresses caused by the pandemic reinforced the case for insourcing the biden administration has echoed that argument which overlooks something economists have been trying to explain for years countries that are more integrated into global value chains experience far fewer price shocks than less integrated countriesp
pthe idea that globalization enhances economic resilience is counterintuitive especially as china seems to shut down its port facilities on a regular basis so consider the baby formula crisis that emerged this springp
pthis is a market where the united states is usually selfsufficient 98 percent of infant formula consumed by americans is manufactured in the united states the market suffered a supply shock when the formula produced at one michigan plant was recalled due to suspected bacterial contamination the food and drug administration fda subsequently shut down the plantp
pthat is exactly the sort of situation in which imports can smooth out supply but thanks to the trump and biden administrations that did not happen infant formula is subject to tariffrate quotas of 175 percent after certain quantities are imported the usmca sharply limited how much formula canada could export to the united states the fda prevented imports from the european union over picayune disputes about labelingp
pthe result by may more than 40 percent of stores were out of baby formula and the military was airlifting emergency supplies from europe quotwere seeing what happens when we reduce trade with other countries for an essential goodquot emthe atlanticems derek thompson observed quotwere more vulnerable to emergencies like a bacteriainfested plant in michiganquot protectionism and excessive regulation make an economy less resilient during such emergenciesp
pan immigration shortfall created by the pandemic and increased restrictions is also taking a toll economists estimate that 2 million fewer workingage immigrants entered the united states than would have been the case if pre2020 migration patterns had persisted contrary to public perception most of these missing immigrants would have been collegeeducated the sectors of the economy that are most dependent on immigrants including hospitality food service and stemrelated fields have seen especially high rates of unfilled jobs and that in turn has helped push prices higherp
pthe trump and biden administrations have either imposed or maintained a welter of policies designed to restrict and regulate the crossborder movement of goods services and people that has made the united states not more resilient but less productive and more vulnerable to local shocks as edward alden recently warned in emforeign policyem quotit is often a small step from prudent selfsufficiency to damaging attempts at autarkyquotp
h2the next reaganh2
pone could argue that there have been three double movements in the last 150 years in response to the 19th century era of globalization the major economies of europe launched a series of trade wars against each other in a prelude to world war i the global economy opened up again in the 1920s but as the great depression worsened the large economies ratcheted up tariffs restricted immigration or engaged in beggarthyneighbor policies in the runup to world war iip
pthe last double movement came after the united states went off the gold standard in 1971 the result was a decade of inflation a surge in commodity prices and an explosion of protectionism but unlike the previous two waves the backlash of the 1970s was channeled into president ronald reagans sunny optimism of the 1980sp
preagan was not a consistent free trader his administration pioneered the practice of voluntary export restraintsin which the exporting country voluntarily restricts its exports a tactic that hurts consumers while benefiting domestic producersthat trumps chief trade negotiator embraced as his preferred tactic but reagan negotiated trade deals supported increases in immigration and repeatedly argued that globalization would benefit the united states and the classical liberal values it held dear when reagan made americans more optimistic about the future he made them more enthusiastic about an open global economyp
pamericans are anything but optimistic right now and critics will continue to use polanyilike arguments to blame the excesses of neoliberalism but protectionists have been in power for the last six years and their policies are partially responsible for steep inflation goods shortages and a faltering service sector perhaps this next decade will produce a successor to reagan someone who can marry hardheaded economics with the optimism necessary to sell itp
pthe alternative is dire quotthe true nature of the international system under which we were living was not realized until it failedquot polanyi wrote in emthe great transformationem quothardly anyone understood the political function of the international monetary system the awful suddenness of the transformation thus took the world completely by surprisewhen it broke the effect was bound to be instantaneousquotp
pthe post a relnofollow hrefhttpsreasoncom20220911goodbyeglobalizationgoodbye globalizationa appeared first on a relnofollow hrefhttpsreasoncomreasoncomap
|
div picture source sizesminwidth 600px 331px 100vw typeimagewebp srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202208featuredreznerjpgwebp 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202208featuredreznerjpgwebp 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202208featuredrezner800x450jpgwebp 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202208featuredrezner600x338jpgwebp 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202208featuredrezner331x186jpgwebp 331w source sizesminwidth 600px 331px 100vw typeimagejpeg srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202208featuredreznerjpg 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202208featuredreznerjpg 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202208featuredrezner800x450jpg 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202208featuredrezner600x338jpg 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202208featuredrezner331x186jpg 331w img width1200 altillustration globe giant hand srchttpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202208featuredrezner800x450jpg height675 picture div pat dawn 21st century countries global south communist bloc falling lower trade barriers liberalize capital markets encourage best brightest study west multinational firms expanding supply chains bring workers mexico china vietnam india russia fold internet created entirely new ways information cross borders labor productivity soaring global poverty fallingp pus politicians largely embraced trend republicans democrats cooperated negotiate trade agreements longtime friends foes took place context public optimism january 2000 69 percent americans told gallup satisfied countrys directionp ptwo decades later things worked way champions free trade hoped end president bill clintons administration china russia turned liberal free market democracies decades unending war peppered financial crises populist uprisings pandemics russias invasion ukraine ensuing sanctions merely latest shock systemp pcountries falling erect new barriers trade impose capital controls restrict migration flows politicians embraced trend strongest throughline donald trump joe biden presidencies hostility economic openness taking place context public pessimism march 22 percent americans told gallup satisfied countrys directionp pthe souring 21st century triggered accusations recriminations bears responsibility end quotthe end historyquot free trade advocates note enormous benefits economic liberalization brought global economy decry rise neomercantilism united states free trades critics offer challenging rebuttal argue decades exposed internal contradictions neoliberalism witnessing natural response societies buffeted vicissitudes free market economic openness sowed seeds destructionp pthere kernel truth kernel truth truth globalizations proponents need completely rethink priors benefits trade international engagement persist current erap padvocates free markets strong case need particular argument open global economy triumphed result world warp h2polanyis challengeh2 pto understand intellectual roots todays resistance free markets book examine karl polanyisemthe great transformationemp ppolanyi writing 1944 wanted understand world arrived low moment depression fascism war writers like fa hayek saw socialisms rise tragic result state interference free markets polanyi viewed ineluctable backlash markets volatilityp pthere arguments inemthe great transformationemthat require recognition response free market enthusiasts polanyi pushed vigorously assumption unregulated markets quotnaturalquot state world governments concerted action polanyi noted maintain modern capitalist systemp pone presentday example intellectual property rights incentivize innovation creativity governments enforce laws protect trademarks patents copyrights state innovation lower diffusion rapid films software pharmaceuticals pirated immediately tradeoff innovation diffusion worth getting requires purposive government actionp ppolanyis second argument ultimate result laissez faire policies quotthe demolition societyquot according toemthe great transformationem human beings inevitably resist efforts turn labor commodity market liberalization produce rising inequality polanyis predictions turned gloomy quotrobbed protective covering cultural institutions human beings perish effect social exposure die victims acute social dislocation vice perversion crime starvation nature reduced elements neighborhoods landscapes defiled rivers polluted military safety jeopardized power produce food raw materials destroyedquotp pfinally polanyi described called quotdouble movementquot state consciously tried create marketplace disembedded rest society trigger blowback markets exactly double movement manifested vary socialists expanded state support fortunate possible response xenophobic nationalism polanyi drew straight line 19th century globalization horrors 1930s 40sp phow accurate describing current moment look united states undeniable similarities hidden shocks liberalizing trade china migration latin america combined prominent shock 2008 financial crisis produced lot social disruption 15 years throw climate change pandemic greatpower rivalries suddenly polanyis hyperbolic description society ravaged market starts sound familiarp pconsciously unconsciously leftwing rightwing critics global economy rely polanyis logic connect dots neoliberalism current state world february journalist glenn greenwald argued canadian trucker protests quota long time makingquot saying underlying discontent reflected quotmass widespread anger hatred neoliberal ruling class westquot sentiment said bound quotfind stillmore extreme expressionsquotp ptucker carlsons rants fox news premised similar logic april example claimed quotneoliberalism looting smokescreen race gender politics wont notice happenedquot ideology said quota cover distribution wealth distribution lopsided age age everquot representing quota shocking discredit capitalismquotp h2testing bicycle theoryh2 pthe great transformation important critique unsurprising people like greenwald carlson gravitated form arguments clear problems applying modern worldp pto begin countries heeded polanyis warnings facing severe populist blowback entire ethos european union integrate continents economies supplying ample social safety net need despite efforts cushion markets effects 21st century populism percolating europe trump won american presidency particularly countries strongest social safety nets hostility economic migration recurring theme european politics decades fears quotpolish plumbersquot inundating western europe recent backlashes syrian afghan refugees nordic states sweden turned far nativist decade implausible blame laissez faire capitalism blowbackp presearch rise populism provides reason skeptical thesis analyses support brexit trumpmost prominently political scientists pippa norris ronald ingleharthave found cultural backlash predominant factor crudely workingclass whites reacted perceived losses social economic standing embracing reactionary brand politics blaming immigrants minorities troubles cas mudde deans populism research wrote years ago debate cultural backlash economic anxiety debated populist scholars decades settled favor cultural backlash hypothesisp palso contrary polanyis thesis americans turned globalization united states striking mismatch way politicians talk voters think trade immigration way voters actually think issuesp paccording politicians americans fed jobdestroying impact international trade wagelowering impact immigration apparent congress response bidens state union address biggest applause line presidents promise quotwhen use taxpayer dollars rebuild america going buy american buy american products support american jobsquotp ppolling data paint different picture 2021 according gallup 79 percent americans viewed trade positivelya record number percentage dropped 63 percent 2022 considerably higher heyday globalization late 1990s gallups results immigration similar 2000 2022 percentage americans wanted immigration tripled percentage wanted immigration fell nearly halfp pbut hostility globalization appeal median american voter appeal pivotal american voter election cycles key victory rust belt meant demonstrating fealty idea america great globalization furthermore supporters free trade immigration place high priority issues salience opponents higher explains trade representative katherine tai convinced hillary clinton lost 2016 small transpacific partnership proposed trade pact united states 11 countriesp pin response political reality successive administrations taken whacks open global economy trump administration withdrew transpacific partnership sabotaged world trade organization wto raised tariffs wide variety goods launched trade war china expended significant effort reduce migration united states biden administration continued policiesp pno progress reviving wto force trade liberalization moratorium new trade deals tai insisted despite evidence contrary china tariffs provide bargaining leverage trade war china persists biden administration scant effort increase immigration flowsp pthe administrations signature foreign economic deals reflect resistance open global economy trump administration renegotiated north american free trade agreement restrictive united statesmexicocanada agreement usmca biden administration launched indopacific economic framework prosperity entice partners away excessive dependence china telling fact proposed agreement include trade negotiators quotmarket accessquotie reduced import barriers trade deal additional trade itp palthough critics like greenwald carlson attack current administration neoliberal bidens team prone repeating polanyis critique quotto bidens officialsquotempoliticoemnoted quotthe decades neoliberal economic policypursued tax cuts weaker regulations proglobalization trade dealsare largely blame todays spiraling inequality economic nationalismquotp pthe response russias unprovoked invasion ukraine intensified attack global openness unprecedented sanctions imposed russia segmented global economy increasing food fuel prices 700 multinational corporations pulled operations russia far exceeding legally required longer war goes permanent spike geopolitical risk little wonder host investment letters joined blackrocks larry fink warning russias invasion quothas end globalization experienced decadesquotp ponce time united states international leader trade liberalization policy wonks talked quotbicycle theoryquot trade negotiations metaphor simple benefits freer trade ideological interestgroup opposition strong trade negotiators continued push greater openness trade bicycle maintain speed easy ride momentum stalled edifice tip like bicycle slows crawl protectionist forces agitate exceptions carveouts restrictions making global economy freep pin years find bicycle theory right safe economic liberalization ground halt thanks polanyis double movement past years united states global economy halted push openness trending closurep h2making economies resilienth2 pthe great transformation posited shift unregulated markets trigger social backlash leading reregulated economy happens protectionist economy creates forms economic malaise maybe double movement force return open economyp pinflation obvious way increased protectionism drag economy underrated benefit hrefhttpsreasoncomvideo20220817thetruthaboutglobalizationopen global economya trade increases productivity allows economy grow faster rate triggering price hikes particularly true united states greater demand goods absorbed greater imports greater demand labor met large influx foreign workersp pduring pandemic years federal government sustained demand fiscal monetary stimulus paid considerably attention supply ledger helping fuel surge inflation unseen 1970sp pamericans continued buy imported goods record levels regardless tariffs contributed rising prices peterson institute international economics estimates united states ended trade war china eliminated steel aluminum tariffs ended softwood lumber duties canada inflation rate cut 13 percentage points quotremoving china tariffs singlelargest policy lever bring inflation president biden hasquot economist jason furman declared april biden administration treasury secretary janet yellen nowformer deputy national security adviser daleep singh suggested lifting tariffs way fighting shortterm inflationp pby trade liberalization ameliorate inflation cure critics globalization argue global supply chain stresses caused pandemic reinforced case insourcing biden administration echoed argument overlooks economists trying explain years countries integrated global value chains experience far fewer price shocks integrated countriesp pthe idea globalization enhances economic resilience counterintuitive especially china shut port facilities regular basis consider baby formula crisis emerged springp pthis market united states usually selfsufficient 98 percent infant formula consumed americans manufactured united states market suffered supply shock formula produced michigan plant recalled suspected bacterial contamination food drug administration fda subsequently shut plantp pthat exactly sort situation imports smooth supply thanks trump biden administrations happen infant formula subject tariffrate quotas 175 percent certain quantities imported usmca sharply limited formula canada export united states fda prevented imports european union picayune disputes labelingp pthe result 40 percent stores baby formula military airlifting emergency supplies europe quotwere seeing happens reduce trade countries essential goodquotemthe atlanticems derek thompson observed quotwere vulnerable emergencies like bacteriainfested plant michiganquot protectionism excessive regulation economy resilient emergenciesp pan immigration shortfall created pandemic increased restrictions taking toll economists estimate 2 million fewer workingage immigrants entered united states case pre2020 migration patterns persisted contrary public perception missing immigrants collegeeducated sectors economy dependent immigrants including hospitality food service stemrelated fields seen especially high rates unfilled jobs turn helped push prices higherp pthe trump biden administrations imposed maintained welter policies designed restrict regulate crossborder movement goods services people united states resilient productive vulnerable local shocks edward alden recently warned inemforeign policyem quotit small step prudent selfsufficiency damaging attempts autarkyquotp h2the reaganh2 pone argue double movements 150 years response 19th century era globalization major economies europe launched series trade wars prelude world war global economy opened 1920s great depression worsened large economies ratcheted tariffs restricted immigration engaged beggarthyneighbor policies runup world war iip pthe double movement came united states went gold standard 1971 result decade inflation surge commodity prices explosion protectionism unlike previous waves backlash 1970s channeled president ronald reagans sunny optimism 1980sp preagan consistent free trader administration pioneered practice voluntary export restraintsin exporting country voluntarily restricts exports tactic hurts consumers benefiting domestic producersthat trumps chief trade negotiator embraced preferred tactic reagan negotiated trade deals supported increases immigration repeatedly argued globalization benefit united states classical liberal values held dear reagan americans optimistic future enthusiastic open global economyp pamericans optimistic right critics continue use polanyilike arguments blame excesses neoliberalism protectionists power years policies partially responsible steep inflation goods shortages faltering service sector decade produce successor reagan marry hardheaded economics optimism necessary sell itp pthe alternative dire quotthe true nature international system living realized failedquot polanyi wrote inemthe great transformationem quothardly understood political function international monetary system awful suddenness transformation took world completely surprisewhen broke effect bound instantaneousquotp pthe post relnofollow hrefhttpsreasoncom20220911goodbyeglobalizationgoodbye globalizationa appeared relnofollow hrefhttpsreasoncomreasoncomap
|
631fb3581f586e0647ddc300
|
Why Ukraine’s successful offensive is such bad news for Vladimir Putin
|
figure dataanvatoplayeridp1
div
divdiv
div
div datareactcomponentanvatovideoplayerdiv
figure
pukraines battleground offensive that has seen it gain thousands of miles of territory once lost to moscow spells bad news for russian president vladimir putin at home and abroad p
pthe ukrainians performance has amplified dissent in russia has strengthened president bidens hand in rallying support for the country has opened up new opportunities for kyiv and is expected to make it harder for russia to find support from its alliesp
pclearly theyre fighting hard a senior us defense official told reporters on monday of the ukrainian troops noting that russian forces have largely ceded their gains to the ukrainians in the vicinity of kharkiv province with many of the russian forces moving back over the border into russia p
pthe ukrainian military last week began a relnoreferrer noopener hrefhttpsthehillcomhomenewsapapinternationalapukrainekeepsinitiativeclaimsitreachedrussianborder target_blanka counteroffensivea that quickly reclaimed territory and pushed russian troops back to the northeastern border of the country in some placesp
pthe lightning advance forced thousands of kremlin troops to make a quick retreat leaving behind ammunition stockpiles and equipment reports of abandonment that could be indicative of russias disorganized command and control the defense official saidp
pon monday ukrainian president volodymyr zelensky said his forces had recaptured 6000 square kilometers of land in the east and south of ukraine since the start of september included in the towns reclaimed was izyum a key city in the fight p
pthe loss of izyum marks russias worst military defeat since march when its troops were unable to take the ukrainian capital of kyiv and were forced backp
pfor ukraine the rapid advance could be a turning point in the 6monthold war that moves the fighting out of a battle of attritionp
pfor russia and putin it could force some very tough decisions on conscription and the future of a war that moscow still insists is merely a special military operationp
pits a time of choosing for president putin said eric ueland the under secretary of state for civilian security democracy and human rights under former president trump for allies in the west its a time of vigilance constant communication and clear lines about what would not be acceptable from russia especially on the military front as president putin and his leadership are continuing to process whats going on in ukrainep
figure classwpblockimageimg sizesmaxwidth 899px 100vw 876px srchttpsthehillcomwpcontentuploadssites2202209gettyimages1243163470editedjpg width2400 alt srcsethttpsthehillcomwpcontentuploadssites2202209gettyimages1243163470editedjpg 2400w httpsthehillcomwpcontentuploadssites2202209gettyimages1243163470editedjpgresize16090 160w httpsthehillcomwpcontentuploadssites2202209gettyimages1243163470editedjpgresize300169 300w httpsthehillcomwpcontentuploadssites2202209gettyimages1243163470editedjpgresize768432 768w httpsthehillcomwpcontentuploadssites2202209gettyimages1243163470editedjpgresize1280720 1280w httpsthehillcomwpcontentuploadssites2202209gettyimages1243163470editedjpgresize1536864 1536w httpsthehillcomwpcontentuploadssites2202209gettyimages1243163470editedjpgresize20481152 2048w httpsthehillcomwpcontentuploadssites2202209gettyimages1243163470editedjpgresize645363 645w httpsthehillcomwpcontentuploadssites2202209gettyimages1243163470editedjpgresize320180 320w httpsthehillcomwpcontentuploadssites2202209gettyimages1243163470editedjpgresize256144 256w httpsthehillcomwpcontentuploadssites2202209gettyimages1243163470editedjpgresize512288 512w httpsthehillcomwpcontentuploadssites2202209gettyimages1243163470editedjpgresize640360 640w httpsthehillcomwpcontentuploadssites2202209gettyimages1243163470editedjpgresize876492 876w httpsthehillcomwpcontentuploadssites2202209gettyimages1243163470editedjpgresize1752986 1752w httpsthehillcomwpcontentuploadssites2202209gettyimages1243163470editedjpgresize960540 960w httpsthehillcomwpcontentuploadssites2202209gettyimages1243163470editedjpgresize19201080 1920w httpsthehillcomwpcontentuploadssites2202209gettyimages1243163470editedjpgresize5028 50w classwpimage3639433 height1350figure
prussian president vladimir putin chairs a meeting on economic issues via a video link at the kremlin in moscow on september 12 2022 photo by gavriil grigorov sputnik afpp
pheidi creborediker adjunct senior fellow at the council on foreign relations noted that putin could react harshly to the increasing momentum from ukrainep
pto the extent that there can be any gains made by ukraine so much to their credit i fear now the retaliation that we could see from putin in the coming days and weeks could be even more brutal against civilians than weve seen already she saidp
pin an attempt to kneecap russia and help ukrainian forces the united states has been at the forefront of imposing harsh sanctions on moscow and sending military and humanitarian aid to ukraine since the war began to keep ukraine supplied with a steady stream of weapons the us since april has led a 50country effort known as the ukraine contact group to coordinate the flow of military assistance p
plast week us officials announced a relnoreferrer noopener hrefhttpsthehillcompolicydefense3634249ustosend2btoukraine18othercountriesatriskofrussia target_blanka new 675 million packagea of weapons and equipment for kyiv as well as 22 billion in longterm military support to bolster the security of ukraine and 18 nearby countries at risk of any future russian attackp
pwe see how bravely the ukrainians have been fighting to fight for their freedom and we support that white house press secretary karine jeanpierre said on monday adding that the white house is grateful for the bipartisan support for ukraine aidp
pin russia the retreat has caused problems for putin beyond the embarrassment of his forces appearing to be caught flatfooted more than 30 russian municipal deputies have signed a petition calling for the longtime leaders resignation a rare criticism of the president who over the years has sought to quash oppositionp
prussian nationalists have also called on putin to make immediate changes to the kremlin military campaign a relnoreferrer noopener hrefhttpswwwreuterscomworldeuroperussiannationalistsrageafterstunningsetbackukraine20220911 target_blankreuters reportedap
pand chechen leader ramzan kadyrov a key putin ally on sunday criticized russias military for the retreatp
pthey have made mistakes and i think they will draw the necessary conclusionsquot kadyrov said in a message posted to his telegram account and translated by a relnoreferrer noopener hrefhttpswwwtheguardiancomworld2022sep11putinloyalistkadyrovcriticisesrussianarmysperformanceoverukraineretreat target_blankthe guardianap
pputin has also faced dissent since ukraines increased counteroffensive from russian media commentators which ueland argued could spark a change in his strategyp
pso what does he choose to do if there is a steady erosion of public support for him and russia does that mean he redoubles his efforts in ukraine does that mean that he moves to try to suppress internal dissent does that mean he moves to put scapegoats out front for some of the failures here nobody knows he said and its very unpredictablep
pcreborediker said she was heartened by the small crack in the ice with the discourse on russian television over the weekend but said it could lead to more action from putinp
pi think that the likely path for putin moving forward is more indiscriminate attacks more internal televised calls for more mobilization a potential staged rampup or conscription of military recruits from throughout russia she said russia will in some way need to build up its troop levels to take on ukraine moving forward p
pthe stunning losses for russia come as moscow has desperately sought weapons and aid from allies including iran and north korea and has played up its support from china beijing so far has not publicly provided any help but has refused to condemn the war and has criticized sanctions against russiap
pputin and chinese president xi jinping this week are expected to speak on the sidelines of a regional summit in uzbekistan the first time the two will meet face to face since russias invasion of ukraine on feb 24p
pthe united states is carefully watching the interaction as the two countries have become closer partners in recent years p
pweve made clear about our concerns about the depth of chinas alignment and ties with russia even as russia prosecutes a war of aggression in ukraine jeanpierre saidp
psamar ali white house fellow at the department of homeland security under former president obama said that if china were to pull support for russia it could lead to the withdrawal of support from other russian allies such as north korea and iranp
pif we see that china decides that putins not the horse to back right now obviously i think thats favorable for the world for global stability and order she said so well have to see if china shifts its energy away from putin will other countries follow and will that weaken putin further and strengthen ukraine us and our alliesp
pcreborediker however argued china is unlikely to discredit putin despite moscows problemsp
pi dont know if theres any hope that behind the scenes china might play at some point a more constructive role than it has to date but certainly in this upcoming meeting i dont imagine that there would be any public display of disunity she saidp
|
figure dataanvatoplayeridp1 div divdiv div div datareactcomponentanvatovideoplayerdiv figure pukraines battleground offensive seen gain thousands miles territory lost moscow spells bad news russian president vladimir putin home abroadp pthe ukrainians performance amplified dissent russia strengthened president bidens hand rallying support country opened new opportunities kyiv expected harder russia find support alliesp pclearly theyre fighting harda senior defense official told reporters monday ukrainian troops noting russian forces largely ceded gains ukrainians vicinity kharkiv province russian forces moving border russiap pthe ukrainian military week began relnoreferrer noopener hrefhttpsthehillcomhomenewsapapinternationalapukrainekeepsinitiativeclaimsitreachedrussianborder target_blanka counteroffensiveathat quickly reclaimed territory pushed russian troops northeastern border country placesp pthe lightning advance forced thousands kremlin troops quick retreat leaving ammunition stockpiles equipment reports abandonment indicative russias disorganized command control defense official saidp pon monday ukrainian president volodymyr zelensky said forces recaptured 6000 square kilometers land east south ukraine start september included towns reclaimed izyum key city fightp pthe loss izyum marks russias worst military defeat march troops unable ukrainian capital kyiv forced backp pfor ukraine rapid advance turning point 6monthold war moves fighting battle attritionp pfor russia putin force tough decisions conscription future war moscow insists merely special military operationp pits time choosing president putin said eric ueland secretary state civilian security democracy human rights president trump allies west time vigilance constant communication clear lines acceptable russia especially military president putin leadership continuing process whats going ukrainep figure classwpblockimageimg sizesmaxwidth 899px 100vw 876px srchttpsthehillcomwpcontentuploadssites2202209gettyimages1243163470editedjpg width2400 alt srcsethttpsthehillcomwpcontentuploadssites2202209gettyimages1243163470editedjpg 2400w httpsthehillcomwpcontentuploadssites2202209gettyimages1243163470editedjpgresize16090 160w httpsthehillcomwpcontentuploadssites2202209gettyimages1243163470editedjpgresize300169 300w httpsthehillcomwpcontentuploadssites2202209gettyimages1243163470editedjpgresize768432 768w httpsthehillcomwpcontentuploadssites2202209gettyimages1243163470editedjpgresize1280720 1280w httpsthehillcomwpcontentuploadssites2202209gettyimages1243163470editedjpgresize1536864 1536w httpsthehillcomwpcontentuploadssites2202209gettyimages1243163470editedjpgresize20481152 2048w httpsthehillcomwpcontentuploadssites2202209gettyimages1243163470editedjpgresize645363 645w httpsthehillcomwpcontentuploadssites2202209gettyimages1243163470editedjpgresize320180 320w httpsthehillcomwpcontentuploadssites2202209gettyimages1243163470editedjpgresize256144 256w httpsthehillcomwpcontentuploadssites2202209gettyimages1243163470editedjpgresize512288 512w httpsthehillcomwpcontentuploadssites2202209gettyimages1243163470editedjpgresize640360 640w httpsthehillcomwpcontentuploadssites2202209gettyimages1243163470editedjpgresize876492 876w httpsthehillcomwpcontentuploadssites2202209gettyimages1243163470editedjpgresize1752986 1752w httpsthehillcomwpcontentuploadssites2202209gettyimages1243163470editedjpgresize960540 960w httpsthehillcomwpcontentuploadssites2202209gettyimages1243163470editedjpgresize19201080 1920w httpsthehillcomwpcontentuploadssites2202209gettyimages1243163470editedjpgresize5028 50w classwpimage3639433 height1350figure prussian president vladimir putin chairs meeting economic issues video link kremlin moscow september 12 2022 photo gavriil grigorov sputnik afpp pheidi creborediker adjunct senior fellow council foreign relations noted putin react harshly increasing momentum ukrainep pto extent gains ukraine credit fear retaliation putin coming days weeks brutal civilians weve seen saidp pin attempt kneecap russia help ukrainian forces united states forefront imposing harsh sanctions moscow sending military humanitarian aid ukraine war beganto ukraine supplied steady stream weapons april led 50country effort known ukraine contact group tocoordinate flow military assistancep plast week officials announceda relnoreferrer noopener hrefhttpsthehillcompolicydefense3634249ustosend2btoukraine18othercountriesatriskofrussia target_blanka new 675 million packageaof weapons equipment kyiv 22 billion longterm military support bolster security ukraine 18 nearby countries risk future russian attackp pwe bravely ukrainians fighting fight freedom support white house press secretary karine jeanpierre said monday adding white house grateful bipartisan support ukraine aidp pin russia theretreat caused problems putin embarrassment forces appearing caught flatfooted 30 russian municipal deputies signed petition calling longtime leaders resignation rare criticism president years sought quash oppositionp prussian nationalists called putin immediate changes kremlin military campaigna relnoreferrer noopener hrefhttpswwwreuterscomworldeuroperussiannationalistsrageafterstunningsetbackukraine20220911 target_blankreuters reportedap pand chechen leader ramzan kadyrov key putin ally sunday criticized russias military retreatp pthey mistakes think draw necessary conclusionsquot kadyrov said message posted telegram account translated bya relnoreferrer noopener hrefhttpswwwtheguardiancomworld2022sep11putinloyalistkadyrovcriticisesrussianarmysperformanceoverukraineretreat target_blankthe guardianap pputin faced dissent ukraines increased counteroffensive russian media commentators ueland argued spark change strategyp pso choose steady erosion public support russia mean redoubles efforts ukraine mean moves try suppress internal dissent mean moves scapegoats failures knows said unpredictablep pcreborediker said heartened small crack ice discourse russian television weekend said lead action putinp pi think likely path putin moving forward indiscriminate attacks internal televised calls mobilization potential staged rampup conscription military recruits russia said russia way need build troop levels ukraine moving forwardp pthe stunning losses russia come moscow desperately sought weapons aid allies including iran north korea played support china beijing far publicly provided help refused condemn war criticized sanctions russiap pputin chinese president xi jinping week expected speak sidelines regional summit uzbekistan time meet face face russias invasion ukraine feb 24p pthe united states carefully watching interaction countries closer partners recent yearsp pweve clear concerns depth chinas alignment ties russia russia prosecutes war aggression ukraine jeanpierre saidp psamar ali white house fellow department homeland security president obama said china pull support russia lead withdrawal support russian allies north korea iranp pif china decides putins horse right obviously think thats favorable world global stability order said china shifts energy away putin countries follow weaken putin strengthen ukraine alliesp pcreborediker argued china unlikely discredit putin despite moscows problemsp pi dont know theres hope scenes china play point constructive role date certainly upcoming meeting dont imagine public display disunity saidp
|
631fb3591f586e0647ddc302
|
Biden pitches ‘cancer moonshot’ as bipartisan pursuit
|
ppresident biden on monday pitched his quotcancer moonshotquot initiative as a bipartisan pursuit that should bring americans together comparing it to former president kennedys famous moonshot initiativep
pcancer does not discriminate red and blue it doesnt care if youre republican or a democrat beating cancer is something we can do together and thats why im here today biden said at the john f kennedy presidential library and museum in bostonp
phis speech was delivered on the 60th anniversary of kennedys moonshot speech at rice university in houston during which he outlined his plan for the us to become an international leader in space explorationp
punwilling to postpone president kennedy set a goal to win the space race against russia and advance science and technology for all of humanity he saidp
ptogether we can choose to move forward with unity hope and optimism and i believe we can usher in the same unwillingness to postpone the same national purpose that will serve to organize and measure the best of our energies and skills to end cancer as we know it and even cure cancers once and for all he addedp
pbiden called the initiative bold ambitious and completely doablep
pthe initiative which he relaunched in february aims to cut the cancer death rate in half over the next 25 years and improve the lives of caregivers and cancer survivorsp
pbiden a hrefhttpsthehillcomhomenewsadministration3638371bidentosignexecutiveorderaspartofupdateoncancermoonshotannounced on mondaya the appointment of renee wegrzyn as the inaugural director of the advanced research projects agency for health an agency created in march focused on developing biomedical technologies to improve health outcomesp
padditionally he signed an executive order launching a national biotechnology and biomanufacturing initiative that ensures that advanced biotechnology invented in the us is also manufactured in the usp
|
ppresident biden monday pitched quotcancer moonshotquot initiative bipartisan pursuit bring americans comparing president kennedys famous moonshot initiativep pcancer discriminate red blue doesnt care youre republican democrat beating cancer thats im today biden said thejohn f kennedypresidential library museum bostonp phis speech delivered 60th anniversary kennedys moonshot speech rice university houston outlined plan international leader space explorationp punwilling postpone president kennedy set goal win space race russia advance science technology humanity saidp ptogether choose forward unity hope optimism believe usher unwillingness postpone national purpose serve organize measure best energies skills end cancer know cure cancers addedp pbiden called initiative bold ambitious completely doablep pthe initiative relaunched february aims cut cancer death rate half 25 years improve lives caregivers cancer survivorsp pbidena hrefhttpsthehillcomhomenewsadministration3638371bidentosignexecutiveorderaspartofupdateoncancermoonshotannounced mondayathe appointment renee wegrzyn inaugural director advanced research projects agency health agency created march focused developing biomedical technologies improve health outcomesp padditionally signed executive order launching national biotechnology biomanufacturing initiative ensures advanced biotechnology invented manufactured usp
|
631fb38d1f586e0647ddc30b
|
Know Your Enemy: On Barbara Ehrenreich, with Alex Press and Gabriel Winant
|
pa hrefimg srchttpswwwdissentmagazineorgwpcontentfiles_mf1663011959666_6328602845_f95009b76d_ocopy2jpegappbarbara ehrenreich was an essential guide to the inner life of american class conflictp
|
pa hrefimg srchttpswwwdissentmagazineorgwpcontentfiles_mf1663011959666_6328602845_f95009b76d_ocopy2jpegappbarbara ehrenreich essential guide inner life american class conflictp
|
631fb3a91f586e0647ddc30f
|
The Federal Trade Commission vs. the Internet
|
div
picture
source sizesminwidth 600px 331px 100vw typeimagewebp srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202209ftcinternet1jpgwebp 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202209ftcinternet11200x675jpgwebp 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202209ftcinternet1800x450jpgwebp 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202209ftcinternet1600x338jpgwebp 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202209ftcinternet1331x186jpgwebp 331w
source sizesminwidth 600px 331px 100vw typeimagejpeg srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202209ftcinternet1jpg 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202209ftcinternet11200x675jpg 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202209ftcinternet1800x450jpg 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202209ftcinternet1600x338jpg 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202209ftcinternet1331x186jpg 331w
img width1200 altlina khan speaking at a hearing with an added illustration bearing the words quotftc vs the internetquot srchttpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202209ftcinternet1800x450jpg height675
picture
div
pspanthe federal trade commission ftc spana hrefhttpswwwftcgovnewseventsevents202209commercialsurveillancedatasecurityanprpublicforumspanhostedspanaspan a public forum last week to target quotcommercial surveillance and lax cybersecurityquot while data privacy is a legitimate spana hrefhttpsnetchoiceorgnewnationalpollamericansblamebidenforrisingpricesandworrybidenbackedantitrustproposalswillworseninflationspanconcernspanaspan ftc chief lina khan and her allies are vilifying legitimate business practices and increasingly overstepping their congressionally granted authorityspanp
pspanmany people are concerned about quotsurveillancequot by anyone no matter the intent but the data practices khans agency is thinking of regulating arent really surveillance at all spana hrefhttpswwwregulationsgovdocumentftc202200530001spanthe advance notice of proposed rulemakingspanaspan covers everything from the mere collection of data to specific questions about certain types of users unique risks which could eliminate many beneficial uses of data khan is conflating beneficial and risky data collection practices in an effort to kneecap successful business models she dislikes without thinking about the impact on consumersspanp
pspanin short this is yet another spana hrefhttpswwwfoxbusinesscompoliticsftcprogressivepolicieskneecappingeconomyspanexamplespanaspan of spana hrefhttpswwwfoxnewscompoliticswalmartfiresbackftccallinglawsuitegregiousinstanceagencyoverreachspanftc overreachspanaspanspanp
pspangone are the days of onesizefitsall advertisements and experiences consumers today want a far more personalized experience we enjoy it when online clothing retailers offer us coupons if we leave things in our carts and when news aggregators recommend articles based on what we enjoyed reading in the past such benefits are possible because of data and because of tools like cookiesspanp
pspanconsumers now have a wide range of choices for how their data is used and an increasing number of sites spana hrefhttpswwwengadgetcom20200128facebookpromptsprivacycheckuphtmlspanencourage us to customize our privacy settingsspanaspan users can select different settings based on how much they trust a specific service if they want a more personalized experience they can have it or they can opt out for more privacy in many cases consumers make choices based on the sensitivity of their activity and information for example most of us would expect a payment site to have more security and privacy features than a local news sitespanp
pspanby overriding such choices the ftc risks taking away features that improve the consumer experience it would also misallocate the agencys existing resources away from those bad actors that are truly harming consumers the ftc has successfully reached sizable agreements around cases involving harm from deceptive privacy practices and lax cybersecurity such as the spana hrefhttpswwwreuterscomarticleusashleymadisoncybersettlementashleymadisonownertopay166milliontosettleftccaseiduskbn14325xspanashley madison casespanaspan in which the ftc reached a multimillion dollar settlement over the affairpromotion companys lax data security practices and consumer deception this and spana hrefhttpswwwftcgovsystemfilesdocumentsreportsftcreportcongressprivacysecurityreport_to_congress_on_privacy_and_data_security_2021pdfspanmany other casesspanaspan the agency has brought show that the ftc already has the authority and resources to go after malicious actorsspanp
pspaninstead the ftc wants yet more powers and it wants to take them without a grant of congressional authority americans should be far more afraid of what an overzealous ftc might do to the internet than of the benign voluntary data practices the agency wants to regulatespanp
pthe post a relnofollow hrefhttpsreasoncom20220912thefederaltradecommissionvstheinternetthe federal trade commission vs the interneta appeared first on a relnofollow hrefhttpsreasoncomreasoncomap
|
div picture source sizesminwidth 600px 331px 100vw typeimagewebp srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202209ftcinternet1jpgwebp 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202209ftcinternet11200x675jpgwebp 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202209ftcinternet1800x450jpgwebp 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202209ftcinternet1600x338jpgwebp 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202209ftcinternet1331x186jpgwebp 331w source sizesminwidth 600px 331px 100vw typeimagejpeg srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202209ftcinternet1jpg 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202209ftcinternet11200x675jpg 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202209ftcinternet1800x450jpg 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202209ftcinternet1600x338jpg 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202209ftcinternet1331x186jpg 331w img width1200 altlina khan speaking hearing added illustration bearing words quotftc vs internetquot srchttpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202209ftcinternet1800x450jpg height675 picture div pspanthe federal trade commission ftc spana hrefhttpswwwftcgovnewseventsevents202209commercialsurveillancedatasecurityanprpublicforumspanhostedspanaspan public forum week target quotcommercial surveillance lax cybersecurityquot data privacy legitimate spana hrefhttpsnetchoiceorgnewnationalpollamericansblamebidenforrisingpricesandworrybidenbackedantitrustproposalswillworseninflationspanconcernspanaspan ftc chief lina khan allies vilifying legitimate business practices increasingly overstepping congressionally granted authorityspanp pspanmany people concerned quotsurveillancequot matter intent data practices khans agency thinking regulating arent surveillance spana hrefhttpswwwregulationsgovdocumentftc202200530001spanthe advance notice proposed rulemakingspanaspan covers mere collection data specific questions certain types users unique risks eliminate beneficial uses data khan conflating beneficial risky data collection practices effort kneecap successful business models dislikes thinking impact consumersspanp pspanin short spana hrefhttpswwwfoxbusinesscompoliticsftcprogressivepolicieskneecappingeconomyspanexamplespanaspan spana hrefhttpswwwfoxnewscompoliticswalmartfiresbackftccallinglawsuitegregiousinstanceagencyoverreachspanftc overreachspanaspanspanp pspangone days onesizefitsall advertisements experiences consumers today want far personalized experience enjoy online clothing retailers offer coupons leave things carts news aggregators recommend articles based enjoyed reading past benefits possible data tools like cookiesspanp pspanconsumers wide range choices data increasing number sites spana hrefhttpswwwengadgetcom20200128facebookpromptsprivacycheckuphtmlspanencourage customize privacy settingsspanaspan users select different settings based trust specific service want personalized experience opt privacy cases consumers choices based sensitivity activity information example expect payment site security privacy features local news sitespanp pspanby overriding choices ftc risks taking away features improve consumer experience misallocate agencys existing resources away bad actors truly harming consumers ftc successfully reached sizable agreements cases involving harm deceptive privacy practices lax cybersecurity spana hrefhttpswwwreuterscomarticleusashleymadisoncybersettlementashleymadisonownertopay166milliontosettleftccaseiduskbn14325xspanashley madison casespanaspan ftc reached multimillion dollar settlement affairpromotion companys lax data security practices consumer deception spana hrefhttpswwwftcgovsystemfilesdocumentsreportsftcreportcongressprivacysecurityreport_to_congress_on_privacy_and_data_security_2021pdfspanmany casesspanaspan agency brought ftc authority resources malicious actorsspanp pspaninstead ftc wants powers wants grant congressional authority americans far afraid overzealous ftc internet benign voluntary data practices agency wants regulatespanp pthe post relnofollow hrefhttpsreasoncom20220912thefederaltradecommissionvstheinternetthe federal trade commission vs interneta appeared relnofollow hrefhttpsreasoncomreasoncomap
|
631fb3d31f586e0647ddc315
|
Sri Lanka’s Left Turn
|
this years protests have revitalized the countrys socialists but can they capitalize on that momentum electorally
|
years protests revitalized countrys socialists capitalize momentum electorally
|
631fb3d91f586e0647ddc317
|
Marco Rubio Wants To Make Your Groceries More Expensive
|
div
picture
source sizesminwidth 600px 331px 100vw typeimagewebp srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads20220911jpgwebp 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202209111200x675jpgwebp 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads20220911800x450jpgwebp 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads20220911600x338jpgwebp 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads20220911331x186jpgwebp 331w
source sizesminwidth 600px 331px 100vw typeimagejpeg srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads20220911jpg 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202209111200x675jpg 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads20220911800x450jpg 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads20220911600x338jpg 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads20220911331x186jpg 331w
img width1200 altmarco rubio cucumbers tariffs strawberries florida mexico agriculture subsidies us trade representative section 301 srchttpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads20220911800x450jpg height675
picture
div
pa trip to the grocery store costs considerably more than it did a year ago now floridas congressional delegation wants to inflate prices even morep
pon friday sen marco rubio rfla led a bipartisan group of lawmakersall of them from floridain a hrefhttpswwwrubiosenategovpublicindexcfmpressreleasesid8065d2a0aabe468a824824fffed21f0dsubmitting a petitiona to us trade representative katherine tai seeking quotan investigationquot into what the lawmakers call quotthe flood of imported seasonal and perishable agricultural products from mexicoquot they ask tai to invoke section 301 of the trade act of 1974 to impose quottrade remediesquot that will protect american growers from the scourge oflowpriced producep
pwhile they dont come out and say it directly its obvious from the letter that rubio and his colleagues are seeking tariffs on mexican produce a hrefhttpscrsreportscongressgovproductpdflsblsb10553section 301a is the same mechanism the trump administration used to impose wideranging tariffs on goods imported from china its a law that grants the executive branch broad unilateral power over tradep
prubio and the other lawmakers say the mexican government is subsidizing its domestic agricultural infrastructure as part of a scheme to undercut the prices charged by us growers quotmexico poses a direct threat to floridas seasonal and perishable agricultural industryquot they concludep
pthe a hrefhttpswwwrubiosenategovpublic_cachefilesf609f7ff293f430eb11939ebff66089e6dfbb16ee78504657512817390490a9dbipartisanfloridacongressionaldelegationsection301petitiontoustrfinal3pdfpetitiona goes into more detail a case of mexicangrown bell peppers for example sells for about 585 less than a case of bell peppers grown in florida a flat of strawberries from mexico goes for a few bucks less than the equivalent amount of strawberries picked in floridap
pand dont forget the cucumbers the petition claims that a flat of mexicangrown cucumbers sells for a whole quot132 less than the average price of a flat of floridaproduced cucumbersquot whats more quotprices for mexican cucumbers are their lowest in the months of april and may which are the peak months for the marketing of floridagrown cucumbersquotp
panyone who has taken a basic economics class should be able to explain whats happening there a high level of supply tends to push prices downward whether grown in mexico or florida it makes sense that cucumber prices would be at their lowest when there are a lot of cucumbers in the marketp
pbut thats not how rubio and his colleagues see it instead the petition describes this minor pricing difference as quota clear attempt to displace florida cucumbers from the us marketquotp
ptake a moment to enjoy the fact that some of the most powerful men and women in the us government are freaking out over the idea that american consumers might get to save a few cents on their next cucumber purchase then amuse yourself with the optics of american agricultural special interestswhich are of course pulling rubios strings herecomplaining about subsidies as if quotdirect government aidquot doesnt account for a hrefhttpswwwcatoorgcommentaryexaminingamericasfarmsubsidyproblemnearly 40 percent of american farmers annual incomeap
pquotthese florida politicians are following a timehonored tradition of trying to help their local constituents at the expense of americans in other states who benefit from lowpriced fruits and vegetables regardless of where they are grownquot says bryan riley director of the free trade initiative at the national taxpayers union foundation any discussion of how government subsidies are distorting the agricultural markets on both sides of the usmexico border should take into account the protectionist barriers to imported sugar he notesp
pindeed the american sugar industry has for decades enjoyed the kind of protectionism that rubio and his colleagues would like to see extended to cucumbers and other produce the results arent great consumers pay a hrefhttpswwwaeiorgresearchproductsreportanalysisoftheussugarprogrambillions morea annually the environment a hrefhttpsreasonorgcommentarypublicprivatepartnershipsandendingsugarsubsidiescouldhelprestorefloridasevergladesgets wreckeda and americans end up eating a hrefhttpshealthclevelandclinicorgavoidthehiddendangersofhighfructosecornsyrupvideoless healthy sugar alternativesap
pbut the craziest thing about rubios proposal is the timing food prices are up a hrefhttpswwwblsgovnewsreleasecpinr0htm109 percenta over the 12 months ending in july that means theyve risen even faster than overall inflation which is up 85 percent over the same period augusts inflation data will be released tuesday morningp
pthe whole point of specialinterest protectionism is that the costs are diffused while the benefits are highly concentrated all americans pay for the federal governments dumb sugar policies but we barely notice the added cost while the sugarproducing industry reaps billions of dollars in benefits every yearp
peven so openly calling for higher prices at the grocery storeand that is exactly what these lawmakers are doingat a time like this are you seriousp
pit shouldnt matter whether a cucumber is grown in florida or mexico and at a time when american consumers are beset by high and rising prices it makes sense to welcome the import of cheaper goods that can put food on the table and put downward pressure on inflation rubios petition should go directly to the compost heapp
piframe allowfullscreen srchttpswwwyoutubecomembedrw7purgu3n0featureoembed width500 titleremy banana free trade camila cabello havana parody height281iframep
pthe post a relnofollow hrefhttpsreasoncom20220912marcorubiowantstomakeyourgroceriesmoreexpensivemarco rubio wants to make your groceries more expensivea appeared first on a relnofollow hrefhttpsreasoncomreasoncomap
|
div picture source sizesminwidth 600px 331px 100vw typeimagewebp srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads20220911jpgwebp 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202209111200x675jpgwebp 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads20220911800x450jpgwebp 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads20220911600x338jpgwebp 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads20220911331x186jpgwebp 331w source sizesminwidth 600px 331px 100vw typeimagejpeg srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads20220911jpg 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202209111200x675jpg 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads20220911800x450jpg 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads20220911600x338jpg 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads20220911331x186jpg 331w img width1200 altmarco rubio cucumbers tariffs strawberries florida mexico agriculture subsidies trade representative section 301 srchttpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads20220911800x450jpg height675 picture div pa trip grocery store costs considerably year ago floridas congressional delegation wants inflate prices morep pon friday sen marco rubio rfla led bipartisan group lawmakersall floridain hrefhttpswwwrubiosenategovpublicindexcfmpressreleasesid8065d2a0aabe468a824824fffed21f0dsubmitting petitiona trade representative katherine tai seeking quotan investigationquot lawmakers quotthe flood imported seasonal perishable agricultural products mexicoquot ask tai invoke section 301 trade act 1974 impose quottrade remediesquot protect american growers scourge oflowpriced producep pwhile dont come directly obvious letter rubio colleagues seeking tariffs mexican produce hrefhttpscrsreportscongressgovproductpdflsblsb10553section 301a mechanism trump administration impose wideranging tariffs goods imported china law grants executive branch broad unilateral power tradep prubio lawmakers mexican government subsidizing domestic agricultural infrastructure scheme undercut prices charged growers quotmexico poses direct threat floridas seasonal perishable agricultural industryquot concludep pthe hrefhttpswwwrubiosenategovpublic_cachefilesf609f7ff293f430eb11939ebff66089e6dfbb16ee78504657512817390490a9dbipartisanfloridacongressionaldelegationsection301petitiontoustrfinal3pdfpetitiona goes detail case mexicangrown bell peppers example sells 585 case bell peppers grown florida flat strawberries mexico goes bucks equivalent strawberries picked floridap pand dont forget cucumbers petition claims flat mexicangrown cucumbers sells quot132 average price flat floridaproduced cucumbersquotwhats quotprices mexican cucumbers lowest months april peak months marketing floridagrown cucumbersquotp panyone taken basic economics class able explain whats happening high level supply tends push prices downward grown mexico florida makes sense cucumber prices lowest lot cucumbers marketp pbut thats rubio colleagues instead petition describes minor pricing difference quota clear attempt displace florida cucumbers marketquotp ptake moment enjoy fact powerful men women government freaking idea american consumers save cents cucumber purchase amuse optics american agricultural special interestswhich course pulling rubios strings herecomplaining subsidies quotdirect government aidquot doesnt account hrefhttpswwwcatoorgcommentaryexaminingamericasfarmsubsidyproblemnearly 40 percent american farmers annual incomeap pquotthese florida politicians following timehonored tradition trying help local constituents expense americans states benefit lowpriced fruits vegetables regardless grownquot says bryan riley director free trade initiative national taxpayers union foundation discussion government subsidies distorting agricultural markets sides usmexico border account protectionist barriers imported sugar notesp pindeed american sugar industry decades enjoyed kind protectionism rubio colleagues like extended cucumbers produce results arent great consumers pay hrefhttpswwwaeiorgresearchproductsreportanalysisoftheussugarprogrambillions morea annually environment hrefhttpsreasonorgcommentarypublicprivatepartnershipsandendingsugarsubsidiescouldhelprestorefloridasevergladesgets wreckeda americans end eating hrefhttpshealthclevelandclinicorgavoidthehiddendangersofhighfructosecornsyrupvideoless healthy sugar alternativesap pbut craziest thing rubios proposal timing food prices hrefhttpswwwblsgovnewsreleasecpinr0htm109 percenta 12 months ending july means theyve risen faster overall inflation 85 percent period augusts inflation data released tuesday morningp pthe point specialinterest protectionism costs diffused benefits highly concentrated americans pay federal governments dumb sugar policies barely notice added cost sugarproducing industry reaps billions dollars benefits yearp peven openly calling higher prices grocery storeand exactly lawmakers doingat time like seriousp pit shouldnt matter cucumber grown florida mexico time american consumers beset high rising prices makes sense welcome import cheaper goods food table downward pressure inflation rubios petition directly compost heapp piframe allowfullscreen srchttpswwwyoutubecomembedrw7purgu3n0featureoembed width500 titleremy banana free trade camila cabello havana parody height281iframep pthe post relnofollow hrefhttpsreasoncom20220912marcorubiowantstomakeyourgroceriesmoreexpensivemarco rubio wants groceries expensivea appeared relnofollow hrefhttpsreasoncomreasoncomap
|
631fb43d1f586e0647ddc322
|
Who will be attending the Queen’s funeral?
|
plondon will be very busy in the coming days more than a relnoreferrer noopener nofollow hrefhttpswwwthetimescoukarticlefivemilequeueexpectedwhenqueenliesinstate3d3cdr7mk target_blankthree quarters of a million peoplea are expected to file past the queen lyinginstate in the palace of westminster then theres the funeral royalty presidents current and former prime ministers diplomats and dignitaries are poised to descend on london for the ceremony on monday 19 september at westminster abbey which can hold around 2000 people so whos comingp
pthere was uncertainty over whether the us president a relnoreferrer noopener hrefhttpswwwnewstatesmancomtagjoebiden target_blankjoe bidena would attend the funeral he hasnt come on a state visit to the uk since he entered office but when asked by reporters last friday 9 september he replied yes i dont know what the details are yet but i will be going it seems unlikely that donald trump will receive an invitation not least because of the limited space within the abbeyp
ppresident recep tayyip erdoan of turkey has said that he wants to come the canadian prime minister justin trudeau has also confirmed he will attend the uks political leaders such as the prime minister and the leader of the opposition keir starmer will be there former prime ministers boris johnson theresa may david cameron gordon brown tony blair and john major are also likely to be invitedp
palongside the politicians royalty from around the world are also expected to attend the guest list for prince philips memorial service in april 2021 provides some idea of who might receive an invitation around 1800 people attended the service including prince albert of monaco denmarks queen margrethe king willemalexander and queen mxima of the netherlands and spains king felipe vi and queen letiziap
pemperor naruhito of japan who ascended the chrysanthemum throne back in 2019 has plans to travel to london for the funeral in what would be his first overseas trip since becoming emperor it seems unlikely that the chinese and russian presidents xi jinping and vladimir putin will attend the royal family will also be in attendance of course including the new prince and princess of wales william and catherine unlike for prince philips memorial harry and meghan are in the uk and expected to attendp
pa relnoreferrer noopener hrefhttpswwwnewstatesmancomtagkingcharles target_blankthe kinga is due to host a reception at buckingham palace the night before world leaders have been asked to limit the use of their own cars private jets and helicopters on the way to the event a relnoreferrer noopener nofollow hrefhttpswwwpoliticoeuarticlequeenelizabethjoebidenkingcharleswestminsterabbeyonlyheadsofstateplusonetoattendqueenelizabethsfuneral target_blankaccording to empoliticoema the attendees will instead be bussed to westminster abbey from a location in west london after the funeral overseas leaders will be escorted to deans yard within the grounds of the abbey for a reception hosted by the foreign secretary james cleverlyp
pstrongem[see also a relnoreferrer noopener hrefhttpswwwnewstatesmancomcomment202209surrealgriefregurgitatedmawkishtiktokfeed target_blankthis is a surreal form of grief circling like a mawkish tiktok feeda]emstrongp
|
plondon busy coming days relnoreferrer noopener nofollow hrefhttpswwwthetimescoukarticlefivemilequeueexpectedwhenqueenliesinstate3d3cdr7mk target_blankthree quarters million peoplea expected file past queen lyinginstate palace westminster theres funeral royalty presidents current prime ministers diplomats dignitaries poised descend london ceremony monday 19 september westminster abbey hold 2000 people whos comingp pthere uncertainty president relnoreferrer noopener hrefhttpswwwnewstatesmancomtagjoebiden target_blankjoe bidena attend funeral hasnt come state visit uk entered office asked reporters friday 9 september hereplied yes dont know details going unlikely donald trump receive invitation limited space abbeyp ppresident recep tayyip erdoan turkey said wants come canadian prime minister justin trudeau alsoconfirmedhe attend uks political leaders prime minister leader opposition keir starmer thereformer prime ministers boris johnson theresa david cameron gordon brown tony blair john major likely invitedp palongside politicians royalty world expected attend guest list prince philips memorial service april 2021 provides idea receive invitation 1800 people attended service including prince albert monaco denmarks queen margrethe king willemalexander queen mxima netherlands spains king felipe vi queen letiziap pemperor naruhito japan ascended chrysanthemum throne 2019 plans travel london funeral overseas trip emperor unlikely chinese russian presidents xi jinping vladimir putin attend royal family attendance course including new prince princess wales william catherine unlike prince philips memorial harry meghan uk expected attendp pa relnoreferrer noopener hrefhttpswwwnewstatesmancomtagkingcharles target_blankthe kinga host reception buckingham palace night world leaders asked limit use cars private jets helicopters way event relnoreferrer noopener nofollow hrefhttpswwwpoliticoeuarticlequeenelizabethjoebidenkingcharleswestminsterabbeyonlyheadsofstateplusonetoattendqueenelizabethsfuneral target_blankaccording empoliticoema attendees instead bussed westminster abbey location west london funeral overseas leaders escorted deans yard grounds abbey reception hosted foreign secretary james cleverlyp pstrongem[see relnoreferrer noopener hrefhttpswwwnewstatesmancomcomment202209surrealgriefregurgitatedmawkishtiktokfeed target_blankthis surreal form grief circling like mawkish tiktok feeda]emstrongp
|
63229c56db1c50ad52b2844b
|
Captiongate: How a Single Zoom Call Propelled Canada’s Greens Into Pronoun Meltdown
|
img altcaptiongate how a single zoom call propelled canadas greens into pronoun meltdown srchttpss3amazonawscomprodstaticcontentquillettecom202209untitledjpgpgreen parties have become a significant political force in many western nations and subnational jurisdictions while greenbranded platforms vary from one part of the world to the next they all a hrefhttpswwwcfrorgbackgrounderhowgreenpartysuccessreshapingglobalpoliticstypicallya draw in heterodox leftofcentre political figures who trumpet ecological sustainability grassroots democracy and social justice through nonviolent means in some nations such as finland germany ireland and austria greens have gained cabinet representation and membership in ruling coalitions in latvia green politicians have even served as prime minister and head of stateppone might think that canada a country whose progressive ranks have long exhibited strong environmentalist tendencies would feature prominently in the green movement but thats not the case in large part because canadas firstpastthepost electoral system makes it difficult for small parties to gain parliamentary representation unless they focus their appeal along narrow regional lines as the bloc qubcois has done in frenchspeaking quebec since the early 1990s out of 338 members of parliament canadas greens have never had more than three mps they currently have two and for reasons described below that number may soon be zeroppanother problem for the greens has been leadership from 2006 to 2019 the a hrefhttpswwwgreenpartycaengreen party of canadaa was led by a former environmental lawyer and sierra club canada director named elizabeth mayan affable but occasionally bumbling figure whos made a number of frontpage gaffes in 2011 she promoted pseudoscientific theories to the effect that a hrefhttpswwwgreenpartycaenblogs4620110728twitterfirestormandwhyisaidwhatisaidaboutwifiwifi internet signalsa might give people cancer and kill pollinating insects the party has been home to a hrefhttpsnationalpostcomnewspoliticselizabethmayssocalledpartyofscienceseemstosupportalotofunscientificpublicpoliciesantifluoridation activistsa as well as proponents of crackpot russian theories about abiogenic oil a 2013 draft version of the partys platform called for governmentsubsidized a hrefhttpsnationalpostcomnewspoliticselizabethmayssocalledpartyofscienceseemstosupportalotofunscientificpublicpolicieshomeopathya two years after that an apparently drunken may stood up at ottawas annual press gallery dinner and delivered a bizarre homage to a returning guantanamo prisoner named omar khadr whom she said had more class than the national governments whole fucking cabinet in the 2019 federal election may played to range rover environmentalists with sanctimonious boasts about how she always used a reusable coffee cup metal straw and my own bamboo utensils as a means to avoid using disposable productsbut then a hrefhttpsnationalpostcomnewspoliticselection2019elizabethmaywasholdingdisposablecupinphotoshoppedimagecontrarytopartysclaimsblameda her staff when it was discovered that a photo of her holding a singleuse cup had been edited to make it look as if she were holding the reusable varietypfigureiframe allowfullscreen srchttpswwwyoutubecomembedupoe59sinhefeatureoembed width200 titleelizabeth may press gallery speech warning graphic language height113iframefigurepmany grumbled that may was too slow to give up her leadership perch yet when she finally did step aside in 2019 the party learned that shed been the only thing holding the outfit together by the time the 2021 federal election rolled around the greens leader was a black jewish woman named annamie paul who got absolutely a hrefhttpsglobalnewscanews8206010greenpartyleaderannamiepaullosesbidtorontocentretrounceda in her own riding winning fewer than 4000 votes paul was then quickly a hrefhttpsglobalnewscanews8223508greenpartyleaderannamiepaulresignsrun out of the party leadershipa during a complicated and often farcical internecine battle that involved public accusations of bigotry hurled in all directions and which predictably repelled many of the partys financial supporters pfigureblockquote classtwittertweetp langen dirltron sept 27 i began the process of stepping down as green party of canada leader today i sent formal notice of my resignation to the gpc i will also be ending my membership in the gpc brit was an honour to work for the people of canada and i look forward to serving in new waysp annamie paul annamiepaul a hrefhttpstwittercomannamiepaulstatus1458486283773296643ref_srctwsrc5etfwnovember 10 2021ablockquote
figurepone might think things couldnt get any worse for the greens but thanks to the installation of a 30yearold interim leader named amita kuttner they very much didppkuttner selfdescribes as nonbinary transgender and pansexual when asked what are your preferred pronouns in a 2019 interview the onetime astrophysicist replied theythem but then a hrefhttpsthetyeecanews20190826amitakuttnergreencandidateelaborateda as follows pblockquotewhen i write my pronouns i sometimes write all of them theythem sheher hehim because i dont care there will be days where im not always even aware of what my gender is and i will notice it based on how someone addresses me and whether i respond i was in choir for many years and theyd say women sing now men sing now and i would find myself starting with one or the other group even though i was obviously supposed to sing soprano id be like oh i guess im feeling that todayblockquotepand yet despite the fact kuttner apparently cant always figure out what my gender is and claims not to care in any case the interim leader felt the need to issue a lengthy a hrefhttpsamitakuttnercom20220906statementonensuringthegreenpartyofcanadaiswelcomingtoeveryonestatementa on september 6th detailing the allegedly devastating emotional effects that ensued when the pronoun descriptor sheelle a hrefhttpsnationalpostcomnewspoliticsmisgenderingincidentplungesgreenpartyintorenewedturmoilappeareda in the electronic caption that sat alongside kuttners name during a green party of canada zoom call instead of the kuttnerapproved theyheille indeed kuttner described the ordeal as evidence that the greens were infected by a system of oppressionpblockquotewhat happened here impacted me much more than a slip of the tongue it made me feel hurt and isolated at a moment that should have been filled with inspiration and anticipation this incident is reflective of a larger pattern of behaviours that a few in the party are perpetuating over the years the party has documented reports which indicate a systemic issue disproportionately affecting black indigenous and racialized people and 2slgbtqia people and i hope many more stories will be able to be shared so that this incident can be a catalyst for change when things like this happen people need to see those in leadership positions take some accountability acknowledge how they have added to this system of oppression and what they must do to break the cycleblockquotepkuttners attempt to weaponize this apparently very oppressive instance of miscaptioning forms part of an ongoing civil war thats been playing out for weeks within the green leadership that battle goes to the question of whether the party should proceed with its ongoing party leadership race or pause it so that green functionaries can investigate all of the vaguely expressed accusations of antisemitism racism and transphobia that were flung in every direction during the tumultuous last days of the annamie paul era back in 2021 pfigureblockquote classtwittertweetp langen dirltrwe invite canadians to get to know the gpcs 6 2022 leadership candidates a hrefhttpstcoidjfvbet5ehttpstcoidjfvbet5ea a hrefhttpstcoo21clko4lfpictwittercomo21clko4lfap green party of canada canadiangreens a hrefhttpstwittercomcanadiangreensstatus1566156097811013640ref_srctwsrc5etfwseptember 3 2022ablockquote
figurepon one side of this battle are the partys a hrefhttpsleadershipgreencaprocessesleadershipleadership contestantsa along with interim leader kuttner whove urged that the leadership race go ahead as planned on the other side are members of the partys federal council whove urged that the race be paused on september 9th krystal brooks the ontario representative on council resigned her office though shes since a hrefhttpstwittercomkrystalkwe123status1569435812256776193s20t43ilipkwh4atkr9wpgvi4achanged her minda apparently authoring a a hrefhttpswwwfacebookcom100046120670948postspfbid0iyqa3waateh7npaqumq8izfhvu2sfpaedd5emzkfyytuoosu5vxiekm4z6m4vhjjlemjaccuseemstyle manifestoa in which she alleged that council members had been inappropriately a hrefhttpswwwcbccanewspoliticsgreenmpsthreatnedtoleaveparty16579691pressureda to vote in favour of keeping to the current schedule most explosively brooks alleged that the green partys only two mps had a hrefhttpstwittercomerewhon4everstatus1569139654431248384s20tvzxcnmd1xiu0v81mndubhwthreateneda to abandon the party and sit as parliamentary independents if they didnt get their way making this even more explosive is the fact that one of these two mps is none other than elizabeth may herself whoin another weird onlyingreenland plot twistnow says she wants to lead the party againppmay also put her name to a dramatically worded group a hrefhttpstwittercomerewhon4everstatus1568468768426434563s20t7mf2hiigc4qne2ae3o48wstatementa expressing solidarity for kuttner and declaring somewhat ominously that captiongate was but the latest in a number of similar behavioural patterns altogether four of the six green party of canada leadership contestants signed that letter including jonathan pedneault a selfdescribed queer person of colour seeking to become mays coleader he solemnly a hrefhttpstwittercomj_pedneaultstatus1567272022480244736s20t7mf2hiigc4qne2ae3o48wdenounceda the incident as a symptom of ignorance and hateand just to remind everyone we are talking here about an incorrect emzoom captionemwhile promising to prioritize a safe and inclusive space for allpfigureblockquote classtwittertweetp langen dirltri stand in solidarity with a hrefhttpstwittercomamitakuttnerref_srctwsrc5etfwamitakuttnera and those affected by ignorance and hate brbras a queer person of colour i understand and have experienced impact verses intention and we must do better brbras coleader i will prioritize a safe and inclusive space for all a hrefhttpstwittercomhashtaggpcsrchashref_srctwsrc5etfwgpca a hrefhttpstcoewjrkqcwhhpictwittercomewjrkqcwhhap jonathan pedneault j_pedneault a hrefhttpstwittercomj_pedneaultstatus1567272022480244736ref_srctwsrc5etfwseptember 6 2022ablockquote
figurepanother party official who resigned this resignation hasnt been rescinded yet is green party president lorraine rekmans compared to brooks rekmans was more precise with her a hrefhttpss3documentcloudorgdocuments22279081resignationrekmans2022pdfcritiquea scathingly a hrefhttpswwwcbccanewspoliticsgreenpartypresidentquitstellsmembersthedreamisdead16579335describinga the greens back office as being under siege by kuttner and the partys leadership contestants speaking with the cbc rekmans explicitly accused this group of using captiongate to a hrefhttpswwwcbccanewspoliticsgreenpartypresidentquitstellsmembersthedreamisdead16579335demeana rekmans and force her out of the party ppits notable that rekmans was the partys a hrefhttpswwwcbccanewspoliticsgreenpartypresidentquitstellsmembersthedreamisdead16579335first indigenous presidenta brooks too is a hrefhttpswwwgreenpartycaencontentfederalcouncilontariokrystalbrooksindigenousa and in a country whose progressive class still describes reconciliation with indigenous peoples as its most morally urgent objective that should count for something but kuttner has instead put pronouns on top of the green agenda and in this astrophysicists claims of captioninduced trauma the leadershipcontestant faction seems to have found a single cosmic trump card that in this surreal green game of intersectional poker bests even a pair of indigenous femalespfigureblockquote classtwittertweetp langzxx dirltra hrefhttpstcom051rn6odlhttpstcom051rn6odlap lorraine rekmans goddessonloose a hrefhttpstwittercomgoddessonloosestatus1569140452439347200ref_srctwsrc5etfwseptember 12 2022ablockquote
figurepthose whove followed the general pattern by which pronoun politics tear progressive organizations apart will note that something similar has been happening a hrefhttpswwwthenationalscotnews20291417scottishgreensmaysplitukpartytransphobiarowin the uka and just two years ago the leader of an even smaller canadian greenstyle party british columbias ecosocialists was forced to a hrefhttpsthepostmillennialcomtransrightsactivistforcesresignationofbcpartyleaderresigna when it was discovered that hed properly defended jk rowling from claims of transphobia emquillette emreaders may recognize a hrefhttpsquillettecom20220202smearingawholeprotestmovementasfascisticwillcomebacktohauntthegrassrootscanadianlefthis namea in that case too the entire furor was largely sparked by a single gender activista trans woman named nicola spurling best known for once a hrefhttpswwwwellandtribunecatsnewscanada20200529harrypotterauthorjkrowlingclasheswithbctransgenderactivistonlineraisesprospectoflegalactionhtmlclaiminga that rowling couldnt be trusted around children a claim that spurling backed away from once rowling threatened legal actionppis this kind of dogmatic attachment to avantgarde gender dogmas reflective of what rankandfile green or ecosocialist voters really wantor just a fixation of tiny activist cliques it so happens that theres a natural experiment that allows us to answer this very questionthanks to none other than amita kuttner pfigureimg srchttpss3amazonawscomprodstaticcontentquillettecom202209screenshot20220913at34104pmpng altcaptiongate how a single zoom call propelled canadas greens into pronoun meltdown width1302 height656figurepyou see after id a hrefhttpstwittercomjonkaystatus1567364728413978624tweeteda out some cheeky commentary about the greens pronoun fixation a few days back kuttner tried to seize on my tweets as a a hrefhttpstwittercomamitakuttnerstatus1567588805565386754s20t9oqg6lnfnyov6x_def7_mqfundraisinga opportunity the interim green leader christened the campaign emlets platform antioppressionem and sought to raise 68321 one dollar to counter each of jonathan kays followers on twitterppits a 12day fundraising campaign that started a week ago as of this writing kuttner has raised exactly 24983 and 10 of that is from mep
|
img altcaptiongate single zoom propelled canadas greens pronoun meltdown srchttpss3amazonawscomprodstaticcontentquillettecom202209untitledjpgpgreen parties significant political force western nations subnational jurisdictions greenbranded platforms vary world hrefhttpswwwcfrorgbackgrounderhowgreenpartysuccessreshapingglobalpoliticstypicallya draw heterodox leftofcentre political figures trumpet ecological sustainability grassroots democracy social justice nonviolent means nations finland germany ireland austria greens gained cabinet representation membership ruling coalitions latvia green politicians served prime minister head stateppone think canada country progressive ranks long exhibited strong environmentalist tendencies feature prominently green movement thats case large canadas firstpastthepost electoral system makes difficult small parties gain parliamentary representation focus appeal narrow regional lines bloc qubcois frenchspeaking quebec early 1990s 338 members parliament canadas greens mps currently reasons described number soon zeroppanother problem greens leadership 2006 2019 hrefhttpswwwgreenpartycaengreen party canadaa led environmental lawyer sierra club canada director named elizabeth mayan affable occasionally bumbling figure whos number frontpage gaffes 2011 promoted pseudoscientific theories effect hrefhttpswwwgreenpartycaenblogs4620110728twitterfirestormandwhyisaidwhatisaidaboutwifiwifi internet signalsa people cancer kill pollinating insects party home hrefhttpsnationalpostcomnewspoliticselizabethmayssocalledpartyofscienceseemstosupportalotofunscientificpublicpoliciesantifluoridation activistsa proponents crackpot russian theories abiogenic oil 2013 draft version partys platform called governmentsubsidized hrefhttpsnationalpostcomnewspoliticselizabethmayssocalledpartyofscienceseemstosupportalotofunscientificpublicpolicieshomeopathya years apparently drunken stood ottawas annual press gallery dinner delivered bizarre homage returning guantanamo prisoner named omar khadr said class national governments fucking cabinet 2019 federal election played range rover environmentalists sanctimonious boasts reusable coffee cup metal straw bamboo utensils means avoid disposable productsbut hrefhttpsnationalpostcomnewspoliticselection2019elizabethmaywasholdingdisposablecupinphotoshoppedimagecontrarytopartysclaimsblameda staff discovered photo holding singleuse cup edited look holding reusable varietypfigureiframe allowfullscreen srchttpswwwyoutubecomembedupoe59sinhefeatureoembed width200 titleelizabeth press gallery speech warning graphic language height113iframefigurepmany grumbled slow leadership perch finally step aside 2019 party learned shed thing holding outfit time 2021 federal election rolled greens leader black jewish woman named annamie paul got absolutely hrefhttpsglobalnewscanews8206010greenpartyleaderannamiepaullosesbidtorontocentretrounceda riding winning fewer 4000 votes paul quickly hrefhttpsglobalnewscanews8223508greenpartyleaderannamiepaulresignsrun party leadershipa complicated farcical internecine battle involved public accusations bigotry hurled directions predictably repelled partys financial supporters pfigureblockquote classtwittertweetp langen dirltron sept 27 began process stepping green party canada leader today sent formal notice resignation gpc ending membership gpc brit honour work people canada look forward serving new waysp annamie paul annamiepaul hrefhttpstwittercomannamiepaulstatus1458486283773296643ref_srctwsrc5etfwnovember 10 2021ablockquote figurepone think things couldnt worse greens thanks installation 30yearold interim leader named amita kuttner didppkuttner selfdescribes nonbinary transgender pansexual asked preferred pronouns 2019 interview onetime astrophysicist replied theythem hrefhttpsthetyeecanews20190826amitakuttnergreencandidateelaborateda follows pblockquotewhen write pronouns write theythem sheher hehim dont care days im aware gender notice based addresses respond choir years theyd women sing men sing find starting group obviously supposed sing soprano id like oh guess im feeling todayblockquotepand despite fact kuttner apparently cant figure gender claims care case interim leader felt need issue lengthy hrefhttpsamitakuttnercom20220906statementonensuringthegreenpartyofcanadaiswelcomingtoeveryonestatementa september 6th detailing allegedly devastating emotional effects ensued pronoun descriptor sheelle hrefhttpsnationalpostcomnewspoliticsmisgenderingincidentplungesgreenpartyintorenewedturmoilappeareda electronic caption sat alongside kuttners green party canada zoom instead kuttnerapproved theyheille kuttner described ordeal evidence greens infected system oppressionpblockquotewhat happened impacted slip tongue feel hurt isolated moment filled inspiration anticipation incident reflective larger pattern behaviours party perpetuating years party documented reports indicate systemic issue disproportionately affecting black indigenous racialized people 2slgbtqia people hope stories able shared incident catalyst change things like happen people need leadership positions accountability acknowledge added system oppression break cycleblockquotepkuttners attempt weaponize apparently oppressive instance miscaptioning forms ongoing civil war thats playing weeks green leadership battle goes question party proceed ongoing party leadership race pause green functionaries investigate vaguely expressed accusations antisemitism racism transphobia flung direction tumultuous days annamie paul era 2021 pfigureblockquote classtwittertweetp langen dirltrwe invite canadians know gpcs 6 2022 leadership candidates hrefhttpstcoidjfvbet5ehttpstcoidjfvbet5ea hrefhttpstcoo21clko4lfpictwittercomo21clko4lfap green party canada canadiangreens hrefhttpstwittercomcanadiangreensstatus1566156097811013640ref_srctwsrc5etfwseptember 3 2022ablockquote figurepon battle partys hrefhttpsleadershipgreencaprocessesleadershipleadership contestantsa interim leader kuttner whove urged leadership race ahead planned members partys federal council whove urged race paused september 9th krystal brooks ontario representative council resigned office shes hrefhttpstwittercomkrystalkwe123status1569435812256776193s20t43ilipkwh4atkr9wpgvi4achanged minda apparently authoring hrefhttpswwwfacebookcom100046120670948postspfbid0iyqa3waateh7npaqumq8izfhvu2sfpaedd5emzkfyytuoosu5vxiekm4z6m4vhjjlemjaccuseemstyle manifestoa alleged council members inappropriately hrefhttpswwwcbccanewspoliticsgreenmpsthreatnedtoleaveparty16579691pressureda vote favour keeping current schedule explosively brooks alleged green partys mps hrefhttpstwittercomerewhon4everstatus1569139654431248384s20tvzxcnmd1xiu0v81mndubhwthreateneda abandon party sit parliamentary independents didnt way making explosive fact mps elizabeth whoin weird onlyingreenland plot twistnow says wants lead party againppmay dramatically worded group hrefhttpstwittercomerewhon4everstatus1568468768426434563s20t7mf2hiigc4qne2ae3o48wstatementa expressing solidarity kuttner declaring somewhat ominously captiongate latest number similar behavioural patterns altogether green party canada leadership contestants signed letter including jonathan pedneault selfdescribed queer person colour seeking mays coleader solemnly hrefhttpstwittercomj_pedneaultstatus1567272022480244736s20t7mf2hiigc4qne2ae3o48wdenounceda incident symptom ignorance hateand remind talking incorrect emzoom captionemwhile promising prioritize safe inclusive space allpfigureblockquote classtwittertweetp langen dirltri stand solidarity hrefhttpstwittercomamitakuttnerref_srctwsrc5etfwamitakuttnera affected ignorance hate brbras queer person colour understand experienced impact verses intention better brbras coleader prioritize safe inclusive space hrefhttpstwittercomhashtaggpcsrchashref_srctwsrc5etfwgpca hrefhttpstcoewjrkqcwhhpictwittercomewjrkqcwhhap jonathan pedneault j_pedneault hrefhttpstwittercomj_pedneaultstatus1567272022480244736ref_srctwsrc5etfwseptember 6 2022ablockquote figurepanother party official resigned resignation hasnt rescinded green party president lorraine rekmans compared brooks rekmans precise hrefhttpss3documentcloudorgdocuments22279081resignationrekmans2022pdfcritiquea scathingly hrefhttpswwwcbccanewspoliticsgreenpartypresidentquitstellsmembersthedreamisdead16579335describinga greens office siege kuttner partys leadership contestants speaking cbc rekmans explicitly accused group captiongate hrefhttpswwwcbccanewspoliticsgreenpartypresidentquitstellsmembersthedreamisdead16579335demeana rekmans force party ppits notable rekmans partys hrefhttpswwwcbccanewspoliticsgreenpartypresidentquitstellsmembersthedreamisdead16579335first indigenous presidenta brooks hrefhttpswwwgreenpartycaencontentfederalcouncilontariokrystalbrooksindigenousa country progressive class describes reconciliation indigenous peoples morally urgent objective count kuttner instead pronouns green agenda astrophysicists claims captioninduced trauma leadershipcontestant faction found single cosmic trump card surreal green game intersectional poker bests pair indigenous femalespfigureblockquote classtwittertweetp langzxx dirltra hrefhttpstcom051rn6odlhttpstcom051rn6odlap lorraine rekmans goddessonloose hrefhttpstwittercomgoddessonloosestatus1569140452439347200ref_srctwsrc5etfwseptember 12 2022ablockquote figurepthose whove followed general pattern pronoun politics tear progressive organizations apart note similar happening hrefhttpswwwthenationalscotnews20291417scottishgreensmaysplitukpartytransphobiarowin uka years ago leader smaller canadian greenstyle party british columbias ecosocialists forced hrefhttpsthepostmillennialcomtransrightsactivistforcesresignationofbcpartyleaderresigna discovered hed properly defended jk rowling claims transphobia emquillette emreaders recognize hrefhttpsquillettecom20220202smearingawholeprotestmovementasfascisticwillcomebacktohauntthegrassrootscanadianlefthis namea case entire furor largely sparked single gender activista trans woman named nicola spurling best known hrefhttpswwwwellandtribunecatsnewscanada20200529harrypotterauthorjkrowlingclasheswithbctransgenderactivistonlineraisesprospectoflegalactionhtmlclaiminga rowling couldnt trusted children claim spurling backed away rowling threatened legal actionppis kind dogmatic attachment avantgarde gender dogmas reflective rankandfile green ecosocialist voters wantor fixation tiny activist cliques happens theres natural experiment allows answer questionthanks amita kuttner pfigureimg srchttpss3amazonawscomprodstaticcontentquillettecom202209screenshot20220913at34104pmpng altcaptiongate single zoom propelled canadas greens pronoun meltdown width1302 height656figurepyou id hrefhttpstwittercomjonkaystatus1567364728413978624tweeteda cheeky commentary greens pronoun fixation days kuttner tried seize tweets hrefhttpstwittercomamitakuttnerstatus1567588805565386754s20t9oqg6lnfnyov6x_def7_mqfundraisinga opportunity interim green leader christened campaign emlets platform antioppressionem sought raise 68321 dollar counter jonathan kays followers twitterppits 12day fundraising campaign started week ago writing kuttner raised exactly 24983 10 mep
|
63229c93db1c50ad52b28451
|
“Life Goes On” With Stewart Brand
|
pspanstewart brand was born in 1938 in 1964 he was hanging out with ken keseys merry pranksters at the center of the lsd counterculture described in tom wolfes electric koolaid acid test in 1966 he realized a satellite image of the earth could be a powerful symbol for holistic environmental thinking and launched a campaign to get such a photo released by nasa in 1968 he succeeded and the first satellite photo of the whole earth taken by the geostationary satellite ats3 appeared on the cover of stewarts famous counterculture zine the whole earth catalog later that year he was the cameraman for douglas englebarts demonstration mother of all demos which laid the foundations of interactive graphical computing spanp
pspanas a lifelong visionary and an adventurer with a unique mix of scientific education army officer experience and classy pedigree brand participated in many of the key scenes and events of late twentiethcentury american culturespanp
pspanmore recently he is known for cofounding the long now foundation which has built a clock inside a mountain designed to run for 10000 years to promote longterm thinking and the revive amp restore project which is applying genetic technology to wildlife conservation ideally including the resurrection of the woolly mammothspanp
pspanstewart often warns that we are as gods and have to get good at it humanity has become a planetary force with an emerging planetary consciousness what kind of civilizations emerge from taking that seriously we called him up at his library north of san francisco to discuss the future of mans dealings with naturespanp
p p
pbwolf weve recently been discussing where society ends and nature begins how should we relate to ecosystem services and the ecosystem balance as parts of our industrial and social orderbp
pbstewartbspan the only two magazines that i get anymoreive got rid of everything elseare palladium and noema berggruens thing noema had this campaignthey interviewed jerry brown and me about it a while backwhere they said look weve been thinking globally for a while now and theres some things for which its been great when the global economy makes all the cities grow and we get out of poverty but theres also the planet and the term planetary economy has no meaning the dynamics of the planet are of a different order and i think what youre talking about here is getting those two wholesystem bodies of thought to engage each other rigorouslyspanp
pspanwe used to talk about egg emerging global governance and the realization that you know its not done with black helicopters its done with all the economists talking to each other and having a global economy to sort of share a frame of reference and a body of economic thought to share thoughts about now that theyre using models instead of equations theyre getting a little more predictive for a changespanp
pspanthat happened because of the santa fe institute where i served on the board for 14 years the institute was founded by bored nuclear physicists at los alamos its often the case that biology moves forward when physicists get bored and decide that they can take their rigorous thinking and deploy it against biology sometimes that works mostly it doesnt but it worked to the extent that they were recognizing complex adaptive systems as being of a different order than those that had been studied before so they reinvented cybernetics with computers with the computers they could do modeling spanp
pspanthey got a bunch of economists and physicists togetherbasically their friendsand asked the question in a series of sitdown meetings in santa fe is there anything we can talk about together what we need to do first is become familiar with each others discipline enough to be able to talk at all so they flipped a coin to see who goes firsteconomists or physicistsand the economists went first they had a nobel prizewinning guy ken arrow and some others in the group they were really good economists they got up and went to the board and started writing out the equations that were their current understanding of how you think economically the physicists kind of glanced at one another finally one of them raised their hand and asked what are you doing and the economists replied were writing the equations we learned that from you and the physicist said we havent used equations in years and the economists said what do you use youre still doing physics right and the physicists answered well we use models dont youspanp
pspanand what finally happened with the santa fe institute is the economists said okay prove it model us some economics they came up with a concept which they called bounded rationality which is what humans actually operate on most of economics up to that point had been based on what would the rational person do and on a theory of games consisting of rational players and so on then they began to model large quantities of these creatures that had imperfect knowledge or were doing the best they could with it this was called agentbased modeling and each of these players operated either on a different theory of the world which we all do or on different information that they had access to how did they behave under those circumstances the answer is that its a complex adaptive system and theres all of what goes on with chaos theory like strange attractors and all of thatprofound unpredictability in most cases this then gave them the beginnings of a swing in economics actually which flipped from witchcraft to become more predictive because they started to behave like weather forecastersspanp
pspanthis is philip tetlocks contribution to intellectual thought forcing people to make falsifiable predictions and state their degree of confidence in each prediction about what is going to happen and by when you get the superforecasters who learned to do that and then learned from studying basically the video of the game how did that guy get by me on the basketball court he did this other thing ive never seen before well ive seen it now now it wont happen again and so game two is different from game one and thats ideally what you can begin to dospanp
pspanthats why my wife ryan phelan who runs revive amp restore came up with the concept of intended consequences which she immediately turned into a workshop and then into a paper when were doing any kind of genetic work with wildlife that would lead to some kind of intervention on the ground people would say you cant do that because ecology is very complicated and unpredictable and you know there will be unintended consequences and youll be really sorryspanp
pspanso it turns out nobodys ever done the research to find out if thats what actually happened with conservation interventions all they knew about was things like cane toads in australia which was not done by conservation scientists at the time the scientists said dont do it you will be really sorry and the agriculturists went ahead and did it anyway and likewise there were species introduced in hawaii basically anytime you introduce anything larger than a bug to an island its going to have deleterious consequences thats not so true on continents by the wayspanp
pspananyway some of our scientists did the research theres been about a thousand cases of intervention in the united states by wildlife conservationists where a species is introduced or reintroduced and the golden boy story is the wolves of yellowstone park or the beavers in scotland and so on theyve been gone for 400 years they came back and immediately did good for everybody so the question for these thousand interventions is first do they cause any harm because at the time people often ran out of money fighting for the permission to try something that they knew damn well was going to work some things were surprising but they didnt matter they were neutral and sometimes the species didnt take so youd say well it was a failure but its not its just that nothing bad happened but no good thing happened either but then if they had the money they would go back with the lessons learned from the first reintroduction and do it better the next time and then even better the time after that and by then the animals are starting to learn how to behave in the environment too so theyve got their own story going again and thats a successspanp
pspannobody pays any attention when these interventions tail off into a success its failures that are news but we discovered that when its professional biologists doing the work they dont cause problems there was one introduction in the southeastern united states which apparently led to the extinction of a local fish in the stream it was just a local fish and so the harm was local and minimal and only that one casespanp
pbmatt i wonder if theres some oversensitivity in the biology world because theres historical experience with pathogens today we could say look at the dangers of gainoffunction research but maybe those should be considered a totally different categorybp
pspani think it does its mainly in medicine really only in the last century has it become worth your time to go to a doctor from 1920 on it started to become a slightly better bet to go to the doctor now its a much better bet and that has happened with an organism which we do not understand completely at all we understand a whole lot we can draw a map that is the size of the wall behind me of just the metabolic pathways not only in humans but in any large animal and so are you going to have unintended consequences when you meddle in that yeah but then you develop doubleblind phasethree research and whatnot to head off the possible harm and by the time you finally deploy something you have a lot of confidence its not going to cause any harm and it looks like it might cause some good spanp
pspanwe are in the process of figuring out how to do that at a planetary scale thats what geoengineering is largely about the best researchers like david keith at harvard are completely doing incrementalist researchway smaller than a volcano i mean the main information we have about solar geoengineering socalled reflective stuff in the stratosphere comes from the mount pinatubo eruption and others which are way bigger than anything that humans would do but we want to be able to do it for a while and actually stop the temperature rise and even bring it down a bit that way we buy time to do all the other stuff so that climate is not an issue anymore that will take one to two hundred yearsspanp
pspanso anyway i came to all that because of complex adaptive systems you have to adopt the understanding that they are in some senses intractable to define in a way where you know for sure that it is going to do what you had intended you never have complete enough knowledge to know that until you experiment in a number of small and illuminating ways but once you do that you can actually manage these very complex adaptive systems and thats what humans are taking on in this century i thinkspanp
pbwolf so then our big picture is this idea of complex adaptive systems in the context of the relationship between industrial civilization and our natural environment a lot of people see human civilization and nature as opposed do you think we can find a more symbiotic relationship that seems to be a theme in your work what do you think that looks likebp
pspani think its actually useful to keep the distinction between human activities and nature i think that both nature and human activities in this century are in the process of learning to blend in with each other but i think the distinction is actually helpful for doing that what we do with intention what we do with abstraction what we do with language and socalled culture involves a lot of darwinian sorting but its not darwinian evolution in the sense that ideas have to individually reproduce in some fashion in order to carry on we have broadcast capabilities that nature does not for examplespanp
pspanwhat i know as a conservationist and from working with conservation biologists is that the rate of evolution has generally gone up since humans started having large impacts on all the kinds of environments that various creatures plants and microbiota live in theres this very good book inheritors of the earth by chris thomas that documents this increased rate of evolution more and more people are seeing wildlife in town raccoons foxes coyotes in california everybody that shares a biome spends a lot of their time evolving in relation to one otherspanp
pspanand thats coevolution which is a profound concept one of the most cited papers in all of biology is by peter raven and paul ehrlich who was an advisor of mine at stanford he said it was a great paper to write with peter because they didnt have to do anything they just had a couple of cups of coffee together then reported on what they were finding in their researchspanp
pspancoevolution is a profound concept that i think scales it scales up from microorganisms to the planetary scale some of it is expressed in the gaia hypothesis jim lovelock and lynn margulis came up with that long ago and i got to print an early version of it actually the gaia hypothesis itself opened up a whole new avenue of nature and humanity in a sense taking each other seriously and gave us the scale and scope to think about human activities having a planetaryscale impact gaia is different after humanity shows up and takes dominion and presumably gaia never had a model of herself the planetary selfregulating system got there by evolution got there without selfconsciousness and got there without a model but humans generate models all the time we cant help it and the gaia concept was a wonderfully inclusive model of engaging nature at planetary scalespanp
pbwolf one way that humans and nature then fit together in a way thats going to change both is that were now in this position of modeling these planetary effects and the planetary ecosystem and so we have to learn how to garden that ecosystem and we have to learn how it affects us and how to integrate those things wellbp
pspana lot of this is kind of like medicine and gardening in some respects because of the do no harm injunction in a way the part humans are sorting out is moving beyond conquering nature danny hillis made this point a while ago when we were starting the long now foundation that humanitys story up until pretty recently has basically been humans learning to conquer nature to master nature to whip it to our aims and that story is complete enough that we can move into the next mode which is basically conquering ourselves in relation to nature and realizing that while we can do everything we should not do everythingwe should only do some things and stop doing some things that cause undue harmspanp
pspanand thats part of why the idea and practice of deextinction appealed to me because its kind of a new level of thinking through undoing harm were not going to bring back dinosaurs but we can bring back the thylacine the tasmanian tiger that one is well along right now and it would be nice to have an apex predator back in tasmania and in the parts of australia that used to have thylacines its not as crucial as something like a woolly mammoth where we really need to get the mammoth steppe fully back to help stabilize the climate over the long termspanp
pbwolf what distinguishes a realitybased framing on a problem like this as opposed to other ways of thinking about it this is a concept youve used previously why is it importantbp
pspana guy named rapoport said something that i quoted in the beginning of one of the books i did knowledge will never replace respect in human dealings with nature you can know a lot and generally the more you know the better but youre never going to know it all and so its about a certain amount of modesty if you cant manage humility modesty will do in the face of complex systems its actually a prudent and usually necessary approach if yourespanp
pspandoing anything that is going to stay useful you can make big changes but then they take on lives of their own some of the ways they go may not be what you wish would have happened the models are always evolving theyre evolving in terms of your ability to sense things like getting knowledge of oceans at depth for example they evolve in relation to notions that people have of how to put ideas together in a way thats effective in the worldspanp
pspanscience is about organized skepticism to determine what you keep having to come back to because its the part that wont change in relation to your opinions and were sort of missing that in the public discourse right now the idea that you can make up the world that you think the way you think is convenient and then act on that and thats as important as what scientists turn up its good that people got postmodernism and all that other stuff science is embedded in scientists who are human and fallible but science takes account of that in a way that strictly postmodern thinking doesnt really allow for theres been this fashion these past years maybe decades to think of everything in terms of power relationshipsgender colonialism and late capitalism whatever that is when those terms are not actually appropriate its a simplistic filtering of experience and knowledge that you always want to bear in mind but not fall completely into where you cant see anything elsespanp
pbwolf youve mentioned that ecosystems and human society are complex adaptive systems can you say more about how we should approach those kinds of systems in theory and practicebp
pspanback in the 1990s climate scientists were getting worked up about what was happening with the keeling curve that we were going to have way too much co2 and methane and that the atmosphere was going to heat up badly and so they said quite rightly that weve got to mitigate the greenhouse gas getting into the atmosphere which means weve got to mitigate the use of fossil fuels for energy and then a guy named jesse ausubel at rockefeller university in new york came up with a paper saying absolutely we need to do all that and were probably not going to be able to do all of it as fast as we need to just because theres so much friction in the system and so we need to think about adapting to temperature rises that are going to happen anyway this was treated as a moral hazard violation [that adaptation would reduce the incentive to do the right thing which is to mitigate fossil fuel use] efforts were made to destroy jesses reputation and so adaptation was a taboo line of research and discussion for a decade or two now could you have known at the time that this was actually a stupid thing to dospanp
pbwolf it seems pretty straightforward that you dont want to shut down some line of questioning just because it might slightly take the pressure off some other important thing theres also a big dosing of bad faith in those things theres people who get attached to the idea of reducing fossil fuel usage and bring in other unrelated motivations it may be that for them its not about global warming its actually that they dont like industrial society and then anyone whos providing solutions to the original problem becomes an enemybp
pspanthis is true of various kinds of intellectuals including me im sure and this happened with my old teacher paul ehrlich he is a brilliant population biologist hes not a brilliant human population biologist however and so he actually became part of the problem by imagining that the authority with which he could speak about butterfly populations and coevolution situations could be directly applied to human populations and with his sense of humor which is great he became very persuasive on the johnny carson show and so on and people who actually studied human demographics had a completely different view that was basically suppressed by paul and my fellow environmentalists of that time including me by the wayspanp
pbwolf this was the population bomb theory that human overpopulation was going to consume all the resources and cause a collapsebp
pspanyeah the population bomb theory probably appealed to us for a number of reasons one of them is that it had this kind of algorithmic clarity we werent looking at real data the way human demographers were at that time and those demographers were seeing this thing in response to what they saw in the world not in response to theory which got named the demographic transition it turned out that with the prospect of prosperity when women moved from the village to the city they immediately stopped having seven children and had two instead and then they would get them educated so theyre trading seven ignorant children for two educated children this is a good deal and clear thinking by the women and that is one of the mechanisms by which the demographic transition actually happens but we still have people screaming about overpopulationspanp
pbmatt there is this weberian distinction between science and politics as vocations that these are two fundamentally different domains that require very different types of thinking they select for different types of individuals if you look at the history of the twentieth century did the fact that oppenheimer was pivotal in the creation of the bomb give him some special privilege should the atomic scientists themselves have a special privilege to talk about the use of nuclear weapons or is that actually out of their domain of expertise this question of the relationship between sciences and between science and politics seems to be at the center of so many of our controversiesbp
pspanon that particular subject we saw the whole idea of nuclear winter friends of mine like carl sagan bought into it and the jasons [scientific groups that advised the us government] looked at it freeman dyson was part of the jasons at that time and they could not make sense of the numbers and over a few years some scientists did put in some time to try and understand it they came up with at most a nuclear autumn and thats part of why freeman then was dubious about climate change because he had been through that thing with the nuclear winter exaggeration and he feared that there was exaggeration going on with the climate and there is by the way a lot of exaggeration in relation to climate that is not to say it isnt going on in the biggest way but the main event gets put in apocalyptic terms and i think thats completely misplacedspanp
pspanand then that shifts over into another discussion is apocalyptic thinking good for anything whatsoever other than excitement my girlfriend in the 70s was stephanie mills the woman who got up in front of the mills college and was valedictorian or whatever she was and said she was not going to have children because the world is overpopulated and it would be irresponsible of her to think about having children to her credit she never did but it was actually a goofy thing that my generation got up to it was based on nothing it turned outspanp
pbmatt youre saying it wasnt just a pose or a theory to believe in overpopulation people really changed how they livedbp
pspanyes and they are now there are people figuring im not going to have children because its going to be a hot world and all these other bad things are going to happen and therefore dont reproduce part of it is i think a scale error maybe its even a pacing error of some kindspanp
pspandavid mackay who was chief scientific advisor to the british government wrote a great book on global warming one of the things he addressed is people who are imagining that their personal behavior is going to save the world like people who will unplug their phone charger when its not actually charging their phone as if that was anything other than performative virtue signaling he said lets look at the actual energy involved here and then ill compare that to one bathtub that this person takes and the heating that was involved with getting the waters to the right temperature they like and how many megayears of not having your phone charger plugged in does it take to match one bathtub and so just keeping the scale of things in mind helps a lotspanp
pspanso theres overpersonalizing stuff live the change you want is in some respects a really valid idea but not in all respects i think it reminds me a little bit of landfills back in the day in the 1970s we got all worked up about landfills and then this guy did a book that looked into what actually goes into the landfill is it those terrible burgerenclosing plastic things that you get along with your burger at a fast food jointspanp
pspanor is it building materials turns out its mainly building materials in the landfills its buildings and all the spare parts all the spare leftover boards you cant use after all and all this kind of stuff im becoming somewhat of a fan of landfills i think its a great way to sequester carbonspanp
pbmatt does this mean youre antirecycling stewartbp
pspanwell a lot of recycling is kind of like the newspaper drives during the wars that i actually remember in world war ii we had to go out and collect everybodys newspapers and they were bundled up and sent off to the government for some purpose that we never understood and it turned out there was no purpose and actually it was just something to mobilize citizens so theyd be part of the causespanp
pstrongwolf it reminds me of this story in rural canada during world war ii they had people guarding a bridge just in the middle of nowhere in the prairies as if the germans or whoever were going to show upstrongp
pspancan you imagine how much fun that is actually spotting airplanes and learning all the various airplane silhouettes and whatnot there were aspects of world war ii that were great fun if you werent in combatspanp
pbmatt all that gets to this important question about the scale at which we intervene to solve these problems i think theres a tendency especially in the mass media age to make everything about the individual if only i were to sacrifice going on an airplane and so would everyone else then we would solve the problem in fact more often the scale has to be at the level of the state or of collective actionbp
pspani think with the climate its useful to ask what the things are that actually function at the scale that you want for the result that you needin this case a planetary scale and thinking through that reversed my opinion about nations in the sense that nationstates still pretty much control their tax systems to the extent that you want to use the tax apparatus to make coal and gasoline expensive and clean forms of energy cheap with a carbon tax the un cant do that nonprofits cant do that businesses cant do that only governments can pass laws and enforce them and likewise with geoengineering with sulfur dioxide in the stratosphere you dont have to go to planetary scales to start finding out to what extent it can work you do it in tiny tiny amounts it actually changes things in the direction that you want without causing regional problems like stopping the monsoon that would starve india or cook indiaspanp
pspanbut unilateral geoengineering has been treated as the great crime that might come out of taking geoengineering seriously somebody might just go off and do it without asking everyone elses permission and this is where you get into a really interesting mode of this century having to think through global permission for planetary actions do you need to get total unanimity of everyone on earth saying okay lets do it do you need to get unanimity of all the nations of most of the nations measuring how these kinds of things will be worked through in this centuryspanp
pbwolf to continue the question of scale of action this also gets to sort of what timescale we are acting on its like your idea of pace layering you want to act and learn at the appropriate pace in relation to the phenomenon or else you risk reacting too fast or slowbp
pspanwhen i was studying organic chemistry for my biology degree it felt like special cases all the way down but thats not actually true physicists like geoffrey west at the santa fe institute came along and said well there is a scaling effect it is clearly the case thatthey call it kleibers lawthat large animals have slower heartbeats and live a long time and tiny animals have very rapid heartbeats and live a short time it turns out that mice and elephants both have the same number of heartbeats in a lifetime and the difference has to do with scale mice are small but the network effects of being a mouse are quite different from the network effects of being an elephantspanp
pspangeoffrey wests book emscaleem went on to look for kleibers law in human institutions like cities cities in particular have a reverse relationship the bigger they get the faster they go instead of slower and this frightened him at least more than it frightened me he believed that clearly the great thing about cities is yeah they create these extra problems but because theyre faster at everything they can come up with solutions to the problems that they cause faster than they caused them and therefore they get bigger and more advantageous and pretty soon youve got a whole urban global civilization and then he just sort of hit some kind of interior wall thinking this cant go onspanp
pspanhe thought that infinite acceleration is not something that humans can live with that its going to just slow down and break so he was worried about a collapse that may come about from these cities getting bigger and bigger faster and faster until something breaks in a big way im not persuaded by that and maybe its because by training im a biologist and hes a physicist i just see so many ameliorating gaialike mechanisms that biology has to manage big changespanp
pspani mean the planets shift from anaerobic to aerobic life as the primary life form was a huge and seemingly catastrophic change certainly if youre an anaerobic microbe you didnt like it but the great oxygenation worked out actually pretty wellso we oxygenating organisms say you might think the anaerobic guys that have to hide down in the soil are saying yeah well fuck you were down here hating you to this very moment but none of that happens im pretty sure they dont even knowspanp
pbwolf youve been around for many decades working on all of these problems meeting all the key people in the field and seeing how things have changed over time what do you think are the most important lessons from these last decades that we need to be carrying forwardbp
pspanim trying to figure out if apocalyptic thinking is actually destructive or just a waste of time how much longer will the term existential threat be something that we are constantly hearing in the high intellectual public discourse its gotten so generalized you can say it about anything now is trump an existential threatspanp
pspanmartin rees the former astronomer royal is a friend in england i was trying to think of the real existential threats i thought well there are comets that are pretty rogue and are pretty big we can head off asteroids pretty well now but comets are probably not in that category so i wrote martin and asked him should i be worried about a comet hurtling in and blasting into earth and he said that the odds of that are so close to zero that you might as well consider them to be zerospanp
pspanthis is a guy who came up with a bet with steven pinker about how theres going to be a million people dying from bioerror or bioterror and we thought that steven won in 2020 but theres still the question of covid19 which has killed more than a million people worldwide was that a case of bioerror getting out of the wuhan lab thats still not decided yet so those guys are relitigating the betspanp
pspanbut anyway martin rees is the one who was saying he expected a million people to die from a bioterror or bioerror hes not a biologist but if it did escape from the wuhan lab he was right was that an existential threat to humanity not even closespanp
pbwolf theres a lot of these sorts of risks that are very disruptive and cause a lot of trouble but our ecology and our civilization are incredibly deep in their resilience for example the last time an asteroid big enough to matter hit earth was 65 million years ago thats a long time like rees says statistically its not happening again any time soon but even then life goes onbp
pspaneven then life goes on exactly this is what ive sort of realized you know if we had a major nuclear exchangelife would go on differently but mostly in recognizable ways i did put this question up on twitter the other day i was thinking in the morning pulled out the coffeeactually i was reading palladiumand i got thinking about civilization thanks to you guys and i put up this question individual civilizations come and go civilization continues it has for five to ten thousand years so when you think about a global civilization does that mean that therefore its deeply fragile or deeply robust which lesson do you drawspanp
pbwolf thats an interesting question i dont know the answerbp
pbmatt well while we have a global civilization at a certain level of analysis we also have the diffusion of certain kinds of technologies of certain ways of thinking and doing politics and economics theres still a lot of deep cultural distinction between say japanese and indians or africans and americans and europeans so in a sense that would make me optimistic about a sort of resiliencybp
pbyou have this modern technological civilization thats diffused among many different deeper historical cultures these existential risk questions dont really get resolved or mitigated by this phenomenon im describing but what it might mean is that even if you had some major crisis in say the anglosphere or in india it would not necessarily cascade or translate into a global catastrophe when rome collapsed that culture was only one instantiation of their peak technological development or is that not the case nowbp
pspanim going to go out on a limb and say that i think that global civilization is robust for some of the reasons we just discussed theres a fair amount spanp
pspanof variety and its one of the things that culture does its one of the things that nations do and even jared diamonds book collapse ends with him saying that all of these prior civilizations that collapsed didnt know about each other but we know about all of them right and ourselves that awareness means that we do not take longevity for granted which these other civilizations didspanp
pspanand so in that sense the concept of existential risk is a good one to have out there its probably not one to obsess over yeah things really can end at any scale you want to think about but at a giant scale theres a lot of microrobustness built in theres a lot of subsidiarity built in of these various things operating regionally at different rates independently of each other or even contrasting enough between each other in terms of pace layers that the system can handle shocksspanp
pbwolf you know it reminds me a little bit of the story of the tower of babel where humanity comes together and builds this big central civilization to control everything its fragile and hubristic but once you do that all the ambition in the system is towards differentiation and the system fragments back down to some stability god has a plan for this so to speakbp
pspani guess every now and then people get experimental they learn the hard way but it works outspanp
pspanthat was one of the things going on over the pa system at woodstock dont eat the brown acid brown acid is bad acid that was all being managed by the hog farm because they were running the overdose tent the tripping tent and you saw kids coming in really bad and so you sort of ask them through there what kind of acid did you take oh the brown acid okay no brown acid thats the ken kesey approach to science if you dont boil rocks and drink the water how do you know it wont make you drunk and i think that actually societies at various times get into that mode of screw it lets do it and its a good thing you know some hippies died some went crazy and stayed crazy but that boldness that fearlessness made it an exciting time to be around and because everything was illegal everything had to go by word of mouth and were talking about reality whats the real world that you fall back on personal experience is the real world that you fall back on to some extent and if you have avenues to transmit that talking with the hitchhiker you picked up because they were dressed like you are information gets aroundspanp
pspanand then that flew in the face of the going theories no hope without dope well actually theres such a thing as too much dope i just saw that kim stanley robinson in the beginning of his wonderful book the high sierra is talking about how when he was dropping acid in the 1970s he grew up in newport beach in southern california and then he went up into the mountains and he says i got high and i never came down and hes been in love with the high sierras ever since what does that say that youthful folly has its functions for societyspanp
div
pwolf tivy is editorinchief of palladium magazinep
pmatt ellison is executive editor of palladium magazinep
divthe post a hrefhttpswwwpalladiummagcom20220914lifegoesonwithstewartbrandilife goes oni with stewart brand
a appeared first on a hrefhttpswwwpalladiummagcompalladiuma
|
pspanstewart brand born 1938 1964 hanging ken keseys merry pranksters center lsd counterculture described tom wolfes electric koolaid acid test 1966 realized satellite image earth powerful symbol holistic environmental thinking launched campaign photo released nasa 1968 succeeded satellite photo earth taken geostationary satellite ats3 appeared cover stewarts famous counterculture zine earth catalog later year cameraman douglas englebarts demonstration mother demos laid foundations interactive graphical computingspanp pspanas lifelong visionary adventurer unique mix scientific education army officer experience classy pedigree brand participated key scenes events late twentiethcentury american culturespanp pspanmore recently known cofounding long foundation built clock inside mountain designed run 10000 years promote longterm thinking revive amp restore project applying genetic technology wildlife conservation ideally including resurrection woolly mammothspanp pspanstewart warns gods good humanity planetary force emerging planetary consciousness kind civilizations emerge taking seriously called library north san francisco discuss future mans dealings naturespanp pp pbwolf weve recently discussing society ends nature begins relate ecosystem services ecosystem balance parts industrial social orderbp pbstewartbspan magazines anymoreive got rid elseare palladium noema berggruens thing noema campaignthey interviewed jerry brown backwhere said look weve thinking globally theres things great global economy makes cities grow poverty theres planet term planetary economy meaning dynamics planet different order think youre talking getting wholesystem bodies thought engage rigorouslyspanp pspanwe talk egg emerging global governance realization know black helicopters economists talking having global economy sort share frame reference body economic thought share thoughts theyre models instead equations theyre getting little predictive changespanp pspanthat happened santa fe institute served board 14 years institute founded bored nuclear physicists los alamos case biology moves forward physicists bored decide rigorous thinking deploy biology works doesnt worked extent recognizing complex adaptive systems different order studied reinvented cybernetics computers computers modelingspanp pspanthey got bunch economists physicists togetherbasically friendsand asked question series sitdown meetings santa fe talk need familiar discipline able talk flipped coin goes firsteconomists physicistsand economists went nobel prizewinning guy ken arrow group good economists got went board started writing equations current understanding think economically physicists kind glanced finally raised hand asked economists replied writing equations learned physicist said havent equations years economists said use youre physics right physicists answered use models dont youspanp pspanand finally happened santa fe institute economists said okay prove model economics came concept called bounded rationality humans actually operate economics point based rational person theory games consisting rational players began model large quantities creatures imperfect knowledge best called agentbased modeling players operated different theory world different information access behave circumstances answer complex adaptive system theres goes chaos theory like strange attractors thatprofound unpredictability cases gave beginnings swing economics actually flipped witchcraft predictive started behave like weather forecastersspanp pspanthis philip tetlocks contribution intellectual thought forcing people falsifiable predictions state degree confidence prediction going happen superforecasters learned learned studying basically video game guy basketball court thing ive seen ive seen wont happen game different game thats ideally begin dospanp pspanthats wife ryan phelan runs revive amp restore came concept intended consequences immediately turned workshop paper kind genetic work wildlife lead kind intervention ground people cant ecology complicated unpredictable know unintended consequences youll sorryspanp pspanso turns nobodys research find thats actually happened conservation interventions knew things like cane toads australia conservation scientists time scientists said dont sorry agriculturists went ahead likewise species introduced hawaii basically anytime introduce larger bug island going deleterious consequences thats true continents wayspanp pspananyway scientists research theres thousand cases intervention united states wildlife conservationists species introduced reintroduced golden boy story wolves yellowstone park beavers scotland theyve gone 400 years came immediately good everybody question thousand interventions cause harm time people ran money fighting permission try knew damn going work things surprising didnt matter neutral species didnt youd failure bad happened good thing happened money lessons learned reintroduction better time better time animals starting learn behave environment theyve got story going thats successspanp pspannobody pays attention interventions tail success failures news discovered professional biologists work dont cause problems introduction southeastern united states apparently led extinction local fish stream local fish harm local minimal casespanp pbmatt wonder theres oversensitivity biology world theres historical experience pathogens today look dangers gainoffunction research maybe considered totally different categorybp pspani think mainly medicine century worth time doctor 1920 started slightly better bet doctor better bet happened organism understand completely understand lot draw map size wall metabolic pathways humans large animal going unintended consequences meddle yeah develop doubleblind phasethree research whatnot head possible harm time finally deploy lot confidence going cause harm looks like cause goodspanp pspanwe process figuring planetary scale thats geoengineering largely best researchers like david keith harvard completely incrementalist researchway smaller volcano mean main information solar geoengineering socalled reflective stuff stratosphere comes mount pinatubo eruption way bigger humans want able actually stop temperature rise bring bit way buy time stuff climate issue anymore yearsspanp pspanso came complex adaptive systems adopt understanding senses intractable define way know sure going intended complete knowledge know experiment number small illuminating ways actually manage complex adaptive systems thats humans taking century thinkspanp pbwolf big picture idea complex adaptive systems context relationship industrial civilization natural environment lot people human civilization nature opposed think find symbiotic relationship theme work think looks likebp pspani think actually useful distinction human activities nature think nature human activities century process learning blend think distinction actually helpful intention abstraction language socalled culture involves lot darwinian sorting darwinian evolution sense ideas individually reproduce fashion order carry broadcast capabilities nature examplespanp pspanwhat know conservationist working conservation biologists rate evolution generally gone humans started having large impacts kinds environments creatures plants microbiota live theres good book inheritors earth chris thomas documents increased rate evolution people seeing wildlife town raccoons foxes coyotes california everybody shares biome spends lot time evolving relation otherspanp pspanand thats coevolution profound concept cited papers biology peter raven paul ehrlich advisor stanford said great paper write peter didnt couple cups coffee reported finding researchspanp pspancoevolution profound concept think scales scales microorganisms planetary scale expressed gaia hypothesis jim lovelock lynn margulis came long ago got print early version actually gaia hypothesis opened new avenue nature humanity sense taking seriously gave scale scope think human activities having planetaryscale impact gaia different humanity shows takes dominion presumably gaia model planetary selfregulating system got evolution got selfconsciousness got model humans generate models time cant help gaia concept wonderfully inclusive model engaging nature planetary scalespanp pbwolf way humans nature fit way thats going change position modeling planetary effects planetary ecosystem learn garden ecosystem learn affects integrate things wellbp pspana lot kind like medicine gardening respects harm injunction way humans sorting moving conquering nature danny hillis point ago starting long foundation humanitys story pretty recently basically humans learning conquer nature master nature whip aims story complete mode basically conquering relation nature realizing everythingwe things stop things cause undue harmspanp pspanand thats idea practice deextinction appealed kind new level thinking undoing harm going bring dinosaurs bring thylacine tasmanian tiger right nice apex predator tasmania parts australia thylacines crucial like woolly mammoth need mammoth steppe fully help stabilize climate long termspanp pbwolf distinguishes realitybased framing problem like opposed ways thinking concept youve previously importantbp pspana guy named rapoport said quoted beginning books knowledge replace respect human dealings nature know lot generally know better youre going know certain modesty cant manage humility modesty face complex systems actually prudent usually necessary approach yourespanp pspandoing going stay useful big changes lives ways wish happened models evolving theyre evolving terms ability sense things like getting knowledge oceans depth example evolve relation notions people ideas way thats effective worldspanp pspanscience organized skepticism determine having come wont change relation opinions sort missing public discourse right idea world think way think convenient act thats important scientists turn good people got postmodernism stuff science embedded scientists human fallible science takes account way strictly postmodern thinking doesnt allow theres fashion past years maybe decades think terms power relationshipsgender colonialism late capitalism terms actually appropriate simplistic filtering experience knowledge want bear mind fall completely cant elsespanp pbwolf youve mentioned ecosystems human society complex adaptive systems approach kinds systems theory practicebp pspanback 1990s climate scientists getting worked happening keeling curve going way co2 methane atmosphere going heat badly said rightly weve got mitigate greenhouse gas getting atmosphere means weve got mitigate use fossil fuels energy guy named jesse ausubel rockefeller university new york came paper saying absolutely need probably going able fast need theres friction system need think adapting temperature rises going happen treated moral hazard violation [that adaptation reduce incentive right thing mitigate fossil fuel use] efforts destroy jesses reputation adaptation taboo line research discussion decade known time actually stupid thing dospanp pbwolf pretty straightforward dont want shut line questioning slightly pressure important thing theres big dosing bad faith things theres people attached idea reducing fossil fuel usage bring unrelated motivations global warming actually dont like industrial society whos providing solutions original problem enemybp pspanthis true kinds intellectuals including im sure happened old teacher paul ehrlich brilliant population biologist hes brilliant human population biologist actually problem imagining authority speak butterfly populations coevolution situations directly applied human populations sense humor great persuasive johnny carson people actually studied human demographics completely different view basically suppressed paul fellow environmentalists time including wayspanp pbwolf population bomb theory human overpopulation going consume resources cause collapsebp pspanyeah population bomb theory probably appealed number reasons kind algorithmic clarity werent looking real data way human demographers time demographers seeing thing response saw world response theory got named demographic transition turned prospect prosperity women moved village city immediately stopped having seven children instead educated theyre trading seven ignorant children educated children good deal clear thinking women mechanisms demographic transition actually happens people screaming overpopulationspanp pbmatt weberian distinction science politics vocations fundamentally different domains require different types thinking select different types individuals look history twentieth century fact oppenheimer pivotal creation bomb special privilege atomic scientists special privilege talk use nuclear weapons actually domain expertise question relationship sciences science politics center controversiesbp pspanon particular subject saw idea nuclear winter friends like carl sagan bought jasons [scientific groups advised government] looked freeman dyson jasons time sense numbers years scientists time try understand came nuclear autumn thats freeman dubious climate change thing nuclear winter exaggeration feared exaggeration going climate way lot exaggeration relation climate isnt going biggest way main event gets apocalyptic terms think thats completely misplacedspanp pspanand shifts discussion apocalyptic thinking good whatsoever excitement girlfriend 70s stephanie mills woman got mills college valedictorian said going children world overpopulated irresponsible think having children credit actually goofy thing generation got based turned outspanp pbmatt youre saying wasnt pose theory believe overpopulation people changed livedbp pspanyes people figuring im going children going hot world bad things going happen dont reproduce think scale error maybe pacing error kindspanp pspandavid mackay chief scientific advisor british government wrote great book global warming things addressed people imagining personal behavior going save world like people unplug phone charger actually charging phone performative virtue signaling said lets look actual energy involved ill compare bathtub person takes heating involved getting waters right temperature like megayears having phone charger plugged match bathtub keeping scale things mind helps lotspanp pspanso theres overpersonalizing stuff live change want respects valid idea respects think reminds little bit landfills day 1970s got worked landfills guy book looked actually goes landfill terrible burgerenclosing plastic things burger fast food jointspanp pspanor building materials turns mainly building materials landfills buildings spare parts spare leftover boards cant use kind stuff im somewhat fan landfills think great way sequester carbonspanp pbmatt mean youre antirecycling stewartbp pspanwell lot recycling kind like newspaper drives wars actually remember world war ii collect everybodys newspapers bundled sent government purpose understood turned purpose actually mobilize citizens theyd causespanp pstrongwolf reminds story rural canada world war ii people guarding bridge middle prairies germans going upstrongp pspancan imagine fun actually spotting airplanes learning airplane silhouettes whatnot aspects world war ii great fun werent combatspanp pbmatt gets important question scale intervene solve problems think theres tendency especially mass media age individual sacrifice going airplane solve problem fact scale level state collective actionbp pspani think climate useful ask things actually function scale want result needin case planetary scale thinking reversed opinion nations sense nationstates pretty control tax systems extent want use tax apparatus coal gasoline expensive clean forms energy cheap carbon tax un cant nonprofits cant businesses cant governments pass laws enforce likewise geoengineering sulfur dioxide stratosphere dont planetary scales start finding extent work tiny tiny amounts actually changes things direction want causing regional problems like stopping monsoon starve india cook indiaspanp pspanbut unilateral geoengineering treated great crime come taking geoengineering seriously somebody asking elses permission interesting mode century having think global permission planetary actions need total unanimity earth saying okay lets need unanimity nations nations measuring kinds things worked centuryspanp pbwolf continue question scale action gets sort timescale acting like idea pace layering want act learn appropriate pace relation phenomenon risk reacting fast slowbp pspanwhen studying organic chemistry biology degree felt like special cases way thats actually true physicists like geoffrey west santa fe institute came said scaling effect clearly case thatthey kleibers lawthat large animals slower heartbeats live long time tiny animals rapid heartbeats live short time turns mice elephants number heartbeats lifetime difference scale mice small network effects mouse different network effects elephantspanp pspangeoffrey wests book emscaleem went look kleibers law human institutions like cities cities particular reverse relationship bigger faster instead slower frightened frightened believed clearly great thing cities yeah create extra problems theyre faster come solutions problems cause faster caused bigger advantageous pretty soon youve got urban global civilization sort hit kind interior wall thinking cant onspanp pspanhe thought infinite acceleration humans live going slow break worried collapse come cities getting bigger bigger faster faster breaks big way im persuaded maybe training im biologist hes physicist ameliorating gaialike mechanisms biology manage big changespanp pspani mean planets shift anaerobic aerobic life primary life form huge seemingly catastrophic change certainly youre anaerobic microbe didnt like great oxygenation worked actually pretty wellso oxygenating organisms think anaerobic guys hide soil saying yeah fuck hating moment happens im pretty sure dont knowspanp pbwolf youve decades working problems meeting key people field seeing things changed time think important lessons decades need carrying forwardbp pspanim trying figure apocalyptic thinking actually destructive waste time longer term existential threat constantly hearing high intellectual public discourse gotten generalized trump existential threatspanp pspanmartin rees astronomer royal friend england trying think real existential threats thought comets pretty rogue pretty big head asteroids pretty comets probably category wrote martin asked worried comet hurtling blasting earth said odds close zero consider zerospanp pspanthis guy came bet steven pinker theres going million people dying bioerror bioterror thought steven won 2020 theres question covid19 killed million people worldwide case bioerror getting wuhan lab thats decided guys relitigating betspanp pspanbut martin rees saying expected million people die bioterror bioerror hes biologist escape wuhan lab right existential threat humanity closespanp pbwolf theres lot sorts risks disruptive cause lot trouble ecology civilization incredibly deep resilience example time asteroid big matter hit earth 65 million years ago thats long time like rees says statistically happening time soon life goes onbp pspaneven life goes exactly ive sort realized know major nuclear exchangelife differently recognizable ways question twitter day thinking morning pulled coffeeactually reading palladiumand got thinking civilization thanks guys question individual civilizations come civilization continues thousand years think global civilization mean deeply fragile deeply robust lesson drawspanp pbwolf thats interesting question dont know answerbp pbmatt global civilization certain level analysis diffusion certain kinds technologies certain ways thinking politics economics theres lot deep cultural distinction japanese indians africans americans europeans sense optimistic sort resiliencybp pbyou modern technological civilization thats diffused different deeper historical cultures existential risk questions dont resolved mitigated phenomenon im describing mean major crisis anglosphere india necessarily cascade translate global catastrophe rome collapsed culture instantiation peak technological development case nowbp pspanim going limb think global civilization robust reasons discussed theres fair amountspanp pspanof variety things culture things nations jared diamonds book collapse ends saying prior civilizations collapsed didnt know know right awareness means longevity granted civilizations didspanp pspanand sense concept existential risk good probably obsess yeah things end scale want think giant scale theres lot microrobustness built theres lot subsidiarity built things operating regionally different rates independently contrasting terms pace layers system handle shocksspanp pbwolf know reminds little bit story tower babel humanity comes builds big central civilization control fragile hubristic ambition system differentiation system fragments stability god plan speakbp pspani guess people experimental learn hard way works outspanp pspanthat things going pa system woodstock dont eat brown acid brown acid bad acid managed hog farm running overdose tent tripping tent saw kids coming bad sort ask kind acid oh brown acid okay brown acid thats ken kesey approach science dont boil rocks drink water know wont drunk think actually societies times mode screw lets good thing know hippies died went crazy stayed crazy boldness fearlessness exciting time illegal word mouth talking reality whats real world fall personal experience real world fall extent avenues transmit talking hitchhiker picked dressed like information gets aroundspanp pspanand flew face going theories hope dope actually theres thing dope saw kim stanley robinson beginning wonderful book high sierra talking dropping acid 1970s grew newport beach southern california went mountains says got high came hes love high sierras youthful folly functions societyspanp div pwolf tivy editorinchief palladium magazinep pmatt ellison executive editor palladium magazinep divthe post hrefhttpswwwpalladiummagcom20220914lifegoesonwithstewartbrandilife goes oni stewart brand appeared hrefhttpswwwpalladiummagcompalladiuma
|
63229c9ddb1c50ad52b28455
|
Adept
|
pa relnoopener hrefhttpswwwadeptaiact target_blankadeptap
pthe post a relnofollow hrefhttpmarginalrevolutioncommarginalrevolution202209adepthtmladepta appeared first on a relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap
|
pa relnoopener hrefhttpswwwadeptaiact target_blankadeptap pthe post relnofollow hrefhttpmarginalrevolutioncommarginalrevolution202209adepthtmladepta appeared relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap
|
63229cb3db1c50ad52b28459
|
How Government Officials Bully Social Media Companies Into Censorship
|
div
picture
source sizesminwidth 600px 331px 100vw typeimagewebp srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202209jenpasakijpgwebp 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202209jenpasaki1200x675jpgwebp 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202209jenpasaki800x450jpgwebp 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202209jenpasaki600x338jpgwebp 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202209jenpasaki331x186jpgwebp 331w
source sizesminwidth 600px 331px 100vw typeimagejpeg srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202209jenpasakijpg 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202209jenpasaki1200x675jpg 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202209jenpasaki800x450jpg 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202209jenpasaki600x338jpg 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202209jenpasaki331x186jpg 331w
img width1200 alta picture of jen psaki against a red background with white icons for media companies next to her srchttpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202209jenpasaki800x450jpg height675
picture
div
pin a hrefhttpswwwwashingtonpostcompolitics20210719bidenfacebookmisinformationjuly 2021a president joe biden was asked by a reporter whether he had any message for platforms like facebook quottheyre killing peoplequot a hrefhttpswwwbbccomnewstechnology57901710he replieda quotthe only pandemic we have is among the unvaccinated and theyre killing peoplequotp
phis press secretary at the time jen psaki and legions of democrats rushed to his defense saying biden was referring to socalled quotmisinformationquot spread on the platform by the quotdisinformation dozenquota hrefhttpswwwnprorg20210513996570855disinformationdozentestfacebookstwittersabilitytocurbvaccinehoaxessome 12 or so accountsa deemed responsible for the vast majority of the platforms vaccineskeptical content but biden psaki and others in the administration have frequently used white house podiums to make bold and inexact claims about the harm posed by social media companies either implicitly suggesting or more explicitly demanding that these companies change their content moderation practices in line with the administrations preferencesp
pquotfacebook needs to move more quickly to remove harmful violative postsquot psaki a hrefhttpswwwreuterscomworldusussurgeongeneralwarnsovercovid19misinformation20210715said afrom her official perch adding that quotyou shouldnt be banned from one platform and not others for providing misinformationquot as if one platform has any control over the decisions made by the otherp
pthis type of government pressure as well as quotbullying threatening and cajolingquot that attempts quotto sway the decisions of private platforms and limit the publication of disfavored speechquot is known as emjawboningem and is the subject of a a hrefhttpswwwcatoorgpolicyanalysisjawboningagainstspeechnew reporta put out by will duffield a policy analyst at the cato institute quotleft unchecked [jawboning] threatens to become normalized as an extraconstitutional method of speech regulationquot morep
blockquotepquotjawboning occurs when a government official threatens to use his or her powerbe it the power to prosecute regulate or legislateto compel someone to take actions that the state official cannot jawboning is dangerous because it allows government officials to assume powers not granted to them by lawquotpblockquote
pin summer 2021 for example quotsurgeon general vivek murthy issued an advisory on health misinformation including eight guidelines for platformsquot following the psaki and biden comments quoton its own the advisory would have been inoffensive but statements by other members of the administration suggested sanctions for noncompliant platformsquot writes duffieldp
blockquotepquotwhite house communications director kate bedingfield completed the jawboning effort during a emmorning joeem interview prompted by a question about getting rid of section 230 she replied were reviewing that and certainly they should be held accountable and i think youve heard the president speak very aggressively about this by gesturing at changes to the intermediary liability protections that social media platforms rely on bedingfield added a vague threat to the administrations demands p
pby raising the specter of changes to or the repeal of section 230 the biden administration made a roundabout threat repealing section 230 would not make vaccine misinformation unlawful but it would harm facebook by exposing it to litigation over its users speech by demanding the removal of misinformation and threatening repeal the administration sought to bully facebook into removing speech that the government couldnt touchquotpblockquote
pduffield has worked to track prominent examples of jawboning database found a hrefhttpswwwcatoorgsitescatoorgfiles202209policyanalysis934annexpdfherea replete with examples of censorship attempts by politicians of both parties though quotnot every demand is paired with a threatquot he writes quotall the demands are made in the course of discussions about potential social media regulationquotp
pquotin general we know that a lot of jawboning happens behind closed doorsquot duffield tells emreasonem quotthere were prior to 2016 a couple of highprofile cases like wikileaksquot he notes quotbut the current era of normalized platform jawboning really begins after the 2016 electionquot he highlights sen dianne feinsteins dcalif social media crackdown attempts on purported russian disinformation back in 2017 as well as the possibility that twitters decision to limit the circulation of the hunter biden laptop story was due to how the company had come under fire trotted before congress and subsequently strengthened their hacked materials policy quotif they didnt take that down and it turns out to be a foreign op and it changes the course of the election theyre going to be right back testifying in front of congress hammered with regulation and finesquot noted disinformation researcher clint watts according to the cato reportp
psome platforms have been broadly resistant to government officials demands whether explicit or implied the cloudbased instant messaging service telegram duffield notes is quotnotorious for ignoring both requests and court ordersquot but this is probably due to the platform not being based in the us it thus has less reason to comply with us laws than platforms like facebook and twitter telegram its worth noting is beating out competitors like facebook messenger and whatsapp in much of eastern europe and the middle east including interestingly in both ukraine and russiap
pbut telegrams case is sadly an exception to the rule whether its congressional staffers pressuring social media employees to make certain content moderation calls behind closed doors or sitting us senators asking tech ceos to testify before themand a hrefhttpswwwpiratewirescompjackbenimblejackbequicksit prettya for their grandstanding and hectoringquotit is not the job of congress to oversee second guess or direct the decisions of private intermediariesquot writes duffield quotsuch oversight presumes a role in speech regulation that the constitution specifically denies congressquotp
pits not just section 230 and changes to liability protections that members of congress and biden administration officials threaten companies with quotwhile some changes to section 230 would change how platforms moderate speech antitrust would harm or dismember the noncompliant firmquot says duffieldp
pthis a hrefhttpsreasoncom20220426twitterfacebooknetflixandthemythofpermanentplatformpowermay well bea the disturbing a hrefhttpsreasoncom20210605thebipartisanantitrustcrusadeagainstbigtechbipartisan futurea of jawboningp
pthe post a relnofollow hrefhttpsreasoncom20220914howgovernmentofficialsbullysocialmediacompaniesintocensorshiphow government officials bully social media companies into censorshipa appeared first on a relnofollow hrefhttpsreasoncomreasoncomap
|
div picture source sizesminwidth 600px 331px 100vw typeimagewebp srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202209jenpasakijpgwebp 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202209jenpasaki1200x675jpgwebp 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202209jenpasaki800x450jpgwebp 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202209jenpasaki600x338jpgwebp 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202209jenpasaki331x186jpgwebp 331w source sizesminwidth 600px 331px 100vw typeimagejpeg srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202209jenpasakijpg 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202209jenpasaki1200x675jpg 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202209jenpasaki800x450jpg 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202209jenpasaki600x338jpg 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202209jenpasaki331x186jpg 331w img width1200 alta picture jen psaki red background white icons media companies srchttpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202209jenpasaki800x450jpg height675 picture div pin hrefhttpswwwwashingtonpostcompolitics20210719bidenfacebookmisinformationjuly 2021a president joe biden asked reporter message platforms like facebook quottheyre killing peoplequot hrefhttpswwwbbccomnewstechnology57901710he replieda quotthe pandemic unvaccinated theyre killing peoplequotp phis press secretary time jen psaki legions democrats rushed defense saying biden referring socalled quotmisinformationquot spread platform quotdisinformation dozenquota hrefhttpswwwnprorg20210513996570855disinformationdozentestfacebookstwittersabilitytocurbvaccinehoaxessome 12 accountsa deemed responsible vast majority platforms vaccineskeptical content biden psaki administration frequently white house podiums bold inexact claims harm posed social media companies implicitly suggesting explicitly demanding companies change content moderation practices line administrations preferencesp pquotfacebook needs quickly remove harmful violative postsquot psaki hrefhttpswwwreuterscomworldusussurgeongeneralwarnsovercovid19misinformation20210715said afrom official perch adding quotyou shouldnt banned platform providing misinformationquot platform control decisions otherp pthis type government pressure quotbullying threatening cajolingquot attempts quotto sway decisions private platforms limit publication disfavored speechquot known emjawboningem subject hrefhttpswwwcatoorgpolicyanalysisjawboningagainstspeechnew reporta duffield policy analyst cato institute quotleft unchecked [jawboning] threatens normalized extraconstitutional method speech regulationquot morep blockquotepquotjawboning occurs government official threatens use powerbe power prosecute regulate legislateto compel actions state official jawboning dangerous allows government officials assume powers granted lawquotpblockquote pin summer 2021 example quotsurgeon general vivek murthy issued advisory health misinformation including guidelines platformsquot following psaki biden comments quoton advisory inoffensive statements members administration suggested sanctions noncompliant platformsquot writes duffieldp blockquotepquotwhite house communications director kate bedingfield completed jawboning effort emmorning joeem interview prompted question getting rid section 230 replied reviewing certainly held accountable think youve heard president speak aggressively gesturing changes intermediary liability protections social media platforms rely bedingfield added vague threat administrations demands p pby raising specter changes repeal section 230 biden administration roundabout threat repealing section 230 vaccine misinformation unlawful harm facebook exposing litigation users speech demanding removal misinformation threatening repeal administration sought bully facebook removing speech government couldnt touchquotpblockquote pduffield worked track prominent examples jawboning database found hrefhttpswwwcatoorgsitescatoorgfiles202209policyanalysis934annexpdfherea replete examples censorship attempts politicians parties quotnot demand paired threatquot writes quotall demands course discussions potential social media regulationquotp pquotin general know lot jawboning happens closed doorsquot duffield tellsemreasonem quotthere prior 2016 couple highprofile cases like wikileaksquot notes quotbut current era normalized platform jawboning begins 2016 electionquot highlights sen dianne feinsteins dcalif social media crackdown attempts purported russian disinformation 2017 possibility twitters decision limit circulation hunter biden laptop story company come fire trotted congress subsequently strengthened hacked materials policy quotif didnt turns foreign op changes course election theyre going right testifying congress hammered regulation finesquot noted disinformation researcher clint watts according cato reportp psome platforms broadly resistant government officials demands explicit implied cloudbased instant messaging service telegram duffield notes quotnotorious ignoring requests court ordersquot probably platform based reason comply laws platforms like facebook twitter telegram worth noting beating competitors like facebook messenger whatsapp eastern europe middle east including interestingly ukraine russiap pbut telegrams case sadly exception rule congressional staffers pressuring social media employees certain content moderation calls closed doors sitting senators asking tech ceos testify themand hrefhttpswwwpiratewirescompjackbenimblejackbequicksit prettya grandstanding hectoringquotit job congress oversee second guess direct decisions private intermediariesquot writes duffield quotsuch oversight presumes role speech regulation constitution specifically denies congressquotp pits section 230 changes liability protections members congress biden administration officials threaten companies quotwhile changes section 230 change platforms moderate speech antitrust harm dismember noncompliant firmquot says duffieldp pthis hrefhttpsreasoncom20220426twitterfacebooknetflixandthemythofpermanentplatformpowermay bea disturbing hrefhttpsreasoncom20210605thebipartisanantitrustcrusadeagainstbigtechbipartisan futurea jawboningp pthe post relnofollow hrefhttpsreasoncom20220914howgovernmentofficialsbullysocialmediacompaniesintocensorshiphow government officials bully social media companies censorshipa appeared relnofollow hrefhttpsreasoncomreasoncomap
|
63229cfcdb1c50ad52b28465
|
Biden touts funds for EV charging network: Will be as 'easy to find as gas stations'
|
ppresident biden on wednesday predicted a future in the us where electric vehicle ev charging stations are as easy to find as gas stations while announcing the first round of funding to build a national charging networkp
pthe great american road trip is going to be fully electrified biden said in remarks in detroit whether youre driving coast to coast along i10 or on i75 here in michigan charging stations will be up and easy to find as gas stations are nowp
pthe president announced the approval of the first 900 million in bipartisan infrastructure law funding to build ev chargers in 35 states which will span 53000 miles of national highway the investment is part of the 75 billion the law allocated to build charging stations across the usp
pit used to be to buy an electric car you had to make all sorts of compromises but not now biden said wednesday thanks to american ingenuity american engineers american auto workers thats all changingp
pthe president noted that drivers can now buy electric vehicles made in america that have a long range charge quickly and are fastp
pi believe we can own the future of the automobile market i believe we can own the future of manufacturing american manufacturing is back detroit is back americas back biden saidp
pbiden earlier on wednesday toured the detroit auto show and test drove an electric cadillac lyriq he was joined by michigan gov gretchen whitmer d sen debbie stabenow d and rep debbie dingell dp
|
ppresident biden wednesday predicted future electric vehicle ev charging stations easy find gas stations announcing round funding build national charging networkp pthe great american road trip going fully electrified biden said remarks detroit youre driving coast coast i10 i75 michigan charging stations easy find gas stations nowp pthe president announced approval 900 million bipartisan infrastructure law funding build ev chargers 35 states span 53000 miles national highway investment 75 billion law allocated build charging stations usp pit buy electric car sorts compromises biden said wednesday thanks american ingenuity american engineers american auto workers thats changingp pthe president noted drivers buy electric vehicles america long range charge quickly fastp pi believe future automobile market believe future manufacturing american manufacturing detroit americas biden saidp pbiden earlier wednesday toured detroit auto test drove electric cadillac lyriq joined michigan gov gretchen whitmer d sen debbie stabenow d rep debbie dingell dp
|
63229d3ddb1c50ad52b2846f
|
Building Back Ukraine Better
|
img altbuilding back ukraine better srchttpswwwamericanpurposecomcontentimages202209citybuildingjpgpin july the swiss town of lugano hosted dozens of highlevel officials from around the world at a conference dedicated to the postwar reconstruction of ukraine recovery is a massive task the conferences website a hrefhttpswwwurc2022comannounceda and poses challenges of a magnitude that cannot be precisely measured at this pointppthinking ahead and mobilizing resources for the period after the war is certainly praiseworthy future development assistance must not be not squandered or end up in the pockets of the selfseeking oligarchs who dominated ukraines economy before the warppif ukraines recent successes on the battlefield teach us anything it would be a mistake to think of the countrys postwar reconstruction as an exercise that can be debated and planned for independently of the war itself if anything countries worried about ukraines becoming a bottomless money pit for western taxpayers down the road must be generous with assistance now particularly military assistance one single factor above everything else will determine if ukraine becomes an economic success story or not whether or not it can decisively defeat the russian invaderppheres a prediction if ukrainians do build on the weekends victories and restore the countrys full sovereignty ukraines reconstruction will be quick and easyfar outpacing the imagination of most experts if they fail and some version of the territorial status quo degenerates through a ceasefire or through attrition into a frozen conflict no amount of western assistance whether financial or technical will make much of a difference___steady_paywall___ppthe reason is simple postwar reconstructions are primarily about politics not about finance or technocratic modalities of aid if postwar politics goes right all else will fall into place if it goes wrong everything else will go down the drain tooppthe postwar stories of japan and germany illustrate the point in 1956 japans per capita gdp was higher than in 1940 before the war by the time that marshall plan funding started flowing to germany and western europe in the late 1940s much of the continents infrastructure had already been repairedppduring the occupation period us financial assistance to japan a hrefhttpssgpfasorgcrsnatsecrl33331pdfworth 22a a little over 30 billion in todays dollars represented several percentage points of japans postwar gdpcomparable in relative size to say the eus funds flowing to new member countriesand primarily took the form of food assistance in the initial years that assistance was quickly tapered off in the 1950s the marshall plan was even smaller as a proportion of western european economiescertainly far too small to make a macroeconomic differenceppin both cases a hrefhttpswwwnberorgpapersw3899what mattered was the broader political packagea that the assistance was a part of which all together facilitated a new social contract that imposed itself through the fact of us victory in the war and which was conducive to democratic capitalism albeit with local characteristics by keeping dirigisme and sovietstyle planning at bay it set the scene for some of the most extraordinary episodes of economic growth in human history the trente glorieuses in europe and japans catchup growth that brought the economy to par with the leading industrialized nations of the westppto return to ukraine the success of its postwar reconstruction and the amount of aid it might require from western donors is not a question that can be tackled independently from the outcome of the current war if the conflict becomes a frozen one with large parts of ukraine under russian occupation the country will remain vulnerable to russian destabilization presumably there will be people moving back and forth and businesses that will want to operate both on ukraines occupied territories and in free ukraine those will represent a political challenge for the government in kyivmuch like similar constituencies do for moldova and georgia the allbutexplicit purpose of setting up such enclaves under russian control is to provide russia with a de facto veto over the politics of postsoviet countries it is hard to imagine either moldova or georgia joining the eu or nato while such territorial disputes linger on moreover the russiabacked separatists can always find ways to thwart the governments plans and extract concessionsoftentimes through the use of corruption or threatsppthe proeu government in chiinu for example continues to tread very lightly around transnistria not just because of the threat posed by russia but also because of the powerful economic interests that benefit from the status quo recently the government a hrefhttpstwittercompaulaerizanustatus1567067003436818433s20ts1jv3ylmffe0yfiweniffqreneweda a license for moldova steel works a highly polluting steel mill mostly processing scrap metal in rbnia transnistria which accounts for over half of the separatist regions manufacturing output and which is currently owned by the separatist authorities to avoid double taxation the company does not pay any taxes into the moldovan budgetppabkhazia and south ossetia may be more insulated from the georgian economy but the kremlin has found other levers over georgian politics the founder of the georgian dream party and the former prime minister bidzina ivanishvili a hrefhttpstransparencygeenpostrussianbusinessesbidzinaivanishviliandhisrelativesmaintainsa significant business interests in russiawhile also retaining substantial clout in georgian politicsphrpthe putative federalization of ukraine under the minsk agreements would have achieved the same outcomes through formal means the two peoples republics of luhansk and donetsk while under russian control would get a seat at the table in kyiv including in the verkhovna rada if the infamous deal were to have been implemented ukraine could have forgotten about eu and nato membershipbut more importantly it would have had to scrap enacting reforms to eradicate corruption and strengthen the rule of lawppyet as other russiasponsored separatist regions in moldova and georgia illustrate the existence of a formal framework is not a necessary condition for such regions to become festering wounds on the body politic should the ongoing war in ukraine result in anything other than a complete expulsion of russia from the territories it occupies it is almost guaranteed that the resulting dynamics would press against kyivs efforts to get ukraines social contract rightppimagine in contrast if russian military efforts collapse completely and ukraine retakes its territory perhaps except for crimea not only would the kremlin be dramatically humiliated but the opportunities for russian interference into the political life of a victorious selfconfident ukraine would be drastically reducedpdiv
span datapullquoteif the kremlin keeps its tentacles inside of ukraine western money will not change ukraines grim political and economic prospectsspan
divpthat does not mean that all of ukraines problems would vanish iraq and afghanistan provide examples of when an overwhelming military victory by the united states did not feed into a straightforward process of reconstruction and reform the main reason there arguably was the lack of a genuine buyin among the local population and elitesa nonexistent problem in ukraine where the local population and increasingly also its economic elites have stood united in their embrace of deeper ties to the european union and to the westppgetting the russian military threatand the russian economyout of the picture as much as possible is a necessary condition for progress within ukraine including on questions of the independence of its judiciary or domestic crony capitalism involving ukrainian oligarchs with ties to the ukrainian government one ought not to underestimate the geopolitical ramifications of a disastrous russian defeat in ukraine which could present the west and prodemocracy promarket reformers across the postsoviet space with opportunities similar to the end of the cold warppin short the rate of return on military assistance emnow emexceeds by several orders of magnitude the rate of return western donors can ever expect to receive on their aid once the war is over if ukrainians win this war they will eventually be able to borrow internationally at tolerable rates possibly even making future aid superfluous if the conflict freezes and the kremlin keeps its tentacles inside of ukraine western money to repair roads bridges and hospitals will not change ukraines grim political and economic prospects it is past time western governments set their priorities accordinglyppema hrefhttpswwwamericanpurposecomauthorsdaliborrohacdalibor rohaca is a senior fellow at the american enterprise institute and a contributing editor at the american purpose twitter daliborrohacemp
|
img altbuilding ukraine better srchttpswwwamericanpurposecomcontentimages202209citybuildingjpgpin july swiss town lugano hosted dozens highlevel officials world conference dedicated postwar reconstruction ukraine recovery massive task conferences website hrefhttpswwwurc2022comannounceda poses challenges magnitude precisely measured pointppthinking ahead mobilizing resources period war certainly praiseworthy future development assistance squandered end pockets selfseeking oligarchs dominated ukraines economy warppif ukraines recent successes battlefield teach mistake think countrys postwar reconstruction exercise debated planned independently war countries worried ukraines bottomless money pit western taxpayers road generous assistance particularly military assistance single factor determine ukraine economic success story decisively defeat russian invaderppheres prediction ukrainians build weekends victories restore countrys sovereignty ukraines reconstruction quick easyfar outpacing imagination experts fail version territorial status quo degenerates ceasefire attrition frozen conflict western assistance financial technical difference___steady_paywall___ppthe reason simple postwar reconstructions primarily politics finance technocratic modalities aid postwar politics goes right fall place goes wrong drain tooppthe postwar stories japan germany illustrate point 1956 japans capita gdp higher 1940 war time marshall plan funding started flowing germany western europe late 1940s continents infrastructure repairedppduring occupation period financial assistance japan hrefhttpssgpfasorgcrsnatsecrl33331pdfworth 22a little 30 billion todays dollars represented percentage points japans postwar gdpcomparable relative size eus funds flowing new member countriesand primarily took form food assistance initial years assistance quickly tapered 1950s marshall plan smaller proportion western european economiescertainly far small macroeconomic differenceppin cases hrefhttpswwwnberorgpapersw3899what mattered broader political packagea assistance facilitated new social contract imposed fact victory war conducive democratic capitalism albeit local characteristics keeping dirigisme sovietstyle planning bay set scene extraordinary episodes economic growth human history trente glorieuses europe japans catchup growth brought economy par leading industrialized nations westppto return ukraine success postwar reconstruction aid require western donors question tackled independently outcome current war conflict frozen large parts ukraine russian occupation country remain vulnerable russian destabilization presumably people moving forth businesses want operate ukraines occupied territories free ukraine represent political challenge government kyivmuch like similar constituencies moldova georgia allbutexplicit purpose setting enclaves russian control provide russia de facto veto politics postsoviet countries hard imagine moldova georgia joining eu nato territorial disputes linger russiabacked separatists find ways thwart governments plans extract concessionsoftentimes use corruption threatsppthe proeu government chiinu example continues tread lightly transnistria threat posed russia powerful economic interests benefit status quo recently government hrefhttpstwittercompaulaerizanustatus1567067003436818433s20ts1jv3ylmffe0yfiweniffqreneweda license moldova steel works highly polluting steel mill processing scrap metal rbnia transnistria accounts half separatist regions manufacturing output currently owned separatist authorities avoid double taxation company pay taxes moldovan budgetppabkhazia south ossetia insulated georgian economy kremlin found levers georgian politics founder georgian dream party prime minister bidzina ivanishvili hrefhttpstransparencygeenpostrussianbusinessesbidzinaivanishviliandhisrelativesmaintainsa significant business interests russiawhile retaining substantial clout georgian politicsphrpthe putative federalization ukraine minsk agreements achieved outcomes formal means peoples republics luhansk donetsk russian control seat table kyiv including verkhovna rada infamous deal implemented ukraine forgotten eu nato membershipbut importantly scrap enacting reforms eradicate corruption strengthen rule lawppyet russiasponsored separatist regions moldova georgia illustrate existence formal framework necessary condition regions festering wounds body politic ongoing war ukraine result complete expulsion russia territories occupies guaranteed resulting dynamics press kyivs efforts ukraines social contract rightppimagine contrast russian military efforts collapse completely ukraine retakes territory crimea kremlin dramatically humiliated opportunities russian interference political life victorious selfconfident ukraine drastically reducedpdiv span datapullquoteif kremlin keeps tentacles inside ukraine western money change ukraines grim political economic prospectsspan divpthat mean ukraines problems vanish iraq afghanistan provide examples overwhelming military victory united states feed straightforward process reconstruction reform main reason arguably lack genuine buyin local population elitesa nonexistent problem ukraine local population increasingly economic elites stood united embrace deeper ties european union westppgetting russian military threatand russian economyout picture possible necessary condition progress ukraine including questions independence judiciary domestic crony capitalism involving ukrainian oligarchs ties ukrainian government ought underestimate geopolitical ramifications disastrous russian defeat ukraine present west prodemocracy promarket reformers postsoviet space opportunities similar end cold warppin short rate return military assistance emnow emexceeds orders magnitude rate return western donors expect receive aid war ukrainians win war eventually able borrow internationally tolerable rates possibly making future aid superfluous conflict freezes kremlin keeps tentacles inside ukraine western money repair roads bridges hospitals change ukraines grim political economic prospects past time western governments set priorities accordinglyppema hrefhttpswwwamericanpurposecomauthorsdaliborrohacdalibor rohaca senior fellow american enterprise institute contributing editor american purpose twitter daliborrohacemp
|
63229d52db1c50ad52b28473
|
Incarcerated Children in Texas Left Without Bathroom Access for 22 Hours
|
div
picture
source sizesminwidth 600px 331px 100vw typeimagewebp srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202207kidsjailjpgwebp 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202207kidsjail1200x675jpgwebp 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202207kidsjail800x450jpgwebp 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202207kidsjail600x338jpgwebp 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202207kidsjail331x186jpgwebp 331w
source sizesminwidth 600px 331px 100vw typeimagejpeg srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202207kidsjailjpg 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202207kidsjail1200x675jpg 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202207kidsjail800x450jpg 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202207kidsjail600x338jpg 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202207kidsjail331x186jpg 331w
img width1200 altsilhouette of a child behind a chain link fence srchttpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202207kidsjail800x450jpg height675
picture
div
pspanthis past may june and july childrenspan a hrefhttpswwwtexastribuneorg20220912texasjuvenileprisonscrisisspandetainedspanaspan in several texas juvenile prisons were denied regular access to toilets forced to urinate into empty water bottles and defecate on pieces of paper on the floor according tospan a hrefhttpswwwtexastribuneorg20220912texasjuvenileprisonscrisisispanthe texas tribunespania spanunable to keep the required childtostaff ratio staff at two texas juvenile lockups kept children in their cells without access to bathrooms from 430 pm to 800 am on weekdays and up to 22 hours a day on weekendsspanp
pa hrefhttpswwwtexastribuneorg20220912texasjuvenileprisonscrisisspanaccordingspanaspan to the spanispantribunespanispan at giddings state schoolspan spanquotthe children had no choice but to use water bottles milk cartons lunch trays or pieces of paper as makeshift toiletsquot during the longest periods of isolation spanp
pspanquotduring the july visit the ombudsman asked youth in all dorms whether this problem had improved all youth stated the issue was the same or worsequot state inspectorsspan a hrefhttpsstatictexastribuneorgmediafilesa05142b532313d993556c5d1994d8460giddingsjune22ombudsmanreportpdf_ga2225929171874298934166307773320894988371661364310spanwrotespanaspan quotmany said they still urinated in their water bottles or milk cartons and three said they defecated inside their room one in a lunch tray one in a plastic bag and one on a piece of paper multiple youth said they had submitted grievances but nothing had changedquotspanp
pspaninspectors for the texas juvenile justice system spana hrefhttpsstatictexastribuneorgmediafilesa05142b532313d993556c5d1994d8460giddingsjune22ombudsmanreportpdf_ga2225929171874298934166307773320894988371661364310spandocumentedspana the accounts of incarcerated kidsspan spanspanquotone said he would never forget having to defecate in his room another said even animals are let out to use the bathroom a third said this is inhumanequot spanp
pspana similar situation appears to have occurred at another youth prison in north texas called the gainesville state school where juveniles reported that facility staff had given them cups to use as toilets per the emtribuneems reportingspanp
pspanthe children imprisoned at giddings state school and gainesville state school often have severe mental health problems hourslong lockdowns during which children are denied access to basic hygiene only exacerbate thisspanp
pspanstaffing shortages make monitoring severely mentally ill children difficult according to the spanispantribunespanispan nearly half of the youth in the states prison system have been placed on suicide watch this year one mother of a kid currentlystrong strongincarcerated at giddings state schoolspan a hrefhttpswwwtexastribuneorg20220803texasjuvenileprisonmothersonspantoldspanaspan the spanispantribunespanispan that hspanspaner sonspan spanquotwas able to cut himself because he wasnt being properly monitored but the investigation was closed with no further action takenquotspanp
pspanquot[kids] are selfharming because the mobile teams may take an hour to get there and they have to go to the bathroom they are selfharming because they get to go to the clinic and the infirmary to have contactquot shandra carter the texas juvenile justice departments interim executive directorspan a hrefhttpswwwtexastribuneorg20220803texasjuvenileprisonmothersonspansaidspanaspan during a june board meeting understaffing quotcould cause a significantly impaired ability to intervene in the increasing suicidal behaviors already occurring by youth struggling with the isolative impact of operational room confinementquotspanp
pspanif a parent denies their child access to bathrooms for 22 hours a day such actions are rightfully considered child abuse and perhaps even grounds for the state to protect the child by removing them from their parents care when those a hrefhttpsreasoncom20121129thetownwherefartingcanlandakidinchildrena are a hrefhttpsreasoncom20140524ohiotodramaticallyreducesolitaryconimprisoneda apparently state actors are free to deny young people in their custody even the most basic a hrefhttpsreasoncom20210920rikersislandoffersaglimpseofamericashellholeprisonshygienea with little recourse spanp
pthe post a relnofollow hrefhttpsreasoncom20220914incarceratedchildrenintexasleftwithoutbathroomaccessfor22hoursincarcerated children in texas left without bathroom access for 22 hoursa appeared first on a relnofollow hrefhttpsreasoncomreasoncomap
|
div picture source sizesminwidth 600px 331px 100vw typeimagewebp srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202207kidsjailjpgwebp 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202207kidsjail1200x675jpgwebp 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202207kidsjail800x450jpgwebp 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202207kidsjail600x338jpgwebp 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202207kidsjail331x186jpgwebp 331w source sizesminwidth 600px 331px 100vw typeimagejpeg srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202207kidsjailjpg 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202207kidsjail1200x675jpg 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202207kidsjail800x450jpg 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202207kidsjail600x338jpg 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202207kidsjail331x186jpg 331w img width1200 altsilhouette child chain link fence srchttpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202207kidsjail800x450jpg height675 picture div pspanthis past june july childrenspan hrefhttpswwwtexastribuneorg20220912texasjuvenileprisonscrisisspandetainedspanaspan texas juvenile prisons denied regular access toilets forced urinate water bottles defecate pieces paper floor according tospan hrefhttpswwwtexastribuneorg20220912texasjuvenileprisonscrisisispanthe texas tribunespania spanunable required childtostaff ratio staff texas juvenile lockups kept children cells access bathrooms 430 pm 800 weekdays 22 hours day weekendsspanp pa hrefhttpswwwtexastribuneorg20220912texasjuvenileprisonscrisisspanaccordingspanaspan spanispantribunespanispan giddings state schoolspanspanquotthe children choice use water bottles milk cartons lunch trays pieces paper makeshift toiletsquot longest periods isolationspanp pspanquotduring july visit ombudsman asked youth dorms problem improved youth stated issue worsequot state inspectorsspan hrefhttpsstatictexastribuneorgmediafilesa05142b532313d993556c5d1994d8460giddingsjune22ombudsmanreportpdf_ga2225929171874298934166307773320894988371661364310spanwrotespanaspan quotmany said urinated water bottles milk cartons said defecated inside room lunch tray plastic bag piece paper multiple youth said submitted grievances changedquotspanp pspaninspectors texas juvenile justice system spana hrefhttpsstatictexastribuneorgmediafilesa05142b532313d993556c5d1994d8460giddingsjune22ombudsmanreportpdf_ga2225929171874298934166307773320894988371661364310spandocumentedspana accounts incarcerated kidsspan spanspanquotone said forget having defecate room said animals let use bathroom said inhumanequot spanp pspana similar situation appears occurred youth prison north texas called gainesville state school juveniles reported facility staff given cups use toilets theemtribuneems reportingspanp pspanthe children imprisoned giddings state school gainesville state school severe mental health problems hourslong lockdowns children denied access basic hygiene exacerbate thisspanp pspanstaffing shortages monitoring severely mentally ill children difficult according spanispantribunespanispan nearly half youth states prison system placed suicide watch year mother kid currentlystrongstrongincarcerated giddings state schoolspana hrefhttpswwwtexastribuneorg20220803texasjuvenileprisonmothersonspantoldspanaspan spanispantribunespanispan hspanspaner sonspan spanquotwas able cut wasnt properly monitored investigation closed action takenquotspanp pspanquot[kids] selfharming mobile teams hour bathroom selfharming clinic infirmary contactquot shandra carter texas juvenile justice departments interim executive directorspan hrefhttpswwwtexastribuneorg20220803texasjuvenileprisonmothersonspansaidspanaspan june board meeting understaffing quotcould cause significantly impaired ability intervene increasing suicidal behaviors occurring youth struggling isolative impact operational room confinementquotspanp pspanif parent denies child access bathrooms 22 hours day actions rightfully considered child abuse grounds state protect child removing parents care hrefhttpsreasoncom20121129thetownwherefartingcanlandakidinchildrena hrefhttpsreasoncom20140524ohiotodramaticallyreducesolitaryconimprisoneda apparently state actors free deny young people custody basic hrefhttpsreasoncom20210920rikersislandoffersaglimpseofamericashellholeprisonshygienea little recoursespanp pthe post relnofollow hrefhttpsreasoncom20220914incarceratedchildrenintexasleftwithoutbathroomaccessfor22hoursincarcerated children texas left bathroom access 22 hoursa appeared relnofollow hrefhttpsreasoncomreasoncomap
|
63229d98db1c50ad52b28479
|
As Inflation Soars, Biden Hosts Cringey Concert Celebrating the Inflation Reduction Act
|
div
picture
source sizesminwidth 600px 331px 100vw typeimagewebp srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202209upiphotostwo8816832400x1350jpgwebp 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202209upiphotostwo881683scalede16631627032371200x675jpgwebp 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202209upiphotostwo881683scalede1663162703237800x450jpgwebp 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202209upiphotostwo881683scalede1663162703237600x338jpgwebp 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202209upiphotostwo881683scalede1663162703237331x186jpgwebp 331w
source sizesminwidth 600px 331px 100vw typeimagejpeg srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202209upiphotostwo8816832400x1350jpg 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202209upiphotostwo881683scalede16631627032371200x675jpg 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202209upiphotostwo881683scalede1663162703237800x450jpg 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202209upiphotostwo881683scalede1663162703237600x338jpg 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202209upiphotostwo881683scalede1663162703237331x186jpg 331w
img width1200 altjames taylor white house inflation reduction act inflation report consumer price index dow jones stock market prices srchttpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202209upiphotostwo881683scalede1663162703237800x450jpg height675
picture
div
pthere was a party at the white house on tuesdayp
pfolk singer james taylor a hrefhttpswwwcspanorgvideo5228361presidentbidencelebratespassageinflationreductionactwas on handa to entertain a crowd of hundreds gathered on the south lawn the crowd included union leaders a hrefhttpstwittercomrweingartenstatus1569807964214534144like randi weingartena executive branch officials and prominent democratic a hrefhttpstwittercomgovmlgstatus1569829665292042240elected officialsa that a hrefhttpsdeadlinecom202209joebideninflationreductionact1235118165according to emdeadlineema the white house had invited from quotfar and widequotat least as far away as k streetp
pquotthis achievement is a testament to our unity our optimism our persistence along with the tireless efforts of a devoted staffquot a hrefhttpswwwspeakergovnewsroom913223saida speaker of the house nancy pelosi dcalif during her turn at the podium quotmr president thank you for unifying and inspiring a vision of a stronger fairer safer future for allquot she added quotyour extraordinary leadership has made this glorious day possiblequotp
pquotthats an applause linequot pelosi paused awkwardly to remind the assembled crowd which a hrefhttpstwittercomdisclosetvstatus1569773204691886084dutifully compliedap
pmeanwhile in the real world no one was applauding tuesday afternoon looked anything but gloriousp
pan ugly consumer price index report released earlier in the day by the department of labor showed that a hrefhttpsreasoncom20220913risinggrocerypricespushedannualinflationto83percentinaugustinflation was still untameda and it sent the markets into a spiral the dow jones industrial average a hrefhttpswwwcnbccom20220912stockfuturesarehigheraswallstreetawaitskeyinflationreporthtmlfell by 1200 pointsa or nearly 4 percent the sampp 500 tumbled by 43 percent and the techheavy nasdaq composite took the worst beating of all falling by 52 percent overall it was the a hrefhttpswwwwsjcomarticlesglobalstocksmarketsdowupdate0913202211663065625worst day for the stock market since june 2020a a painful reminder that americans are stealing dealing with the twin scourges of rising prices and falling investment returns we are a hrefhttpsreasoncom20220913latestinflationnumbersshowthatrentistoodamnhighpaying morea and getting lessp
pbut at least the politicians had a nice partyp
pthe white house probably couldnt have picked a worse day to celebrate the passage of the inflation reduction act despite its name the bill is a hrefhttpsreasoncomvideo20220818theinflationreductionactbarelyputsadentinthedeficitmostlya a package of democratic domestic tax and spending agenda items the biggest portion involves a series of subsidies for green energy whatever merits that might have its a hrefhttpsreasoncom20220808senatepasses740billioninflationreductionactthatwillprobablymakeinflationworsenot going to reduce inflationap
pthe only part of the bill that emdoesem address the countrys high and rising prices was a provision to use some new tax revenue a hrefhttpsreasoncom20220801theinflationreductionactwontactuallyreduceinflationto pay down about 300 billiona of the federal governments staggering budget deficit but thats already been wiped out as president joe bidens decision to forgive student loans for a hrefhttpswwwwhitehousegovbriefingroomstatementsreleases20220824factsheetpresidentbidenannouncesstudentloanreliefforborrowerswhoneeditmostan estimated 43 million peoplea will end up a hrefhttpswwwcrfborgblogscancellingstudentdebtwouldundermineinflationreductionactadding even more to the deficitap
pthe hard truth is that there isnt much that politicians can do to bring inflation under control because it is a phenomenon of monetary policy reckless fiscal policy that demands heavy borrowing and printing cana hrefhttpsreasoncom20220408covidstimuluschecksworsenedinflationand hasaset off inflation but once the tiger is out of the cage there is little to be done except wait for higher interest rates to cool the economy federal reserve chairman jerome powell who is largely responsible for actually combating inflation has a hrefhttpswwwnytimescom20220826businesseconomyjeromepowellinflationhtmlindicateda that the fight wont be won quickly or easily the fed is a hrefhttpswwwreuterscommarketsusfedsetanother75basispointratehikeearlypivotunlikely20220913expecteda to raise interest rates again next weekp
pall we can ask of politicians is that they a hrefhttpsreasoncom20210415therealinflationriskispoliticalstop making the situation worsea by spending even more money and that they stop celebrating the mess theyve made while average americans struggle to pay for a hrefhttpsreasoncom20220912marcorubiowantstomakeyourgroceriesmoreexpensivegroceriesap
pon tuesday democrats failed on both counts the only purpose the south lawn party servedbesides calling to mind george w bushs quota hrefhttpsreasoncom20060501missionaccomplishedatyeartmission accomplishedaquot speech and that time john kerry trotted out taylor to sing quotyouve got a friendquot a hrefhttpsreasoncom20150116johnkerryhasjamestaylorsingyouvegto the victims of a terrorist attackawas confirming how hopelessly out of touch these elected leaders and their friends arep
pcredit cnns alisyn camerota for having the best reaction to what was unfolding as she pivoted the networks coverage from the white house party to the bad news coming from wall street camerota a hrefhttpstwittercomscottsloofmanstatus1569779040512315394saida what we all were thinking quotfeels like its hard to be celebratoryquotp
pbut thats only true if you live in realityp
pthe post a relnofollow hrefhttpsreasoncom20220914asinflationsoarsbidenhostscringeyconcertcelebratingtheinflationreductionactas inflation soars biden hosts cringey concert celebrating the inflation reduction acta appeared first on a relnofollow hrefhttpsreasoncomreasoncomap
|
div picture source sizesminwidth 600px 331px 100vw typeimagewebp srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202209upiphotostwo8816832400x1350jpgwebp 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202209upiphotostwo881683scalede16631627032371200x675jpgwebp 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202209upiphotostwo881683scalede1663162703237800x450jpgwebp 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202209upiphotostwo881683scalede1663162703237600x338jpgwebp 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202209upiphotostwo881683scalede1663162703237331x186jpgwebp 331w source sizesminwidth 600px 331px 100vw typeimagejpeg srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202209upiphotostwo8816832400x1350jpg 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202209upiphotostwo881683scalede16631627032371200x675jpg 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202209upiphotostwo881683scalede1663162703237800x450jpg 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202209upiphotostwo881683scalede1663162703237600x338jpg 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202209upiphotostwo881683scalede1663162703237331x186jpg 331w img width1200 altjames taylor white house inflation reduction act inflation report consumer price index dow jones stock market prices srchttpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202209upiphotostwo881683scalede1663162703237800x450jpg height675 picture div pthere party white house tuesdayp pfolk singer james taylor hrefhttpswwwcspanorgvideo5228361presidentbidencelebratespassageinflationreductionactwas handa entertain crowd hundreds gathered south lawn crowd included union leaders hrefhttpstwittercomrweingartenstatus1569807964214534144like randi weingartena executive branch officials prominent democratic hrefhttpstwittercomgovmlgstatus1569829665292042240elected officialsa hrefhttpsdeadlinecom202209joebideninflationreductionact1235118165according toemdeadlineema white house invited quotfar widequotat far away k streetp pquotthis achievement testament unity optimism persistence tireless efforts devoted staffquot hrefhttpswwwspeakergovnewsroom913223saida speaker house nancy pelosi dcalif turn podium quotmr president thank unifying inspiring vision stronger fairer safer future allquot added quotyour extraordinary leadership glorious day possiblequotp pquotthats applause linequot pelosi paused awkwardly remind assembled crowd hrefhttpstwittercomdisclosetvstatus1569773204691886084dutifully compliedap pmeanwhile real world applauding tuesday afternoon looked gloriousp pan ugly consumer price index report released earlier day department labor showed hrefhttpsreasoncom20220913risinggrocerypricespushedannualinflationto83percentinaugustinflation untameda sent markets spiral dow jones industrial average hrefhttpswwwcnbccom20220912stockfuturesarehigheraswallstreetawaitskeyinflationreporthtmlfell 1200 pointsa nearly 4 percent sampp 500 tumbled 43 percent techheavy nasdaq composite took worst beating falling 52 percent overall hrefhttpswwwwsjcomarticlesglobalstocksmarketsdowupdate0913202211663065625worst day stock market june 2020a painful reminder americans stealing dealing twin scourges rising prices falling investment returns hrefhttpsreasoncom20220913latestinflationnumbersshowthatrentistoodamnhighpaying morea getting lessp pbut politicians nice partyp pthe white house probably couldnt picked worse day celebrate passage inflation reduction act despite bill hrefhttpsreasoncomvideo20220818theinflationreductionactbarelyputsadentinthedeficitmostlya package democratic domestic tax spending agenda items biggest portion involves series subsidies green energy merits hrefhttpsreasoncom20220808senatepasses740billioninflationreductionactthatwillprobablymakeinflationworsenot going reduce inflationap pthe bill thatemdoesem address countrys high rising prices provision use new tax revenue hrefhttpsreasoncom20220801theinflationreductionactwontactuallyreduceinflationto pay 300 billiona federal governments staggering budget deficit thats wiped president joe bidens decision forgive student loansfor hrefhttpswwwwhitehousegovbriefingroomstatementsreleases20220824factsheetpresidentbidenannouncesstudentloanreliefforborrowerswhoneeditmostan estimated 43 million peopleawill end hrefhttpswwwcrfborgblogscancellingstudentdebtwouldundermineinflationreductionactadding deficitap pthe hard truth isnt politicians bring inflation control phenomenon monetary policy reckless fiscal policy demands heavy borrowing printing cana hrefhttpsreasoncom20220408covidstimuluschecksworsenedinflationand hasaset inflation tiger cage little wait higher interest rates cool economy federal reserve chairman jerome powell largely responsible actually combating inflation hrefhttpswwwnytimescom20220826businesseconomyjeromepowellinflationhtmlindicateda fight wont won quickly easily fed hrefhttpswwwreuterscommarketsusfedsetanother75basispointratehikeearlypivotunlikely20220913expecteda raise interest rates weekp pall ask politicians hrefhttpsreasoncom20210415therealinflationriskispoliticalstop making situation worsea spending money stop celebrating mess theyve average americans struggle pay hrefhttpsreasoncom20220912marcorubiowantstomakeyourgroceriesmoreexpensivegroceriesap pon tuesday democrats failed counts purpose south lawn party servedbesides calling mind george w bushs quota hrefhttpsreasoncom20060501missionaccomplishedatyeartmission accomplishedaquot speech time john kerry trotted taylor sing quotyouve got friendquot hrefhttpsreasoncom20150116johnkerryhasjamestaylorsingyouvegto victims terrorist attackawas confirming hopelessly touch elected leaders friends arep pcredit cnns alisyn camerota having best reaction unfolding pivoted networks coverage white house party bad news coming wall street camerota hrefhttpstwittercomscottsloofmanstatus1569779040512315394saida thinking quotfeels like hard celebratoryquotp pbut thats true live realityp pthe post relnofollow hrefhttpsreasoncom20220914asinflationsoarsbidenhostscringeyconcertcelebratingtheinflationreductionactas inflation soars biden hosts cringey concert celebrating inflation reduction acta appeared relnofollow hrefhttpsreasoncomreasoncomap
|
63279cfa604cc46cc89a76db
|
White House pushes for monkeypox funding as cases fall
|
pmonkeypox cases are declining in many areas of the country but the biden administration is warning that the virus still poses a danger and pushing for lawmakers to approve its multibilliondollar funding request to combat itp
pmore than 23000 infections have been confirmed in the us during the outbreak but the growth has slowed cases have dropped about 50 percent in the past month according to the centers for disease control and prevention cdc from an average of 440 cases a day on aug 16 to 170 cases a day on sept 14p
pwhite house officials are cheering the updates and taking credit for the progress made so farp
pquottheres no question that the work weve done to rapidly increase vaccine supply get people vaccinated [ramp] up the availability of testing and treatments and educate individuals on how they can protect themselves is making a tremendous difference the administrations strategy is workingquot bob fenton white house monkeypox response coordinator said during a recent press briefingp
pofficials are also preaching caution and warning that the virus remains a threat especially if the administration does not have enough funding to help end the outbreak p
pquotwe should note that we have made strong progress and were encouraged by the cases the case rate of rise decliningquot cdc director rochelle walensky said quotand yet we are keeping our the gas pedal heavily heavily downward pedal to the metal as we continue the vigilance herequotp
pthe white house requested 45 billion for monkeypox response in the upcoming government spending bill the funding would go towards increasing access to vaccinations testing treatment and operational support as well as helping to combat monkeypox globally p
pbut republicans have largely soured on providing any new money and want the administration to work with what it already hasp
pquotin my view adding additional funding in that area would make it a very heavy lift for myself and other republicansquot sen mitt romney rutah told reporters quottheres ample revenue thats been provided to the administration to be able to deal with medical emergencies of this naturequotp
plast week senate minority whip john thune rsd said republicans had quotzeroquot interest in providing additional fundingp
pquottheres plenty of money still swirling around from previous covid bills i mean four and a half billion for monkeypox thats a lot of money and not sure how theyre gonna spend it allquot thune said p
psenate health education labor and pensions committee help ranking member richard burr rnc told administration health officials during a recent hearing that the governments response to monkeypox has been plagued by ineptitude and more money wont solve the problems p
pit isnt a question of authority you have the authority it isnt a question of money you have been given astonishing amounts of moneyquot burr said its a question of leadership its a question of focus its a question of squashing the typical bureaucratic roadblocks arrogance and ineptitudequotp
punlike with covid19 the administration has not previously requested money for the monkeypox response the white house has been able to tap into its national stockpile of smallpox vaccines but officials said they are running out of money to replenish it p
pin addition federal officials said they cant just repurpose previously allocated covid19 funding for monkeypox because legislative language in previous supplemental spending bills restricts the use of funds to covid19related matters onlyp
pexperts and public health advocates stressed the importance of continuing to put resources into the monkeypox response even as case numbers fallp
pquoti think its too early to make any kind of true definitive statements on where we standquot said anne rimoin an epidemiologist at the university of california los angeles who has studied monkeypox for decadesp
pquotit appears that we havent learned anything controlling outbreaks epidemics and pandemics require a sustained effort over a lengthy period of timequot rimoin said quotif were truly going to understand what happened and how to continue to prevent the spread of this virus we have to put the resources in place to do soquotp
pdavid harvey executive director of the national coalition of std directors said sexual health clinics dont have enough money to continue treating patients without additional resourcesp
pquotwe have seen this song and dance before with woeful covid vaccination rates among minority communities leading to poorer outcomes and we cant afford to make the same mistake againquot harvey said in a statementp
pjen kates senior vice president and director of global health and hiv policy for the kaiser family foundation said the frustrating part of the monkeypox funding stalemate is that it wont take nearly as much of an investment as covid19 p
pquoti think part of the white house argument to congress and part of the public health argument is were in a window of opportunity here if we can get the response right and make sure we bring cases down and sustain thatquot kates said quotits not a long term investment needquotp
pduring the recent senate hearing with top administration officials sen patty murray dwash the help committee chairwoman questioned whether the government can be trusted to adequately prepare for the next outbreak given the initial missteps in responding to monkeypoxp
pstill she said the way to be sure the government is ready is to make sure they have the money they need to preparep
pi know im not the only one here with concerns about the monkeypox response but we cant just say this isnt working without providing the funding to end this outbreak and build the public health system americans deservequot murray saidp
|
pmonkeypox cases declining areas country biden administration warning virus poses danger pushing lawmakers approve itsmultibilliondollar funding request combat itp pmore 23000 infectionshave confirmedin usduring outbreak growthhas slowed cases dropped 50 percent past month according centers disease control prevention cdc average 440 cases day aug 16 170 cases day sept 14p pwhite house officials cheering updates taking credit progress farp pquottheres question work weve rapidly increase vaccine supply people vaccinated [ramp] availability testing treatments educate individuals protect making tremendous difference administrations strategy workingquot bob fenton white house monkeypox response coordinator said recent press briefingp pofficials preaching caution warning virus remains threat especially administration funding help end outbreakp pquotwe note strong progress encouraged cases case rate rise decliningquot cdc director rochelle walensky said quotand keeping gas pedal heavily heavily downward pedal metal continue vigilance herequotp pthe white house requested 45 billion monkeypox response upcoming government spending bill funding increasing access vaccinations testing treatment operational support helping combat monkeypox globallyp pbut republicans largely soured providing new money want administration work hasp pquotin view adding additional funding area heavy lift republicansquot sen mitt romney rutah told reporters quottheres ample revenue thats provided administration able deal medical emergencies naturequotp plast week senate minority whip john thune rsd said republicans quotzeroquot interest providing additional fundingp pquottheres plenty money swirling previous covid bills mean half billion monkeypox thats lot money sure theyre gonna spend allquot thune saidp psenate health education labor pensions committee help ranking member richard burr rnc told administration health officials recent hearing governments response monkeypox plagued ineptitude money wont solve problemsp pit isnt question authority authority isnt question money given astonishing amounts moneyquot burr said question leadership question focus question squashing typical bureaucratic roadblocks arrogance ineptitudequotp punlike covid19 administration previously requested money monkeypox response white house able tap national stockpile smallpox vaccines officials said running money replenish itp pin addition federal officials said cant repurpose previously allocated covid19 funding monkeypox legislative language previous supplemental spending bills restricts use funds covid19related matters onlyp pexperts public health advocates stressed importance continuing resources monkeypox response case numbers fallp pquoti think early kind true definitive statements standquot said anne rimoin epidemiologist university california los angeles studied monkeypox decadesp pquotit appears havent learned controlling outbreaks epidemics pandemics require sustained effort lengthy period timequot rimoin said quotif truly going understand happened continue prevent spread virus resources place soquotp pdavid harvey executive director national coalition std directors said sexual health clinics dont money continue treating patients additional resourcesp pquotwe seen song dance woeful covid vaccination rates minority communities leading poorer outcomes cant afford mistake againquot harvey said statementp pjen kates senior vice president director global health hiv policy kaiser family foundation said frustrating monkeypox funding stalemate wont nearly investment covid19p pquoti think white house argument congress public health argument window opportunity response right sure bring cases sustain thatquot kates said quotits long term investment needquotp pduring recent senate hearing administration officials sen patty murray dwash help committee chairwoman questioned government trusted adequately prepare outbreak given initial missteps responding monkeypoxp pstill said way sure government ready sure money need preparep pi know im concerns monkeypox response cant isnt working providing funding end outbreak build public health system americans deservequot murray saidp
|
63279d36604cc46cc89a76e3
|
The end of the museum
|
pthe post a relnofollow hrefhttpswwwspikedonlinecom20220918theendofthemuseumthe end of the museuma appeared first on a relnofollow hrefhttpswwwspikedonlinecomspikedap
|
pthe post relnofollow hrefhttpswwwspikedonlinecom20220918theendofthemuseumthe end museuma appeared relnofollow hrefhttpswwwspikedonlinecomspikedap
|
63279d3e604cc46cc89a76e5
|
Why Skills-Based Immigration Is the Best Option for America
|
a meticulous and groundbreaking book on immigration chronicles the history of upward mobility in the united statesbut falls short as an argument against a more selective policy
|
meticulous groundbreaking book immigration chronicles history upward mobility united statesbut falls short argument selective policy
|
63279d43604cc46cc89a76e7
|
*Magnificent Rebels*
|
pthe author is the excellent andrea wulf and the subtitle is a relnoopener hrefhttpswwwamazoncommagnificentrebelsfirstromanticsinventiondp0525657118reftmm_hrd_swatch_0_encodingutf8qid1663411760sr81 target_blankthe first romantics and the invention of the selfa the focus is on the german group of thinkers who worked together in or near jena including the schlegels novalis schiller goethe and schelling with a later cameo from hegel this is one of my favorite books of the year but note it focuses mostly on their personal stories and not so much on their ideas perfect for me but not the ideal introduction for every reader and their ideas are hard to explain their emphasis on imagination and subjectivity has been so absorbed into the modern world it can be hard to grasp their revolutionary nature at the time context is that which is scarce recommended nonethelessp
pthe post a relnofollow hrefhttpmarginalrevolutioncommarginalrevolution202209magnificentrebelshtmlmagnificent rebelsa appeared first on a relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap
|
pthe author excellent andrea wulf subtitle relnoopener hrefhttpswwwamazoncommagnificentrebelsfirstromanticsinventiondp0525657118reftmm_hrd_swatch_0_encodingutf8qid1663411760sr81 target_blankthe romantics invention selfa focus german group thinkers worked near jena including schlegels novalis schiller goethe schelling later cameo hegel favorite books year note focuses personal stories ideas perfect ideal introduction reader ideas hard explain emphasis imagination subjectivity absorbed modern world hard grasp revolutionary nature time context scarce recommended nonethelessp pthe post relnofollow hrefhttpmarginalrevolutioncommarginalrevolution202209magnificentrebelshtmlmagnificent rebelsa appeared relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap
|
63279d59604cc46cc89a76e9
|
Interview markets in everything
|
blockquotepsome job candidates are hiring proxies to sit in job interviews for them and even paying up to 150 an hour for onep
pin a a dataurie6b733e95abdc5dba9033be41e524e18 dataanalyticsmodulebody_link dataanalyticspostdepth40 hrefhttpswwwbusinessinsidercombaitswitchjobinterviewsunqualifiedapplicantspayingremotework20229ircrecent insider investigationa into the baitandswitch job interview thats becoming increasingly trendy one professional job interview proxy who uses a website to book clients and keeps a google driver folder of past video interviews said he a dataurie6b733e95abdc5dba9033be41e524e18 dataanalyticsmodulebody_link dataanalyticspostdepth60 hrefhttpswwwbusinessinsidercombaitswitchjobinterviewsunqualifiedapplicantspayingremotework20229irccharges clients 150a an hourp
pthe proxy was approached by aamil karimi who works at cybersecurity firm optiv as a principal intelligence analyst karimi who posed as a job seeker to talk to the proxy a dataurie6b733e95abdc5dba9033be41e524e18 dataanalyticsmodulebody_link dataanalyticspostdepth60 hrefhttpswwwbusinessinsidercombaitswitchjobinterviewsunqualifiedapplicantspayingremotework20229irctold insiders rob pricea that the baitandswitch trend has been on the rise because of more workfromhome jobs and overseas hiringp
pthe baitandswitch interview a dataurie6b733e95abdc5dba9033be41e524e18 dataanalyticsmodulebody_link dataanalyticspostdepth60 hrefhttpswwwbusinessinsidercombaitswitchjobinterviewsunqualifiedapplicantspayingremotework20229ircworks like thisa a job candidate hires someone else to pretend to be them in a job interview in hopes they will secure the job when the job starts the person who hired the proxy is the one to show up for workpblockquote
phere is a relnoopener hrefhttpswwwbusinessinsidercomprofessionalfakejobinterviewproxyschemecharge150hour20229utm_sourcefeedlyutm_mediumwebfeeds target_blankthe full storya let someone else say what your open browser tabs are for the pointer i thank the excellent a relnoopener hrefhttpstwittercomsamirvarma target_blanksamir varmaap
pthe post a relnofollow hrefhttpmarginalrevolutioncommarginalrevolution202209interviewmarketsineverythinghtmlinterview markets in everythinga appeared first on a relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap
|
blockquotepsome job candidates hiring proxies sit job interviews paying 150 hour onep pin aa dataurie6b733e95abdc5dba9033be41e524e18 dataanalyticsmodulebody_link dataanalyticspostdepth40 hrefhttpswwwbusinessinsidercombaitswitchjobinterviewsunqualifiedapplicantspayingremotework20229ircrecent insider investigationainto baitandswitch job interview thats increasingly trendy professional job interview proxy uses website book clients keeps google driver folder past video interviews said hea dataurie6b733e95abdc5dba9033be41e524e18 dataanalyticsmodulebody_link dataanalyticspostdepth60 hrefhttpswwwbusinessinsidercombaitswitchjobinterviewsunqualifiedapplicantspayingremotework20229irccharges clients 150aan hourp pthe proxy approached aamil karimi works cybersecurity firm optiv principal intelligence analyst karimi posed job seeker talk proxya dataurie6b733e95abdc5dba9033be41e524e18 dataanalyticsmodulebody_link dataanalyticspostdepth60 hrefhttpswwwbusinessinsidercombaitswitchjobinterviewsunqualifiedapplicantspayingremotework20229irctold insiders rob priceathat baitandswitch trend rise workfromhome jobs overseas hiringp pthe baitandswitch interviewa dataurie6b733e95abdc5dba9033be41e524e18 dataanalyticsmodulebody_link dataanalyticspostdepth60 hrefhttpswwwbusinessinsidercombaitswitchjobinterviewsunqualifiedapplicantspayingremotework20229ircworks like thisa job candidate hires pretend job interview hopes secure job job starts person hired proxy workpblockquote phere relnoopener hrefhttpswwwbusinessinsidercomprofessionalfakejobinterviewproxyschemecharge150hour20229utm_sourcefeedlyutm_mediumwebfeeds target_blankthe storya let open browser tabs pointer thank excellent relnoopener hrefhttpstwittercomsamirvarma target_blanksamir varmaap pthe post relnofollow hrefhttpmarginalrevolutioncommarginalrevolution202209interviewmarketsineverythinghtmlinterview markets everythinga appeared relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap
|
6328ee420742031abe57c187
|
Biden calls Puerto Rico governor amid Fiona devastation
|
ppresident biden on monday called the governor of puerto rico to discuss the federal response to the devastation seen so far from hurricane fionap
ppuerto rico has seen its power grid downed landslides unleashed and infrastructure including roads and bridges destroyed since the hurricane hit ground on the southwest coast on sundayp
pbiden and gov pedro pierluisi discussed the immediate needs of puerto rico on the call which took place aboard air force one while the president was on his way back from london following queen elizabeth iis funeralp
pthe president said there are more than 300 federal personnel on the ground in puerto rico already working to assist with response and recovery and in the coming days as damage assessments are conducted the number of support personnel will increase substantiallyp
pbiden on sunday declared a state of emergency in the territoryp
pthe president also acknowledged the extra devastation following hurricane maria in 2017 and the governor expressed his appreciation for the partnership and support from the administration so far the white house saidp
pthe president said that he will ensure that the federal team remains on the job to get it done especially given that puerto rico is still recovering from the damage of hurricane maria five years ago this week according to the white housep
pfederal emergency management agency fema administrator deanne criswell will travel to puerto rico on tuesday to meet with state and local officials and impacted citizens the white house announced she is expected to assess urgent needs that the president has directed fema to meetp
|
ppresident biden monday called governor puerto rico discuss federal response devastation seen far hurricane fionap ppuerto rico seen power grid downed landslides unleashed infrastructure including roads bridges destroyed hurricane hit ground southwest coast sundayp pbiden gov pedro pierluisi discussed immediate needs puerto rico took place aboard air force president way london following queen elizabeth iis funeralp pthe president said 300 federal personnel ground puerto rico working assist response recovery coming days damage assessments conducted number support personnel increase substantiallyp pbiden sunday declared state emergency territoryp pthe president acknowledged extra devastation following hurricane maria 2017 governor expressed appreciation partnership support administration far white house saidp pthe president said ensure federal team remains job especially given puerto rico recovering damage hurricane maria years ago week according white housep pfederal emergency management agency fema administrator deanne criswell travel puerto rico tuesday meet state local officials impacted citizens white house announced expected assess urgent needs president directed fema meetp
|
6328eefb0742031abe57c19b
|
Spending Down $12 Million in Pandemic Relief Money on an Immigration Stunt Isn't 'Responsible Fiscal Policy'
|
div
picture
source sizesminwidth 600px 331px 100vw typeimagewebp srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202209krtphotoslive920048e1663604395662jpgwebp 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202209krtphotoslive920048e16636043956621200x675jpgwebp 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202209krtphotoslive920048e1663604395662800x450jpgwebp 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202209krtphotoslive920048e1663604395662600x338jpgwebp 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202209krtphotoslive920048e1663604395662331x186jpgwebp 331w
source sizesminwidth 600px 331px 100vw typeimagejpeg srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202209krtphotoslive920048e1663604395662jpg 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202209krtphotoslive920048e16636043956621200x675jpg 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202209krtphotoslive920048e1663604395662800x450jpg 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202209krtphotoslive920048e1663604395662600x338jpg 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202209krtphotoslive920048e1663604395662331x186jpg 331w
img width1200 altflorida gov ron desantis gives a speech srchttpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202209krtphotoslive920048e1663604395662800x450jpg height675
picture
div
pspanafter florida gov ron desantis coordinated two flights last week to relocate dozens of migrants to marthas vineyard critics of the move have questioned how he financed the stuntspanp
pspanthough the payments have not been definitively linked to the marthas vineyard flights desantis republican administration paid an aviation company 615000 one week before spana hrefhttpsreasoncom20220916ifrondesantishatescommunismheshouldntweaponizevictimsofcommunismspanflyingspanaspan nearly 50 migrants to massachusetts on wednesday that would come to 12300 per head spana hrefhttpwwwtransparencyfloridagovsearchessearchvendors_warrantaspxfy23vid2910978be55150200liac108845fund1000stvertolidovid2910978scfspanpublic recordsspana spanindicate thatspanspan the department of transportation a hrefhttpswwwtampabaycomnewsfloridapolitics20220916desantisadministrationpaid615000aviationcompanyrelocateunauthorizedaliensmade the paymenta to vertol systems company inc which is spana hrefhttpswwwkgwcomarticlenewsinvestigationsoregonaviationcompanymigrants283294410d492604fd3aa0058e14795919bspanbasedspanaspan in oregon but has a location in the florida panhandle for a quotrelocation program of unauthorized aliensquotspanp
pspanthat relocation program is spana hrefhttpswwwflsenategovsessionbill20225001billtexterpdfspanfundedspanaspan by the states 20212022 appropriations which allocated 12000000 to implement quota program to facilitate the transport of unauthorized aliens from this state consistent with federal lawquot funds not spent in fiscal year 20212022 roll over to 20222023 to be used for the same purposespanp
pspanjudging by desantis recent comments that money is still being spent quotthe legislature gave me 12 millionquot desantis spana hrefhttpstwittercomaaronparseghianstatus1570841866714894336spansaidspanaspan at a news conference on friday quotwere going to spend every penny of that to make sure that were protecting the people of the state of floridaquotspanp
pspanaccording to the 20222023 spending bill the 12 million pot spana hrefhttpswwwflsenategovsessionbill20225001billtexterpdfspancomesspanaspan from quotthe interest earnings associated with the federal coronavirus state fiscal recovery fundquot part of the american rescue plana 19 trillion package passed last year against a hrefhttpsclerkhousegovvotes202172unanimousa spanspangopspan a hrefhttpswwwsenategovlegislativelisroll_call_votesvote1171vote_117_1_00110htmpositionspanoppositionspanaspanset aside about spana hrefhttpswwwwashingtonpostcombusiness20220916floridamigrantimmigrationstimulusaidspan350 billionspanaspan as relief cash for states and localities the federal government spana hrefhttpswwwwashingtonpostcombusiness20220916floridamigrantimmigrationstimulusaidspanattachedspanaspan few strings to how state and local governments spent the interest earned on those funds while they remained unspentspanp
pspanfloridas migrant relocation fund is a hrefhttpsreasoncom20210304thecovidreliefbillismostlyaexpensivebundleofpoliticallymotivatedgiveawaysby no meansa the spanspanfirstspan a hrefhttpsreasoncom20211203schooldistrictscovidreliefmoneyvapedetectorsspanexamplespanaspan of spana hrefhttpsreasoncom20220602governmentscovidrelieffundsemployeebonusesspanquestionably directedspanaspan covid19 a hrefhttpsreasoncom20220324dcspent25millioninpandemicrelieffundsonparkingcopsrelief moneya which was ostensibly doled out to cushion economic burdens imposed by the pandemic and the governments response to it nor is florida the first state to use covid relief money for immigration enforcement texas spana hrefhttpswwwwashingtonpostcombusiness20220916floridamigrantimmigrationstimulusaidspantappedspanaspan into a similar pandemic fund to support operation lone star a bordersecuring program that has proven a hrefhttpswwwhoustonchroniclecompoliticstexasarticlecostsfortwoyeartexasbordersecurityblitz17137328phpcostlya and a hrefhttpswwwhoustonchroniclecompoliticstexasarticlejusticedepartmentisinvestigatingtexas17287171phpcontroversialaspanp
pspancovid relevance aside are the marthas vineyard flights really quotprotecting the people of the state of floridaquot for one thing the spending bill provides money for the transportation of migrants quotfrom this statequotmeaning florida but last weeks flights spana hrefhttpswwwcnncom20220916usmarthasvineyardmigrantsfloridabudgetlanguageindexhtmlspanoriginatedspanaspan in san antonio texas desantis has defended the use of his states funds in this way by claiming florida officials have been working in texas quotspana hrefhttpswwwwashingtonpostcomimmigration20220916migrantsdesantismarthasvineyardspanfor monthsspanaspanquot to identify and divert individuals who were likely to eventually end up in floridaspanp
pspaneven so many of the immigration enforcement schemes embraced by desantis and other gop governors a hrefhttpsreasoncom20220623gregabbottspent1400aheadtobusmigrantstodcforapoliticalstuntcomea with spanspanheftyspan a hrefhttpsreasoncom20220622rondesantisimmigrationcrackdowncouldprovecostlyspanprice tagsspanaspan even if their spana hrefhttpsreasoncom20220415gregabbottscrewedovertruckdriversinamisguidedattempttoincreasebordersecurityspanresultsspanaspan are spana hrefhttpsreasoncom20210629gregabbottsborderwallplanisdoomedtofailspansketchyspanaspan floridas migrant transportation fund flies in the face of the fiscal responsibility desantis says he defends desantis himself criticized the american rescue plan that now funds the migrant relocation program spana hrefhttpswwwwcjbcom20210308govdesantistakesshotsattheamericanrescueplandesignedbasicallytobailoutthepoorlygovernedstatesspansayingspanaspan the package was quotdesigned basically to bail out the poorly governed statesquot when the governor signed the 20222023 state budget that funds the migrant relocation program he vetoed 31 billion in spending and laid out tax relief for floridians a hrefhttpswwwflgovcom20220602governorrondesantissignsthefreedomfirstbudgetprovidinghistoricinvestmentstosupportourcommunitiespromoteeducationandprotecttheenvironmenttoutinga his states quotresponsible fiscal policiesquot as he did sospanp
pspanmoral legal and economic concerns all linger as desantis spana hrefhttpswwwfox13newscomnewsfloridagovrondesantissaysmoremigrantflightstosanctuarystateslikelyspansaysspanaspan there will likely be more migrants bused and flown to blue cities since immigrants spana hrefhttpsiteporgundocumentedimmigrantsstatelocaltaxcontributions2017spancontributespanaspan significantly to public finances through taxes are less likely to spana hrefhttpswwwcatoorgblog14mostcommonargumentsagainstimmigrationwhytheyrewrongspanusespanaspan welfare than similarly situated nativeborn americans and are able to fill critical jobs a fiscally responsible governor would be wise to drop the costly enforcement stuntsspanp
pthe post a relnofollow hrefhttpsreasoncom20220919spendingdown12millioninpandemicreliefmoneyonanimmigrationstuntisntresponsiblefiscalpolicyspending down 12 million in pandemic relief money on an immigration stunt isnt responsible fiscal policya appeared first on a relnofollow hrefhttpsreasoncomreasoncomap
|
div picture source sizesminwidth 600px 331px 100vw typeimagewebp srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202209krtphotoslive920048e1663604395662jpgwebp 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202209krtphotoslive920048e16636043956621200x675jpgwebp 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202209krtphotoslive920048e1663604395662800x450jpgwebp 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202209krtphotoslive920048e1663604395662600x338jpgwebp 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202209krtphotoslive920048e1663604395662331x186jpgwebp 331w source sizesminwidth 600px 331px 100vw typeimagejpeg srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202209krtphotoslive920048e1663604395662jpg 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202209krtphotoslive920048e16636043956621200x675jpg 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202209krtphotoslive920048e1663604395662800x450jpg 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202209krtphotoslive920048e1663604395662600x338jpg 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202209krtphotoslive920048e1663604395662331x186jpg 331w img width1200 altflorida gov ron desantis gives speech srchttpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202209krtphotoslive920048e1663604395662800x450jpg height675 picture div pspanafter florida gov ron desantis coordinated flights week relocate dozens migrants marthas vineyard critics questioned hefinanced stuntspanp pspanthough payments definitively linked marthas vineyard flights desantisrepublican administration paid aviation company 615000 week spana hrefhttpsreasoncom20220916ifrondesantishatescommunismheshouldntweaponizevictimsofcommunismspanflyingspanaspan nearly 50 migrants massachusetts wednesday come 12300 head spana hrefhttpwwwtransparencyfloridagovsearchessearchvendors_warrantaspxfy23vid2910978be55150200liac108845fund1000stvertolidovid2910978scfspanpublic recordsspana spanindicate thatspanspanthe department transportation hrefhttpswwwtampabaycomnewsfloridapolitics20220916desantisadministrationpaid615000aviationcompanyrelocateunauthorizedaliensmade paymenta vertol systems company inc spana hrefhttpswwwkgwcomarticlenewsinvestigationsoregonaviationcompanymigrants283294410d492604fd3aa0058e14795919bspanbasedspanaspan oregon location florida panhandle quotrelocation program unauthorized aliensquotspanp pspanthat relocation program spana hrefhttpswwwflsenategovsessionbill20225001billtexterpdfspanfundedspanaspan states 20212022 appropriations allocated 12000000 implement quota program facilitate transport unauthorized aliens state consistent federal lawquot funds spent fiscal year 20212022 roll 20222023 purposespanp pspanjudging desantis recent comments money spent quotthe legislature gave 12 millionquot desantis spana hrefhttpstwittercomaaronparseghianstatus1570841866714894336spansaidspanaspan news conference friday quotwere going spend penny sure protecting people state floridaquotspanp pspanaccording 20222023 spending bill 12 million pot spana hrefhttpswwwflsenategovsessionbill20225001billtexterpdfspancomesspanaspan quotthe interest earnings associated federal coronavirus state fiscal recovery fundquot american rescue plana 19 trillion package passed year hrefhttpsclerkhousegovvotes202172unanimousa spanspangopspan hrefhttpswwwsenategovlegislativelisroll_call_votesvote1171vote_117_1_00110htmpositionspanoppositionspanaspanset aside spana hrefhttpswwwwashingtonpostcombusiness20220916floridamigrantimmigrationstimulusaidspan350 billionspanaspan relief cash states localities federal government spana hrefhttpswwwwashingtonpostcombusiness20220916floridamigrantimmigrationstimulusaidspanattachedspanaspan strings state local governments spent interest earned funds remained unspentspanp pspanfloridas migrant relocation fund hrefhttpsreasoncom20210304thecovidreliefbillismostlyaexpensivebundleofpoliticallymotivatedgiveawaysby meansa spanspanfirstspan hrefhttpsreasoncom20211203schooldistrictscovidreliefmoneyvapedetectorsspanexamplespanaspan spana hrefhttpsreasoncom20220602governmentscovidrelieffundsemployeebonusesspanquestionably directedspanaspancovid19 hrefhttpsreasoncom20220324dcspent25millioninpandemicrelieffundsonparkingcopsrelief moneya ostensibly doled cushion economic burdens imposed pandemic governments response florida state use covid relief money immigration enforcement texas spana hrefhttpswwwwashingtonpostcombusiness20220916floridamigrantimmigrationstimulusaidspantappedspanaspan similar pandemic fund support operation lone star bordersecuring program proven hrefhttpswwwhoustonchroniclecompoliticstexasarticlecostsfortwoyeartexasbordersecurityblitz17137328phpcostlya hrefhttpswwwhoustonchroniclecompoliticstexasarticlejusticedepartmentisinvestigatingtexas17287171phpcontroversialaspanp pspancovid relevance aside marthas vineyard flights quotprotecting people state floridaquot thing spending bill provides money transportation migrants quotfrom statequotmeaning florida weeks flights spana hrefhttpswwwcnncom20220916usmarthasvineyardmigrantsfloridabudgetlanguageindexhtmlspanoriginatedspanaspan san antonio texas desantis defended use states funds way claiming florida officials working texas quotspana hrefhttpswwwwashingtonpostcomimmigration20220916migrantsdesantismarthasvineyardspanfor monthsspanaspanquot identify divert individuals likely eventually end floridaspanp pspaneven immigration enforcement schemes embraced desantis gop governors hrefhttpsreasoncom20220623gregabbottspent1400aheadtobusmigrantstodcforapoliticalstuntcomea spanspanheftyspan hrefhttpsreasoncom20220622rondesantisimmigrationcrackdowncouldprovecostlyspanprice tagsspanaspan spana hrefhttpsreasoncom20220415gregabbottscrewedovertruckdriversinamisguidedattempttoincreasebordersecurityspanresultsspanaspan spana hrefhttpsreasoncom20210629gregabbottsborderwallplanisdoomedtofailspansketchyspanaspan floridas migrant transportation fund flies face fiscal responsibility desantis says defends desantis criticized american rescue plan funds migrant relocation program spana hrefhttpswwwwcjbcom20210308govdesantistakesshotsattheamericanrescueplandesignedbasicallytobailoutthepoorlygovernedstatesspansayingspanaspan package quotdesigned basically bail poorly governed statesquot governor signed 20222023 state budget funds migrant relocation program vetoed 31 billion spending laid tax relief floridians hrefhttpswwwflgovcom20220602governorrondesantissignsthefreedomfirstbudgetprovidinghistoricinvestmentstosupportourcommunitiespromoteeducationandprotecttheenvironmenttoutinga states quotresponsible fiscal policiesquot sospanp pspanmoral legal economic concerns linger desantis spana hrefhttpswwwfox13newscomnewsfloridagovrondesantissaysmoremigrantflightstosanctuarystateslikelyspansaysspanaspan likely migrants bused flown blue cities immigrants spana hrefhttpsiteporgundocumentedimmigrantsstatelocaltaxcontributions2017spancontributespanaspan significantly public finances taxes likely spana hrefhttpswwwcatoorgblog14mostcommonargumentsagainstimmigrationwhytheyrewrongspanusespanaspan welfare similarly situated nativeborn americans able fill critical jobs fiscally responsible governor wise drop costly enforcement stuntsspanp pthe post relnofollow hrefhttpsreasoncom20220919spendingdown12millioninpandemicreliefmoneyonanimmigrationstuntisntresponsiblefiscalpolicyspending 12 million pandemic relief money immigration stunt isnt responsible fiscal policya appeared relnofollow hrefhttpsreasoncomreasoncomap
|
6328ef1a0742031abe57c19f
|
Britain’s final farewell to Queen Elizabeth II
|
pthey came in buses to pay their respects presidents prime ministers soldiers and royalty shuffled into westminster abbey in central london to attend the funeral of queen elizabeth ii her coffin was carried through the great west door to the sounds of the burial sentencesem emand the tolling of the abbeys bellp
pthe dean of westminster called on the congregation to commend queen elizabeth to the care and keeping of almighty god this explicitly christian finale to the queens 70year reign was informed by the rites and passages of other royal funerals p
pthe speaker of the house commons lindsay hoyle has said the pageantry and ritual would constitute the most important event the world will ever see that seems unlikely but for many the events of recent days have been deeply felt p
pthe queens coffin lay in westminster hall for four days hundreds of thousands filed past to pay their respects many pausing to angle their heads perform the sign of the cross offer a namaste or salute some came with a symbol of their connection to the queen whether it was a clerical collar military medals or a girlguide neckerchief one heard the cry of babies occasional weeping and the clank of walking sticks many people would turn to look at the coffin one last time before they left the hall few among them walked out into new palace yard with their eyes dryp
pthese pilgrims had trudged for nearly five miles at its longest the queue was ten miles long with a waiting time of 24 hours every minute or so the queue would move forward the motion rippling down the line firemen handed out bottles of water an officious marshal chastised those taking photographs on the stairs near westminster bridgep
pqueuing intensified peoples emotion strangers became friends and there was a sense of camaraderie the experience made people more helpful and more willing to ask for help it was as good as a queue could be said stuart an accountant it was a relaxed peaceful way of coming here one vicar from wakefield told me to get off the train and go straight in wouldnt have felt the same p
pwe stood for six and a half hours for one day in our lives the royal family do this all the time said a woman called penny p
pnear parliament a statue of the queens grandfather george v watched over the queue will elizabeth now become a statue there are a relnoreferrer noopener nofollow hrefhttpswwwthetimescoukarticlequeenelizabethiistatuemayascendfourthplinthoftrafalgarsquaressswx0l2m target_blankplansa for her to replace the sculpture of whipped cream and cherry currently on the fourth plinth in trafalgar square but some argue this position wouldnt be sufficiently grand or what about an epithet elizabeth the great as boris johnson has recommended the good british path a relnoreferrer noopener nofollow hrefhttpswwwyoutubecomwatchvoh0jjcf4z6a target_blankproclaimeda her father george the good in 1952 but no one remembers george vi as such todayp
phowever her life is memorialised the queen has become a conduit for the personal grief many feel about their own relatives who have recently passed beside westminster hall one man i tried to speak to simply held up his hand and said i think id rather just let it sink in a woman mentioned the recent death of her mother and another said the queen was the enduring link with her own childhoodp
poutside westminster abbey 4000 military personnel formed a procession of more than a mile long to honour their commanderinchief as the service came to a close a group of nhs workers elevated to a kind of royalty during the covid19 pandemic joined the procession near the rear the crowds gathered to watch the last time that britain buried a monarch in 1952 hawkers sold small pieces of mirror to help those at the back see they held up these squares of glass in the same way people raised their smartphones today as the archbishop of canterbury justin welby said in his sermon jesus does not tell his disciples how to follow but who to follow and for many that was the queenp
|
pthey came buses pay respects presidents prime ministers soldiers royalty shuffled westminster abbey central london attend funeral queen elizabeth ii coffin carried great west door sounds burial sentencesememand tolling abbeys bellp pthe dean westminster called congregation commend queen elizabeth care keeping almighty god explicitly christian finale queens 70year reign informed rites passages royal funeralsp pthe speaker house commons lindsay hoyle said pageantry ritual constitute important event world unlikely events recent days deeply feltp pthe queens coffin lay westminster hall days hundreds thousands filed past pay respects pausing angle heads perform sign cross offer namaste salute came symbol connection queen clerical collar military medals girlguide neckerchief heard cry babies occasional weeping clank walking sticks people turn look coffin time left hall walked new palace yard eyes dryp pthese pilgrims trudged nearly miles longest queue miles long waiting time 24 hours minute queue forward motion rippling line firemen handed bottles water officious marshal chastised taking photographs stairs near westminster bridgep pqueuing intensified peoples emotion strangers friends sense camaraderie experience people helpful willing ask help good queue said stuart accountant relaxed peaceful way coming vicar wakefield told train straight wouldnt felt samep pwe stood half hours day lives royal family time said woman called pennyp pnear parliament statue queens grandfather george v watched queue elizabeth statue area relnoreferrer noopener nofollow hrefhttpswwwthetimescoukarticlequeenelizabethiistatuemayascendfourthplinthoftrafalgarsquaressswx0l2m target_blankplansafor replace sculpture whipped cream cherry currently fourth plinth trafalgar square argue position wouldnt sufficiently grand epithet elizabeth great boris johnson recommendedthe good british patha relnoreferrer noopener nofollow hrefhttpswwwyoutubecomwatchvoh0jjcf4z6a target_blankproclaimedaher father george good 1952 remembers george vi todayp phowever life memorialised queen conduit personal grief feel relatives recently passed westminster hall man tried speak simply held hand said think id let sink woman mentionedthe recent death mother said queen enduring link childhoodp poutside westminster abbey 4000 military personnel formed procession mile long honour commanderinchief service came close group nhs workers elevated kind royalty covid19 pandemic joined procession near rear crowds gathered watch time britain buried monarch 1952 hawkers sold small pieces mirror help held squares glass way people raised smartphones today archbishop canterbury justin welby said sermon jesus tell disciples follow follow queenp
|
6328ef250742031abe57c1a3
|
Critique and the Linguistic Transformation of Society
|
h4the new discourses podcast with james lindsay episode 93h4
predefine the words redefine the society thats the basic idea of critique and the way so much of marxist activism proceeds recently james lindsay explained this phenomenon in an a relnoopener hrefhttpsnewdiscoursescom202209threetermscommunistsredefinedtosubvertsociety datasaferedirecturlhttpswwwgooglecomurlqhttpsnewdiscoursescom202209threetermscommunistsredefinedtosubvertsocietyampsourcegmailampust1663683733312000ampusgaovvaw1vked2tt4g8rq_llstsksq target_blankessaya on new discourses with relation to three key terms that allow a subversion of society inclusion democracy and most concerningly citizenship in this episode of the new discourses podcast host james lindsay reads through and elaborates on his own essay on this topic join him to understand this important maneuverp
hr
pemsubscribe to the new discourses podcast on spanspana relnoopener noreferrer hrefhttpssoundcloudcomnewdiscourses target_blanksoundcloudaspanspan spanspana relnoopener noreferrer hrefhttpspodcastsapplecomuspodcastnewdiscoursesid1499880546 target_blankapple podcastsaspanspan spanspana relnoopener noreferrer hrefhttpspodcastsgooglecomfeedahr0cdovl2zlzwrzlnnvdw5ky2xvdwquy29tl3vzzxjzl3nvdw5ky2xvdwq6dxnlcnm6nzgxmte2mzi1l3nvdw5kcy5yc3m target_blankgoogle podcastsaspanspan spanspana relnoopener noreferrer hrefhttpsopenspotifycomshow0hfzdaxi5l4lnjqstfwgzpsikd5rtswgt1epiuyrixmlgw target_blankspotifyaspanspan spanspana relnoopener noreferrer hrefhttpswwwstitchercompodcastnewdiscourses target_blankstitcheraspanspana relnoopener noreferrer hrefhttpswwwstitchercompodcastnewdiscourses target_blanka spanspana relnoopener noreferrer hrefhttpswwwyoutubecomplaylistlistpl2hruftaprxcqcbydcaullid2d9exyny target_blankyoutubeaspanspan or by spanspana relnoopener noreferrer hrefhttpsfeedssoundcloudcomuserssoundcloudusers781116325soundsrss target_blankrssaspanspanemp
pemadditional episodes of the new discourses podcast are available spanspana relnoopener hrefhttpsnewdiscoursescomtagndpodcast target_blankhereaspanspanemp
pemfollow james lindsay spanspana relnoopener hrefhttpslinktreeconceptualjames target_blankhttpslinktreeconceptualjamesaspanspanemp
pthe post a relnofollow hrefhttpsnewdiscoursescom202209critiquelinguistictransformationsocietycritique and the linguistic transformation of societya appeared first on a relnofollow hrefhttpsnewdiscoursescomnew discoursesap
|
h4the new discourses podcast james lindsay episode 93h4 predefine words redefine society thats basic idea critique way marxist activism proceeds recently james lindsay explained phenomenon ana relnoopener hrefhttpsnewdiscoursescom202209threetermscommunistsredefinedtosubvertsociety datasaferedirecturlhttpswwwgooglecomurlqhttpsnewdiscoursescom202209threetermscommunistsredefinedtosubvertsocietyampsourcegmailampust1663683733312000ampusgaovvaw1vked2tt4g8rq_llstsksq target_blankessayaon new discourses relation key terms allow subversion society inclusion democracy concerningly citizenship episode new discourses podcast host james lindsay reads elaborates essay topic join understand important maneuverp hr pemsubscribe new discourses podcast spanspana relnoopener noreferrer hrefhttpssoundcloudcomnewdiscourses target_blanksoundcloudaspanspanspanspana relnoopener noreferrer hrefhttpspodcastsapplecomuspodcastnewdiscoursesid1499880546 target_blankapple podcastsaspanspanspanspana relnoopener noreferrer hrefhttpspodcastsgooglecomfeedahr0cdovl2zlzwrzlnnvdw5ky2xvdwquy29tl3vzzxjzl3nvdw5ky2xvdwq6dxnlcnm6nzgxmte2mzi1l3nvdw5kcy5yc3m target_blankgoogle podcastsaspanspanspanspana relnoopener noreferrer hrefhttpsopenspotifycomshow0hfzdaxi5l4lnjqstfwgzpsikd5rtswgt1epiuyrixmlgw target_blankspotifyaspanspanspanspana relnoopener noreferrer hrefhttpswwwstitchercompodcastnewdiscourses target_blankstitcheraspanspana relnoopener noreferrer hrefhttpswwwstitchercompodcastnewdiscourses target_blankaspanspana relnoopener noreferrer hrefhttpswwwyoutubecomplaylistlistpl2hruftaprxcqcbydcaullid2d9exyny target_blankyoutubeaspanspan byspanspana relnoopener noreferrer hrefhttpsfeedssoundcloudcomuserssoundcloudusers781116325soundsrss target_blankrssaspanspanemp pemadditional episodes new discourses podcast available spanspana relnoopener hrefhttpsnewdiscoursescomtagndpodcast target_blankhereaspanspanemp pemfollow james lindsayspanspana relnoopener hrefhttpslinktreeconceptualjames target_blankhttpslinktreeconceptualjamesaspanspanemp pthe post relnofollow hrefhttpsnewdiscoursescom202209critiquelinguistictransformationsocietycritique linguistic transformation societya appeared relnofollow hrefhttpsnewdiscoursescomnew discoursesap
|
632a935f2c7c41b2f595ac17
|
White House rushes to help Puerto Rico during fragile recovery
|
pthe devastation in puerto rico has so far sparked a quick response from washington but the federal governments effectiveness is poised to be tested by the territorys structural issues that remain fragile exactly five years after hurricane maria wrecked the islandp
phurricane fiona again knocked out power islandwide caused landslides and flooding and destroyed infrastructure sights that are all too familiar for puerto rico after maria in 2017p
pquotit wasnt as destructive because there wasnt as much wind but there was a lot of floodingquot said puerto rico health secretary carlos melladop
pquotit affected a lot of places that flooded where typically there is no floodingquotp
pfiona was a tropical storm when it hit the island growing into a category 1 hurricane during its path over puerto rico president biden issued an emergency declaration hours before the storm was upgraded sunday morningp
pwhile the flooding power and water outages and landslides present a very real danger to an alreadytraumatized population fiona pales in comparison to the sheer destruction of mara which struck with 200 mileperhour windsp
pstill fiona dumped 25 to 27 inches of rain on the island the equivalent of 11 million olympicsized swimming pools compared to about 32 inches during mariap
pbiden activated emergency funds after puerto rico gov pedro pierluisi d declared a state of emergency the white house has not yet said if the president will visit puerto rico since he returned to the us after a short trip to london for queen elizabeths funeral on monday and then left for the united nations in new york on tuesdayp
pin a call with pierluisi during his flight back from london biden and the governor discussed the immediate needs of puerto rico including federal support to the island p
pat the cabinet level federal officials contacted their puerto rican counterparts including mellado who coordinated with health and human services secretary xavier becerrap
pbiden said there are over 300 federal personnel already working to assist and that in the coming days as damage assessments are conducted the number of support personnel will increase substantially meanwhile fema administrator deanne criswell traveled to puerto rico on tuesday p
pthe administrations efforts so far are a stark contrast to former president trumps response to maria which was marked by a slow deployment of aid and disbursement of funds for reconstruction projects a trip to the island by trump was overtaken by images of him throwing rolls of paper towels at a group of people at a relief centerp
pat the time democrats blasted the trump administration for what they saw as an inadequate response to helping a us terrority p
pquotas many of you remember maria exposed the weaknesses of the infrastructure on the island and the callousness remember the paper towels the callousness of the federal response by the trump administrationquot said senate majority leader charles schumer dny at an event observing the fiveyear anniversary of maria in the capitol tuesdayp
pstill in the first days after maria hit the trump white house telegraphed an intention to quickly respondp
pquotim not going to defend trumpquot said carlos mercader a political consultant who in 2017 was heading the puerto rico federal affairs administration the territorys office in washingtonp
pquotfrom the start i had conversations with the president i wasnt even the governor and i talked to the president twice and the governor talked to him about four timesquot said mercaderp
pbut mercader said trump himself and his top officials quot[thendirector of the office of management and budget mick] mulvaney was a despotquot blocked relief and recovery funds with red tape implementing accounting processes designed to slow disbursements to the islandp
pquothaving said that there was communication there was help what happened is nobody was ready for a hurricane like mariaquot said mercaderp
pstill trumps reluctance to release funds aggravated conditions on the ground drawing condemnation and the white house was further criticized after trump celebrated the federal governments reaction to maria as an unsung successp
pi think in general their message is that were more competent and this falls into that category and they will likely not follow the same playbook ivan zapien a democratic lobbyist and former executive director at the hispanic leadership council of the democratic national committee dnc said of the biden white housep
pbidens response will be watched by voters especially hispanic voters who are being aggressively courted by republicans ahead of the midtermsp
pi think its critically important that he respond effectively and aggressively just overall to show voters that his administration can get the job done and i do think that many families and friends and particularly the state of florida where theres big puerto rican communities will be paying attention zapien saidp
pin large part driven by the difficulties of reconstruction after maria hundreds of thousands of puerto ricans have moved to florida changing that states electoral landscapep
pwhile many recent arrivals are reluctant to participate in elections particularly midterms a high diaspora turnout in central florida could shift the balance for statewide racesp
pthe biden administrations disaster response started on the right foot but puerto ricos myriad structural issues could complicate the path forwardp
pmellado said when he talked to the head of fema in puerto rico to ask for a power generator he immediately got one he said most hospitals have working power generators a massive upgrade from five years ago when some health centers were left without power for monthsp
pbut puerto ricos health system is still underfunded as the territory receives only a portion of the medicare and medicaid funds it would receive if it were funded on parity with the statesp
pwhile mellado said there are funds coming to cover costs of treating certain diseases including zika expected to spread in coming weeks hes concerned about longerterm prospectsp
pquotwhat im worried about is the longterm access to medicaid which would help us because weve had many delays in identifying patients and giving them adequate treatmentquot he addedp
pbut perhaps puerto ricos biggest structural deficiency is its power grid a juryrigged system with 1950s technology that completely collapsed after maria and has not yet been fully rebuiltp
pthe power grid has been managed by a private entity since june 2021 and its stability is a contentious topic of debate on the island where residents have pushed back against privatizationp
pthe hurricane and islandwide blackout it caused raises more tensions over the us territorys infrastructure because it appears to be just as fragile in the five years since the last devastating hurricanep
pismael arciniegas rueda a senior economist at the policy research organization rand argued that not everything puerto rico wanted to do to strengthen the infrastructure could have been done in five yearsp
pfixing the problem in puerto rico that we had takes time he said it takes a long time to move and change the design of the grid that puerto rico had that was kind of centralized to a more decentralized system that might be more resilient to these kind of problems hurricanes but also to earthquakesp
pbut civil society in puerto rico is impatient after years of power grid mismanagement and a privatization process that was closely linked to the islands debt restructuringp
pfive years ago when hurricane maria hit we were talking about how unprepared puerto rico was how the electrical grid could not sustain a hit from a hurricane and how the debt crisis of puerto rico was taking money away from the islands recovery said julio lopez varona cochief of campaigns at the center for popular democracyp
ppuerto ricans are in a place of distrust sadness and frustration because we know there were conscious decisions made to pay the debt while theyre closing hospitals and schools we know that there are millionaires coming here every year who dont have to deal with these direct effects of climate change said lopez varonap
pmeanwhile the white house touted bidens focus on infrastructure throughout his administration to highlight the federal response to hurricane fiona p
pand it took a stab at trump for his attempt to implement his own infrastructure policyp
pweve heard from the last administration it was a joke about how we were going to improve our infrastructure this is a president along with congress that made it happen because of his leadership white house press secretary karine jean pierre saidp
|
pthe devastation puerto rico far sparked quick response washington federal governments effectiveness poised tested territorys structural issues remain fragile exactly years hurricane maria wrecked islandp phurricane fiona knocked power islandwide caused landslides flooding destroyed infrastructure sights familiar puerto rico maria 2017p pquotit wasnt destructive wasnt wind lot floodingquot said puerto rico health secretary carlos melladop pquotit affected lot places flooded typically floodingquotp pfiona tropical storm hit island growing category 1 hurricane path puerto rico president biden issued emergency declaration hours storm upgraded sunday morningp pwhile flooding power water outages landslides present real danger alreadytraumatized population fiona pales comparison sheer destruction mara struck 200 mileperhour windsp pstill fiona dumped 25 27 inches rain island equivalent 11 million olympicsized swimming pools compared 32 inches mariap pbiden activated emergency funds puerto rico gov pedro pierluisi d declared state emergency white house said president visit puerto rico returned short trip london queen elizabeths funeral monday left united nations new york tuesdayp pin pierluisi flight london biden governor discussed immediate needs puerto rico including federal support islandp pat cabinet level federal officials contacted puerto rican counterparts including mellado coordinated health human services secretary xavier becerrap pbiden said 300 federal personnel working assist coming days damage assessments conducted number support personnel increase substantially fema administrator deanne criswell traveled puerto rico tuesdayp pthe administrations efforts far stark contrast president trumps response maria marked slow deployment aid disbursement funds reconstruction projects trip island trump overtaken images throwing rolls paper towels group people relief centerp pat time democrats blasted trump administration saw inadequate response helping terrorityp pquotas remember maria exposed weaknesses infrastructure island callousness remember paper towels callousness federal response trump administrationquot said senate majority leader charles schumer dny event observing fiveyear anniversary maria capitol tuesdayp pstill days maria hit trump white house telegraphed intention quickly respondp pquotim going defend trumpquot said carlos mercader political consultant 2017 heading puerto rico federal affairs administration territorys office washingtonp pquotfrom start conversations president wasnt governor talked president twice governor talked timesquot said mercaderp pbut mercader said trump officials quot[thendirector office management budget mick] mulvaney despotquot blocked relief recovery funds red tape implementing accounting processes designed slow disbursements islandp pquothaving said communication help happened ready hurricane like mariaquot said mercaderp pstill trumps reluctance release funds aggravated conditions ground drawing condemnation white house criticized trump celebrated federal governments reaction maria unsung successp pi think general message competent falls category likely follow playbook ivan zapien democratic lobbyist executive director hispanic leadership council democratic national committee dnc said biden white housep pbidens response watched voters especially hispanic voters aggressively courted republicans ahead midtermsp pi think critically important respond effectively aggressively overall voters administration job think families friends particularly state florida theres big puerto rican communities paying attention zapien saidp pin large driven difficulties reconstruction maria hundreds thousands puerto ricans moved florida changing states electoral landscapep pwhile recent arrivals reluctant participate elections particularly midterms high diaspora turnout central florida shift balance statewide racesp pthe biden administrations disaster response started right foot puerto ricos myriad structural issues complicate path forwardp pmellado said talked head fema puerto rico ask power generator immediately got said hospitals working power generators massive upgrade years ago health centers left power monthsp pbut puerto ricos health system underfunded territory receives portion medicare medicaid funds receive funded parity statesp pwhile mellado said funds coming cover costs treating certain diseases including zika expected spread coming weeks hes concerned longerterm prospectsp pquotwhat im worried longterm access medicaid help weve delays identifying patients giving adequate treatmentquot addedp pbut puerto ricos biggest structural deficiency power grid juryrigged system 1950s technology completely collapsed maria fully rebuiltp pthe power grid managed private entity june 2021 stability contentious topic debate island residents pushed privatizationp pthe hurricane islandwide blackout caused raises tensions territorys infrastructure appears fragile years devastating hurricanep pismael arciniegas rueda senior economist policy research organization rand argued puerto rico wanted strengthen infrastructure yearsp pfixing problem puerto rico takes time said takes long time change design grid puerto rico kind centralized decentralized system resilient kind problems hurricanes earthquakesp pbut civil society puerto rico impatient years power grid mismanagement privatization process closely linked islands debt restructuringp pfive years ago hurricane maria hit talking unprepared puerto rico electrical grid sustain hit hurricane debt crisis puerto rico taking money away islands recovery said julio lopez varona cochief campaigns center popular democracyp ppuerto ricans place distrust sadness frustration know conscious decisions pay debt theyre closing hospitals schools know millionaires coming year dont deal direct effects climate change said lopez varonap pmeanwhile white house touted bidens focus infrastructure administration highlight federal response hurricane fionap pand took stab trump attempt implement infrastructure policyp pweve heard administration joke going improve infrastructure president congress happen leadership white house press secretary karine jean pierre saidp
|
632a93692c7c41b2f595ac1b
|
Can Europe survive the age of strongmen?
|
pthea relnoopener hrefhttpswwwreuterscomworldasiapacificarmeniasays135soldierskilledclasheswithazerbaijanthisweek20220916 target_blank latest military assaulta by azerbaijans oilrich dictator ilham aliyev on tiny democratic armenia places the european union once again in an awkward position on the one hand as eu leaders never cease to remind us the continental bloc stands for liberalism and democracy against the rising tide of eurasian autocracy on the other european leaders such as ursula von der leyen who signed an eu energy deal with the very same aliyeva relnoopener hrefhttpswwwlemondefrenopinionarticle20220729bychoosingazerbaijanasagassupplierursulavonderleyenweakenstheeuropeanunion_5991891_23html target_blank just a few months agoa feel somehow compelled to place the continents fate in the hands of antidemocratic strongmen whether bullied by autocrats like erdogan or lukashenko pumping migrants towards europes borders or dependent on dictators like putin or aliyev for europes energy needsp
pit is unnecessary to debate whether this situation derives from hypocrisy or bad diplomacy it is both and at the heart of it lies the fundamental conundrum facing eu geopolitics how to defend europes liberaldemocratic ideology in a hard world where it is too weak to enforce its will and the continents nearest neighbours are emboldened towards swift decisive action by their total rejection of europes moral norms what the selfproclaimed moral superpower lacks is a basic understanding of power where it lies and how to use it but worse europes leaders lack the fundamental willingness to act strongly and decisively in defence of european interestsp
pin his 1951 masterwork a relnoopener hrefhttpwwwtelospresscomstoretheforestpassagepaperbackp30633407 target_blankemthe forest passageema the writer and philosopher ernst jnger observed of prewar german societys meek subjection to the nazi regime a relnoopener hrefhttpsunherdcom202112ernstjungerourprophetofanarchy target_blankhe despiseda that long periods of peace and quiet favour certain optical illusions among them is the assumption that the invulnerability of the home is founded upon the constitution and safeguarded by it in reality it rests upon the father of the family who accompanied by his sons appears with the axe on the threshold of his dwelling a naive and selfregarding faith in the smooth functioning of liberal institutions serves only to render you powerless when faced with a challenger who does not respect the rules of your game ultimately freedom and security depend on your willingness to wield power yourself and to actively defend your liberty and way of lifep
divdiv
pnearly seven months into putins war in ukraine we see this is the essential challenge facing europe today the us security umbrella has rendered europe weak and powerless believing that it could sway the rest of the world towards its governing philosophy through offering trade deals as carrots relying on americas offstage presence to wield the stick yet the continent now finds itself a geopolitical pygmy bullied by autocrats like putin erdogan and lukashenko structurally at the mercy of more assertive actors this winter we shall endure the results just as covid finally revealed our continents structural dependency on chinese manufacturing so has putins invasion of ukraine revealed our dependence on russian energy to sustain not just our industrial capacity but the very building blocks of modern middleclass lifep
pcommentators who once lauded figures such as merkel have suddenly perceived too late that there is nothing very liberal or admirable about subjecting your people to the whims of illiberal tyrants yet merkels sudden fall from grace shows us only half of the equation the nature of european institutions built around myths of everexpanding liberal progress remains the same history has moved on but europes governance has remained infantilised stuck in a vanished past even after merkel europe remains ruled by merkelians and institutions expressly designed to stymie the swift and decisive action a world of crisis and competition demandsp
diva hrefhttpsunherdcom202209themythicpowerofkingcharlesiiirefinnara hrefhttpsunherdcom202209themythicpowerofkingcharlesiiirefinnarimg srchttpsunherdcomwpcontentuploads202209gettyimages52101073scalede16627447474831300x169jpgadiva hrefhttpsunherdcom202209themythicpowerofkingcharlesiiirefinnarspanmore from this authorspanaa hrefhttpsunherdcom202209themythicpowerofkingcharlesiiirefinnarh5the mythic power of king charles iiih5apa hrefhttpsunherdcom202209themythicpowerofkingcharlesiiirefinnarspanbyspan aris roussinosapdivadiv
pin his 2019 book a hrefhttpswwwagendapubcombooks121thestrongmenemthe strongmenema the german political theorist hans kribbe distils his rare policy experience of having worked for both the european commission and putins government to claim that to survive an anarchic world europe will have to adopt many of the manners of the archetypal strongman it was no more a call for an actual european strongman than hobbes emleviathanem was a demand for rule by monstrous giants kribbe uses the term more as a metaphor for comfort with executive power than as a political roadmapp
pthe strongman as he notes citing a relnoopener hrefhttpswwwpalladiummagcom20210723degaullesstateoftomorrow target_blankde gaullea as an example differs from the dictator or the classic totalitarians of the 20th century in that his transcendence of the ordinary rules is always limited in time born of crisis the strongmans brief but decisive display of executive power aims to unblock a congested system a great reset if you will allowing the ordinary functions of the state to return reinvigorated once the crisis of the day has been surpassed unlike the fascists or communists of the past he is not ideological the strongman lives in an embattled chaotic and postideological present not an idealised future the language of consensus and persuasion can only work so far in an illiberal world europe should be fluent in its liberal values but it should also be strong it must become aware that it is but one community in a pluralistic world that is potentially hostile and that may destroy itp
pkribbe likens 21stcentury europe to 19thcentury china which even as european powers seized its territory and imposed humiliating terms on the middle kingdom retreated to a smug and selfdefeating certainty in the superiority of its values and political system only after suffering humiliation after humiliation did china conclude that its cultural sophistication would not protect its freedom kribbe notes adding that today if europe clings to the notion that the world just wishes to emulate its model be taught by it it risks making the same mistake it will tell strongmen like putin and erdogan to behave or go home and they will only laugh and go about their business as before indeed kribbe observes darkly if europes position is that the truthfulness of its liberal values suffices to secure its sovereignty it may need its own century of humiliation to discover that only the strong can be free as a vision of a better world europes idealism and commitment to persuasion and consensus may be admirable but it is no roadmap to navigating an anarchic world of competing statesp
pthere are echoes of kribbes analysis in macrons a relnoopener hrefhttpsforeignaffairsconz20220902milositranslationspeechbypresidentemmanuelmacronontheoccasionoftheconferenceofambassadors target_blanklandmark speecha to the conference of french ambassadors earlier this month in which he observed that for things to stay the same for europe everything must change the economic order open liberal capitalism has gone out of order he said the reality is that the pandemic has fractured production lines it has reregionalised sometimes renationalised certain production chains and i think it has permanently deglobalised a large part of world productionp
diva hrefhttpsunherdcom202112ernstjungerourprophetofanarchyrefinnara hrefhttpsunherdcom202112ernstjungerourprophetofanarchyrefinnarimg srchttpsunherdcomwpcontentuploads2021122gettyimages541029157scaled1300x222gifadiva hrefhttpsunherdcom202112ernstjungerourprophetofanarchyrefinnarspanmore from this authorspanaa hrefhttpsunherdcom202112ernstjungerourprophetofanarchyrefinnarh5ernst jnger our prophet of anarchyh5apa hrefhttpsunherdcom202112ernstjungerourprophetofanarchyrefinnarspanbyspan aris roussinosapdivadiv
psimilarly in the political sphere macron observed we are living in the beginning of an illiberal moment indeed geopolitics is gradually being structured around a competition between the united states and china in which china can legitimately challenge the americanled order and redefine the rules of the international game the result for macron is that we will also have to rearm ourselves morally like jnger macron understands that true liberty ultimately depends on strength and the capacity for selfdefence as he declared we must be a strong nation which as i said knows what the price of freedom isp
pwhat would a sovereign europe able to defend its customs and way of life against autocratic challengers look like for macron as for kribbe to avoid its looming fate as a helpless vassal of one great power or another europe must reclaim the language of power and finally accept the reality that it is a sovereign polity among others with its own interests to defend yet as kribbe notes for the ruling generation of eu politicians the language and worldview of sovereign power is seen as somehow immoral a fundamentally indecent relic of a less enlightened age but delegating our security to america is no more moral or stable in the long run than delegating our industrial capacity to china or our energy security to russia it leaves us at the mercy of noneuropean actors whose interests are not identical to ours and whose actions will always subordinate our security and prosperity to their own as kribbe warns those who farm out their protection to the strong also farm out their freedom they can never eliminate the possibility of extortionp
padopting a relnoopener hrefhttpsunherdcom202110thedemocratwhocouldbringdownbiden target_blanka schmittian framea kribbe observes that it is only in a relnoopener hrefhttpsunherdcom202205covidwasliberalismsendgame target_blankthe state of exceptiona that sovereign power reveals itself yet he warns given that they are designed as a bureaucratic and technocratic escape pod from the world of geopolitics and power the eus institutions are not fitted out to project strength citing europes difficult and so far subordinate relationship with the strongmen of eurasia as the necessary harbinger of a new age of european sovereignty kribbe terms the continents current predicament as the age of encounter the encounter being with sovereign power itself raw and vital but we can take the schmittian framing further we still live in an age of exception a period of everspreading accumulating crisis in which only those actors capable of bold and decisive action will survive as kribbe warns europe must decide just one great dilemma choosing strength is it a vassal or sovereign in a world dominated by power no question is more importantp
diva hrefhttpsunherdcom202208europehaslosttheenergywarrefinnara hrefhttpsunherdcom202208europehaslosttheenergywarrefinnarimg srchttpsunherdcomwpcontentuploads202207gettyimages485744138copy300x189jpgadiva hrefhttpsunherdcom202208europehaslosttheenergywarrefinnarspansuggested readingspanaa hrefhttpsunherdcom202208europehaslosttheenergywarrefinnarh5europe has lost the energy warh5apa hrefhttpsunherdcom202208europehaslosttheenergywarrefinnarspanbyspan thomas faziapdivadiv
pwhat the assumption of sovereignty would look like is hard to determine it need not and probably ought not as kribbe emphasises mean the consolidation of supreme power in one person but is better interpreted as an understanding of what sovereignty means and a willingness to use it in any case kribbes portrayal of the former eu commission president jeanclaude juncker as the continents chosen interlocutor with autocratic rivals appears misguided meanwhile the longestserving european leader viktor orbn though wellversed in the language of power shows himself in practice more an accomplice to europes autocratic rivals than their challenger perhaps macron himself one of the few theorists of statecraft and no stranger to a certain gaullist temperament would seem a better avatar though the perennially hostile central european response to his attempted geopolitical balancing act mitigates against his chancesp
parguably polands decisive policy choices in ukraine and its rapid programme of rearmament is itself just such a form of swift decisive action which may soon make poland the sovereign land power on the european continent indeed without the vital rearmament aspect a similar case could be made for the uk yet what is certain is this we live in an anarchic world of hard power and the european unions current structure and idealistic worldview leaves the continent weak and almost powerless far from the nascent superpower it hovers indecisively on the edge of becoming europe similarly wedged between rival empires is as helpless at determining its own fate as tiny luckless armenia the coming winter and the years that will follow will be harder than they needed to be we must ensure at the end of this period of trial that we europeans are never left this vulnerable again europe cannot survive another merkel nor prolong the vanished order of willed powerlessness she presided overp
a hrefhttpsunherdcom202209caneuropesurvivetheageofstrongmenappcommentsview 4 commentsa
|
pthea relnoopener hrefhttpswwwreuterscomworldasiapacificarmeniasays135soldierskilledclasheswithazerbaijanthisweek20220916 target_blank latest military assaulta azerbaijans oilrich dictator ilham aliyev tiny democratic armenia places european union awkward position hand eu leaders cease remind continental bloc stands liberalism democracy rising tide eurasian autocracy european leaders ursula von der leyen signed eu energy deal aliyeva relnoopener hrefhttpswwwlemondefrenopinionarticle20220729bychoosingazerbaijanasagassupplierursulavonderleyenweakenstheeuropeanunion_5991891_23html target_blank months agoa feel compelled place continents fate hands antidemocratic strongmen bullied autocrats like erdogan lukashenko pumping migrants europes borders dependent dictators like putin aliyev europes energy needsp pit unnecessary debate situation derives hypocrisy bad diplomacy heart lies fundamental conundrum facing eu geopolitics defend europes liberaldemocratic ideology hard world weak enforce continents nearest neighbours emboldened swift decisive action total rejection europes moral norms selfproclaimed moral superpower lacks basic understanding power lies use worse europes leaders lack fundamental willingness act strongly decisively defence european interestsp pin 1951 masterwork relnoopener hrefhttpwwwtelospresscomstoretheforestpassagepaperbackp30633407 target_blankemthe forest passageema writer philosopher ernst jnger observed prewar german societys meek subjection nazi regime relnoopener hrefhttpsunherdcom202112ernstjungerourprophetofanarchy target_blankhe despiseda long periods peace quiet favour certain optical illusions assumption invulnerability home founded constitution safeguarded reality rests father family accompanied sons appears axe threshold dwelling naive selfregarding faith smooth functioning liberal institutions serves render powerless faced challenger respect rules game ultimately freedom security depend willingness wield power actively defend liberty way lifep divdiv pnearly seven months putins war ukraine essential challenge facing europe today security umbrella rendered europe weak powerless believing sway rest world governing philosophy offering trade deals carrots relying americas offstage presence wield stick continent finds geopolitical pygmy bullied autocrats like putin erdogan lukashenko structurally mercy assertive actors winter shall endure results covid finally revealed continents structural dependency chinese manufacturing putins invasion ukraine revealed dependence russian energy sustain industrial capacity building blocks modern middleclass lifep pcommentators lauded figures merkel suddenly perceived late liberal admirable subjecting people whims illiberal tyrants merkels sudden fall grace shows half equation nature european institutions built myths everexpanding liberal progress remains history moved europes governance remained infantilised stuck vanished past merkel europe remains ruled merkelians institutions expressly designed stymie swift decisive action world crisis competition demandsp diva hrefhttpsunherdcom202209themythicpowerofkingcharlesiiirefinnara hrefhttpsunherdcom202209themythicpowerofkingcharlesiiirefinnarimg srchttpsunherdcomwpcontentuploads202209gettyimages52101073scalede16627447474831300x169jpgadiva hrefhttpsunherdcom202209themythicpowerofkingcharlesiiirefinnarspanmore authorspanaa hrefhttpsunherdcom202209themythicpowerofkingcharlesiiirefinnarh5the mythic power king charles iiih5apa hrefhttpsunherdcom202209themythicpowerofkingcharlesiiirefinnarspanbyspan aris roussinosapdivadiv pin 2019 book hrefhttpswwwagendapubcombooks121thestrongmenemthe strongmenema german political theorist hans kribbe distils rare policy experience having worked european commission putins government claim survive anarchic world europe adopt manners archetypal strongman actual european strongman hobbes emleviathanem demand rule monstrous giants kribbe uses term metaphor comfort executive power political roadmapp pthe strongman notes citing relnoopener hrefhttpswwwpalladiummagcom20210723degaullesstateoftomorrow target_blankde gaullea example differs dictator classic totalitarians 20th century transcendence ordinary rules limited time born crisis strongmans brief decisive display executive power aims unblock congested system great reset allowing ordinary functions state return reinvigorated crisis day surpassed unlike fascists communists past ideological strongman lives embattled chaotic postideological present idealised future language consensus persuasion work far illiberal world europe fluent liberal values strong aware community pluralistic world potentially hostile destroy itp pkribbe likens 21stcentury europe 19thcentury china european powers seized territory imposed humiliating terms middle kingdom retreated smug selfdefeating certainty superiority values political system suffering humiliation humiliation china conclude cultural sophistication protect freedom kribbe notes adding today europe clings notion world wishes emulate model taught risks making mistake tell strongmen like putin erdogan behave home laugh business kribbe observes darkly europes position truthfulness liberal values suffices secure sovereignty need century humiliation discover strong free vision better world europes idealism commitment persuasion consensus admirable roadmap navigating anarchic world competing statesp pthere echoes kribbes analysis macrons relnoopener hrefhttpsforeignaffairsconz20220902milositranslationspeechbypresidentemmanuelmacronontheoccasionoftheconferenceofambassadors target_blanklandmark speecha conference french ambassadors earlier month observed things stay europe change economic order open liberal capitalism gone order said reality pandemic fractured production lines reregionalised renationalised certain production chains think permanently deglobalised large world productionp diva hrefhttpsunherdcom202112ernstjungerourprophetofanarchyrefinnara hrefhttpsunherdcom202112ernstjungerourprophetofanarchyrefinnarimg srchttpsunherdcomwpcontentuploads2021122gettyimages541029157scaled1300x222gifadiva hrefhttpsunherdcom202112ernstjungerourprophetofanarchyrefinnarspanmore authorspanaa hrefhttpsunherdcom202112ernstjungerourprophetofanarchyrefinnarh5ernst jnger prophet anarchyh5apa hrefhttpsunherdcom202112ernstjungerourprophetofanarchyrefinnarspanbyspan aris roussinosapdivadiv psimilarly political sphere macron observed living beginning illiberal moment geopolitics gradually structured competition united states china china legitimately challenge americanled order redefine rules international game result macron rearm morally like jnger macron understands true liberty ultimately depends strength capacity selfdefence declared strong nation said knows price freedom isp pwhat sovereign europe able defend customs way life autocratic challengers look like macron kribbe avoid looming fate helpless vassal great power europe reclaim language power finally accept reality sovereign polity interests defend kribbe notes ruling generation eu politicians language worldview sovereign power seen immoral fundamentally indecent relic enlightened age delegating security america moral stable long run delegating industrial capacity china energy security russia leaves mercy noneuropean actors interests identical actions subordinate security prosperity kribbe warns farm protection strong farm freedom eliminate possibility extortionp padopting relnoopener hrefhttpsunherdcom202110thedemocratwhocouldbringdownbiden target_blanka schmittian framea kribbe observes relnoopener hrefhttpsunherdcom202205covidwasliberalismsendgame target_blankthe state exceptiona sovereign power reveals warns given designed bureaucratic technocratic escape pod world geopolitics power eus institutions fitted project strength citing europes difficult far subordinate relationship strongmen eurasia necessary harbinger new age european sovereignty kribbe terms continents current predicament age encounter encounter sovereign power raw vital schmittian framing live age exception period everspreading accumulating crisis actors capable bold decisive action survive kribbe warns europe decide great dilemma choosing strength vassal sovereign world dominated power question importantp diva hrefhttpsunherdcom202208europehaslosttheenergywarrefinnara hrefhttpsunherdcom202208europehaslosttheenergywarrefinnarimg srchttpsunherdcomwpcontentuploads202207gettyimages485744138copy300x189jpgadiva hrefhttpsunherdcom202208europehaslosttheenergywarrefinnarspansuggested readingspanaa hrefhttpsunherdcom202208europehaslosttheenergywarrefinnarh5europe lost energy warh5apa hrefhttpsunherdcom202208europehaslosttheenergywarrefinnarspanbyspan thomas faziapdivadiv pwhat assumption sovereignty look like hard determine need probably ought kribbe emphasises mean consolidation supreme power person better interpreted understanding sovereignty means willingness use case kribbes portrayal eu commission president jeanclaude juncker continents chosen interlocutor autocratic rivals appears misguided longestserving european leader viktor orbn wellversed language power shows practice accomplice europes autocratic rivals challenger macron theorists statecraft stranger certain gaullist temperament better avatar perennially hostile central european response attempted geopolitical balancing act mitigates chancesp parguably polands decisive policy choices ukraine rapid programme rearmament form swift decisive action soon poland sovereign land power european continent vital rearmament aspect similar case uk certain live anarchic world hard power european unions current structure idealistic worldview leaves continent weak powerless far nascent superpower hovers indecisively edge europe similarly wedged rival empires helpless determining fate tiny luckless armenia coming winter years follow harder needed ensure end period trial europeans left vulnerable europe survive merkel prolong vanished order willed powerlessness presided overp hrefhttpsunherdcom202209caneuropesurvivetheageofstrongmenappcommentsview 4 commentsa
|
632a936e2c7c41b2f595ac1d
|
The philosophy of Count Dracula
|
pthose visiting romania for the first time will often be told that its association with vampires is really an unfair imposition having mostly to do with bram stokers invention of a transylvanian setting for his 1897 novel emdraculaem his tale you will hear is a typically victorian confession of englands own deepest fears of pestilence of empathologia sexualisem hopelessly interwoven with what would soon be called the deathdrive of uncouth swarthy continentalsp
pin the shadow of bran castle once home to vlad the impaler you might enjoy the irony of hearing this revisionist history lesson while surrounded by a whole gallery of vampire kitsch kiosks with plastic fangs for sale a dracula faceinahole board as diminutive and unthreatening as his descendants count chocula of breakfastcereal fame or sesame streets own count von countp
plistening to such lectures in the past i would often find myself unable to suppress that exclamation so completely taboo in our era of stayinyourlane deference emwell actuallyem because the truth is that tales of vampires existed in the balkans long before bram stoker between the 15th and the 19th centuries the figure of the vampire made the gradual transition from the protoethnography of the balkans to the imaginations of gothic emlittrateursemp
divdiv
pmost succinctly we may say that the figure of the vampire emerges out of the confluence of three elements the first is the real historical record of the actions of a certain vlad epe 142831147677 the violent transgressions for which he became notorious were extreme notably impalement on rounded and greased spikes carefully avoiding direct puncture of inner organs so as to prolong the victims misery woodcuts depicting his deeds were soon published in german books and as these circulated the legends surrounding him grew beyond all human proportionp
pthe second element is the arrival of germanophone habsburg administrators in newly subordinated regions of southeastern europe who had been influenced in their practices by the emerging culture of the republic of letters which encouraged literate travellers in littleknown places to note down and to report back to the metropole all rare or mysterious incidents the third element finally are the ancient folkcultural practices and beliefs that these humble clerks observed and documentedp
pof particular importance in the revisionist lesson for foreigners in transylvania is the task of clearing dracula from any association with vampirism dracula they explain is simply the title but not the name of vlad epe also known as vlad iii or vlad the impaler he inherited it from his father vlad ii a member of the order of the dragon in romanian emdracul emderives from the latinem dracoem and simply means the dragonp
diva hrefhttpsunherdcom202206yourfitbithasstolenyoursoulrefinnara hrefhttpsunherdcom202206yourfitbithasstolenyoursoulrefinnarimg srchttpsunherdcomwpcontentuploads202206gettyimages833553921300x169jpgadiva hrefhttpsunherdcom202206yourfitbithasstolenyoursoulrefinnarspanmore from this authorspanaa hrefhttpsunherdcom202206yourfitbithasstolenyoursoulrefinnarh5your fitbit has stolen your soulh5apa hrefhttpsunherdcom202206yourfitbithasstolenyoursoulrefinnarspanbyspan justin e h smithapdivadiv
pit is not in fact in the castles but in the villages of romania that we typically hear rumours of the emstrigoiem which are in turn close cousins of the emvrykolakasem of greece and the emupiorem of the slavic countries these are in all their regional variants ghosts of the deceased poltergeists who return to trouble the living a common belief holds that one may prevent their apparition by sealing the coffin of the dead shut with extra nails and by driving a stake through the chest of the corpse should one encounter a emstrigoiem some texts and traditions counsel the use of apotropaics such as garlic or holy water to ward them off these folkloric characters thus share some but not all of the traits associated with the stokerian vampire there is as yet no strong association with bats for example or with hematophagyp
pit is at least true then that stokers rendition bumps the vampire up several social classes from where it had always resided in authentic folk culture from the peasantry to the aristocracy and it is the elevation of traditional village practices to a form of aristocratic decadence that enables stoker to give his fiction a historical grounding and to identify his own protagonists vampirism as part of an inheritance from none other than vlad the impalerp
pwho was it but one of my own race who as emvoivodeem [a military leader] crossed the danube and beat the turk on his own ground this was a dracula indeed woe was it that his own unworthy brother when he had fallen sold his people to the turk and brought the shame of slavery on them was it not this dracula indeed who inspired that other of his race who in a later age again and again brought his forces over the great river into turkeylandp
pin portraying vlad as a hero in the war against the turks the english novelist is channelling a historiographical tendency more commonly seen in russia and the balkans than in western europe in the orthodox lands while his cruelty is acknowledged vlad is mostly seen as a valiant defender against the ottoman menace and therefore as a bulwark of christendom in the germanspeaking world by contrast his significance as a military leader pales in comparison with his inhuman and gratuitous cruelty beginning as early as the 1460s broadsides circulated describing the delight vlad took in roasting babies alive and forcing their mothers to eat them in hearing the low moans of his impaled victims as musical accompaniment to his mealsp
diva hrefhttpsunherdcom202203howbuffyrevampedteensexrefinnara hrefhttpsunherdcom202203howbuffyrevampedteensexrefinnarimg srchttpsunherdcomwpcontentuploads2022032screenshot20220310at45926pm300x181jpgadiva hrefhttpsunherdcom202203howbuffyrevampedteensexrefinnarspansuggested readingspanaa hrefhttpsunherdcom202203howbuffyrevampedteensexrefinnarh5how buffy revamped teen sexh5apa hrefhttpsunherdcom202203howbuffyrevampedteensexrefinnarspanbyspan kat rosenfieldapdivadiv
phorrific tales of vlad the impaler were not the only source of vampire mythology nonfictional writing on strange incidents and curiosities stretches back to antiquity but it is in the wake of the scientific revolution that a more systematic approach develops to the collection of eyewitness reports largely inspired by the learned journal of the royal society of london emthe philosophical transactionsem founded in 1666p
pthe first extant treatise on vampirism is ema relnoopener hrefhttpssubstackcomredirect85b66692af254ac0b86a20bc708b29cbr1fhein target_blankde masticatione mortuorum in tumulisa em[emon the chewing of the dead in their tombsem] published in 1725 by the german lutheran pastor and historian michal ranfft in his work ranfft helped to make vampires known throughout the germanspeaking world by republishing a report from a minor administrator in the serbian provinces of the kingdom of hungary who described some peculiar events in the village of kisolova following the death of a certain petar blagojevi of whom it was stated that within eight days [of his death] nine people both old and young died after enduring an illness of 24 hours it is reported that as they still lay alive on their death beds the abovementioned plogojovitz [sic] who had died ten weeks prior came to them in their sleep lay down on top of them and croaked that they must now give up their soulsp
pthe author of the report cited by ranfft uses the word vampire in one of its earliest printed occurrences he reports that since among similar people as are calledem vampyriem there must be visible various signs as that their bodies are undecayed with skin hair beard and nails growing the villagers resolved to open up the grave of petar blagojevi and to see what they might discover there here is what they foundp
pthat first of all the body and its grave were not in the least touched by the usual smell of the dead the body other than the nose which had somewhat fallen off was very fresh the hair and the beard and also the nails of which the older ones had fallen away had grown on him the old skin which was somewhat white had peeled away and a new fresh skin had come forth underneath the face hands and feet and the whole body were so composed that they could not have been more perfect during the course of his life not without surprise i glimpsed fresh blood in his mouth which according to the common expression he had sucked from those he had killedp
pat issue in part was a puzzlement about some unexpected contingencies in the way bodies decompose while they often rot quickly depending on the circumstances of the air the temperature and the presence of microorganisms bodies can also come to appear under the right conditions even more healthy than they had been just prior to death sometimes a corpse is found with blood streaming from the mouth a natural consequence of the internal breakdown of the organs which nonetheless can easily be mistaken for a vestige of recent feasting they frequently become bloated and in an era in which corpulence was still strongly associated with health this temporary condition could easily appear as an improvement only to be explained on the assumption that the corpse had been ingesting food food that is or bloodp
pthe difficulty of determining the precise boundary between life and death is a subject that reappears throughout the 18th century not just in reference to vampires but in numerous medical treatises the most interesting example of such work is undoubtedly the danishfrench physician jacquesbnigne winslows 1742 a relnoopener hrefhttpssubstackcomredirect9fece09569794504a69936a3ac4f0fcdr1fhein target_blankemdissertation on the uncertainty of the signs of death and the misuse of burials and rushed embalmingsema winslow cites several authorities to establish the view that putrefaction is the only infallible sign of deathp
pwinslow also peppers his treatise with macabre reports many of which read like gothic fiction thus we learn of a lady of auxbourg who falling into a syncope in consequence of a suffocation of the matrix was buried in a deep vault without being covered with earth some years after however one of the same family happening to die the vault was opend and the body of the young lady found on the stairs at its entry without any fingers on the right hand soon enough documentary sources such as this were sublimated into fictional stories about the undead edgar allen poes emthe premature burialem 1844 being a prime examplep
diva hrefhttpsunherdcom202206whyweneedfairiesrefinnara hrefhttpsunherdcom202206whyweneedfairiesrefinnarimg srchttpsunherdcomwpcontentuploads20220627300x184jpgadiva hrefhttpsunherdcom202206whyweneedfairiesrefinnarspansuggested readingspanaa hrefhttpsunherdcom202206whyweneedfairiesrefinnarh5why we need fairiesh5apa hrefhttpsunherdcom202206whyweneedfairiesrefinnarspanbyspan salley vickersapdivadiv
pthe early modern explosion of interest in balkan superstition is as we have begun to see in no small measure an effect of the encounter between the catholic and orthodox worlds and in particular of the expansion of habsburg rule into regions of the balkans that had previously belonged to the ottoman empire this encounter triggered a long and indeed still ongoing habit of representing southeastern europe as a land of benighted and backwards beliefp
pin his contribution to the 1776 emdictionnaire philosophiqueem none other than voltaire who never misses an opportunity to scoff at people who happen not to be french takes up the example of vampires not only as a measure of the distance between enlightened europe and those other parts but also between the rationality of the ancient greeks and the irrationality of their degenerated modern descendants who would believe that the fashion of vampires came from greece this is not the greece of alexander of aristotle of plato of epicurus of demosthenes but rather christian greece which is unfortunately schismaticp
pvoltaire is a defiant atheist but his polemical anticlericalism brings him close to some of the themes of antipapism familiar from protestant lands for many protestant authors the difference between catholicism and worship of the forces of darkness is but another case of the narcissism of minor differences voltaire writing in this same spirit speaks mockingly of a young sceptic who had dared to question the truth of a number of reported miracles involving the virgin mary and who finally was won over to all manner of catholic articles of faith as a result of exposure to folkbeliefs about vampires in his satirical account it was best for the weakminded to shelter themselves from stories of vampires if only because these can all too easily serve as a gateway drug to the roman religionp
diva hrefhttpsunherdcom202205ludwigwittgensteinswaronphilosophyrefinnara hrefhttpsunherdcom202205ludwigwittgensteinswaronphilosophyrefinnarimg srchttpsunherdcomwpcontentuploads2022052promo225553628_2300x169jpgadiva hrefhttpsunherdcom202205ludwigwittgensteinswaronphilosophyrefinnarspansuggested readingspanaa hrefhttpsunherdcom202205ludwigwittgensteinswaronphilosophyrefinnarh5ludwig wittgensteins war on philosophyh5apa hrefhttpsunherdcom202205ludwigwittgensteinswaronphilosophyrefinnarspanbyspan terry eagleton apdivadiv
pamong catholic authors by contrast we generally see not mockery of folkbeliefs about vampires but rather a subtle almost mischievous effort to occupy the ambiguous space between affirmation and scepticism indeed a convention emerges in vampirological works over the course of the 18th century whereby the author is generally presented as an intrepid and dedicated but perhaps somewhat shadowy character this doubt is in turn offset by an assurance that the author is a man of the cloth an abbey or a clergyman who has immersed himself in the study of dark forces in order to better combat them for the sake of humanitys salvation which side a reader constantly wonders is the author emreallyem onp
pwhether writing as a scienceoriented debunker or as a pious fighter against the forces of darkness or indeed as some mixture of these two vampirologists always seem to be infected by their subject sceptics will see them as frivolous for wasting their intellectual energy on an old folk myth and the pious will see them as rather too interested for suspicious reasons in the very thing they are supposed to be fighting against it is hard to be taken seriously as a vampirologistp
pand yet it still seems to me that vampires are due a certain measure of rehabilitation the vampire i think is at least as good to think with as the a relnoopener hrefhttpsenwikipediaorgwikiphilosophical_zombie target_blankphilosophical zombiea that has historically been preferred by analytic philosophers zombies give us all of the conceptual problems about mind and consciousness but none of the emfeelingem and are thus perfect watercarriers for whatever it is the analytics are trying to do to think with vampires is by contrast to think about feeling mood and the dimensions of human existence these disclosep
pin its essence a vampire is a being that knows it is dead and feels infinite sadness about its plight this is a paradoxical situation to be in since death is supposed to be the cessation of all consciousness but it is also fairly close to what we imagine when we tryem per impossibileem to imagine death we do so mostly by feeling our way into it until we can bear no more and recoil we do so by allowing what that feeling discloses to us to count for something and also in our dreams notably we encounter dead people with surprising regularity they walk and talk and give us tidings yet theres something off about them by which we understand that they are dead an impossible condition yet there they arep
div
div
pema longer version of this essay first appeared at a relnoopener hrefhttpsjustinehsmithsubstackcompreenteringthevampirecastle target_blankjustin e h smiths hinternetaemp
divdiv
div
div
a hrefhttpsunherdcom202209thephilosophyofcountdraculaappcommentsview commentsa
|
pthose visiting romania time told association vampires unfair imposition having bram stokers invention transylvanian setting 1897 novel emdraculaem tale hear typically victorian confession englands deepest fears pestilence empathologia sexualisem hopelessly interwoven soon called deathdrive uncouth swarthy continentalsp pin shadow bran castle home vlad impaler enjoy irony hearing revisionist history lesson surrounded gallery vampire kitsch kiosks plastic fangs sale dracula faceinahole board diminutive unthreatening descendants count chocula breakfastcereal fame sesame streets count von countp plistening lectures past find unable suppress exclamation completely taboo era stayinyourlane deference emwell actuallyem truth tales vampires existed balkans long bram stoker 15th 19th centuries figure vampire gradual transition protoethnography balkans imaginations gothic emlittrateursemp divdiv pmost succinctly figure vampire emerges confluence elements real historical record actions certain vlad epe 142831147677 violent transgressions notorious extreme notably impalement rounded greased spikes carefully avoiding direct puncture inner organs prolong victims misery woodcuts depicting deeds soon published german books circulated legends surrounding grew human proportionp pthe second element arrival germanophone habsburg administrators newly subordinated regions southeastern europe influenced practices emerging culture republic letters encouraged literate travellers littleknown places note report metropole rare mysterious incidents element finally ancient folkcultural practices beliefs humble clerks observed documentedp pof particular importance revisionist lesson foreigners transylvania task clearing dracula association vampirism dracula explain simply title vlad epe known vlad iii vlad impaler inherited father vlad ii member order dragon romanian emdraculemderives latinemdracoem simply means dragonp diva hrefhttpsunherdcom202206yourfitbithasstolenyoursoulrefinnara hrefhttpsunherdcom202206yourfitbithasstolenyoursoulrefinnarimg srchttpsunherdcomwpcontentuploads202206gettyimages833553921300x169jpgadiva hrefhttpsunherdcom202206yourfitbithasstolenyoursoulrefinnarspanmore authorspanaa hrefhttpsunherdcom202206yourfitbithasstolenyoursoulrefinnarh5your fitbit stolen soulh5apa hrefhttpsunherdcom202206yourfitbithasstolenyoursoulrefinnarspanbyspan justin e h smithapdivadiv pit fact castles villages romania typically hear rumours theemstrigoiem turn close cousins theemvrykolakasem greece theemupioremof slavic countries regional variants ghosts deceased poltergeists return trouble living common belief holds prevent apparition sealing coffin dead shut extra nails driving stake chest corpse encounter aemstrigoiem texts traditions counsel use apotropaics garlic holy water ward folkloric characters share traits associated stokerian vampire strong association bats example hematophagyp pit true stokers rendition bumps vampire social classes resided authentic folk culture peasantry aristocracy elevation traditional village practices form aristocratic decadence enables stoker fiction historical grounding identify protagonists vampirism inheritance vlad impalerp pwho race emvoivodeem [a military leader] crossed danube beat turk ground dracula woe unworthy brother fallen sold people turk brought shame slavery dracula inspired race later age brought forces great river turkeylandp pin portraying vlad hero war turks english novelist channelling historiographical tendency commonly seen russia balkans western europe orthodox lands cruelty acknowledged vlad seen valiant defender ottoman menace bulwark christendom germanspeaking world contrast significance military leader pales comparison inhuman gratuitous cruelty beginning early 1460s broadsides circulated describing delight vlad took roasting babies alive forcing mothers eat hearing low moans impaled victims musical accompaniment mealsp diva hrefhttpsunherdcom202203howbuffyrevampedteensexrefinnara hrefhttpsunherdcom202203howbuffyrevampedteensexrefinnarimg srchttpsunherdcomwpcontentuploads2022032screenshot20220310at45926pm300x181jpgadiva hrefhttpsunherdcom202203howbuffyrevampedteensexrefinnarspansuggested readingspanaa hrefhttpsunherdcom202203howbuffyrevampedteensexrefinnarh5how buffy revamped teen sexh5apa hrefhttpsunherdcom202203howbuffyrevampedteensexrefinnarspanbyspan kat rosenfieldapdivadiv phorrific tales vlad impaler source vampire mythology nonfictional writing strange incidents curiosities stretches antiquity wake scientific revolution systematic approach develops collection eyewitness reports largely inspired learned journal royal society londonemthe philosophical transactionsem founded 1666p pthe extant treatise vampirism isema relnoopener hrefhttpssubstackcomredirect85b66692af254ac0b86a20bc708b29cbr1fhein target_blankde masticatione mortuorum tumulisaem[emon chewing dead tombsem] published 1725 german lutheran pastor historian michal ranfft work ranfft helped vampires known germanspeaking world republishing report minor administrator serbian provinces kingdom hungary described peculiar events village kisolova following death certain petar blagojevi stated days [of death] people old young died enduring illness 24 hours reported lay alive death beds abovementioned plogojovitz [sic] died weeks prior came sleep lay croaked soulsp pthe author report cited ranfft uses word vampire earliest printed occurrences reports similar people calledemvampyriem visible signs bodies undecayed skin hair beard nails growing villagers resolved open grave petar blagojevi discover foundp pthat body grave touched usual smell dead body nose somewhat fallen fresh hair beard nails older ones fallen away grown old skin somewhat white peeled away new fresh skin come forth underneath face hands feet body composed perfect course life surprise glimpsed fresh blood mouth according common expression sucked killedp pat issue puzzlement unexpected contingencies way bodies decompose rot quickly depending circumstances air temperature presence microorganisms bodies come appear right conditions healthy prior death corpse found blood streaming mouth natural consequence internal breakdown organs nonetheless easily mistaken vestige recent feasting frequently bloated era corpulence strongly associated health temporary condition easily appear improvement explained assumption corpse ingesting food food bloodp pthe difficulty determining precise boundary life death subject reappears 18th century reference vampires numerous medical treatises interesting example work undoubtedly danishfrench physician jacquesbnigne winslows 1742 relnoopener hrefhttpssubstackcomredirect9fece09569794504a69936a3ac4f0fcdr1fhein target_blankemdissertation uncertainty signs death misuse burials rushed embalmingsema winslow cites authorities establish view putrefaction infallible sign deathp pwinslow peppers treatise macabre reports read like gothic fiction learn lady auxbourg falling syncope consequence suffocation matrix buried deep vault covered earth years family happening die vault opend body young lady found stairs entry fingers right hand soon documentary sources sublimated fictional stories undead edgar allen poes emthe premature burialem 1844 prime examplep diva hrefhttpsunherdcom202206whyweneedfairiesrefinnara hrefhttpsunherdcom202206whyweneedfairiesrefinnarimg srchttpsunherdcomwpcontentuploads20220627300x184jpgadiva hrefhttpsunherdcom202206whyweneedfairiesrefinnarspansuggested readingspanaa hrefhttpsunherdcom202206whyweneedfairiesrefinnarh5why need fairiesh5apa hrefhttpsunherdcom202206whyweneedfairiesrefinnarspanbyspan salley vickersapdivadiv pthe early modern explosion interest balkan superstition begun small measure effect encounter catholic orthodox worlds particular expansion habsburg rule regions balkans previously belonged ottoman empire encounter triggered long ongoing habit representing southeastern europe land benighted backwards beliefp pin contribution 1776emdictionnaire philosophiqueem voltaire misses opportunity scoff people happen french takes example vampires measure distance enlightened europe parts rationality ancient greeks irrationality degenerated modern descendants believe fashion vampires came greece greece alexander aristotle plato epicurus demosthenes christian greece unfortunately schismaticp pvoltaire defiant atheist polemical anticlericalism brings close themes antipapism familiar protestant lands protestant authors difference catholicism worship forces darkness case narcissism minor differences voltaire writing spirit speaks mockingly young sceptic dared question truth number reported miracles involving virgin mary finally won manner catholic articles faith result exposure folkbeliefs vampires satirical account best weakminded shelter stories vampires easily serve gateway drug roman religionp diva hrefhttpsunherdcom202205ludwigwittgensteinswaronphilosophyrefinnara hrefhttpsunherdcom202205ludwigwittgensteinswaronphilosophyrefinnarimg srchttpsunherdcomwpcontentuploads2022052promo225553628_2300x169jpgadiva hrefhttpsunherdcom202205ludwigwittgensteinswaronphilosophyrefinnarspansuggested readingspanaa hrefhttpsunherdcom202205ludwigwittgensteinswaronphilosophyrefinnarh5ludwig wittgensteins war philosophyh5apa hrefhttpsunherdcom202205ludwigwittgensteinswaronphilosophyrefinnarspanbyspan terry eagleton apdivadiv pamong catholic authors contrast generally mockery folkbeliefs vampires subtle mischievous effort occupy ambiguous space affirmation scepticism convention emerges vampirological works course 18th century author generally presented intrepid dedicated perhapssomewhat shadowy character doubt turn offset assurance author man cloth abbey clergyman immersed study dark forces order better combat sake humanitys salvation reader constantly wonders authoremreallyemonp pwhether writing scienceoriented debunker pious fighter forces darkness mixture vampirologists infected subject sceptics frivolous wasting intellectual energy old folk myth pious interested suspicious reasons thing supposed fighting hard taken seriously vampirologistp pand vampires certain measure rehabilitation vampire think good think relnoopener hrefhttpsenwikipediaorgwikiphilosophical_zombie target_blankphilosophical zombiea historically preferred analytic philosophers zombies conceptual problems mind consciousness theemfeelingem perfect watercarriers analytics trying think vampires contrast think feeling mood dimensions human existence disclosep pin essence vampire knows dead feels infinite sadness plight paradoxical situation death supposed cessation consciousness fairly close imagine tryem impossibileem imagine death feeling way bear recoil allowing feeling discloses count somethingand dreams notably encounter dead people surprising regularity walk talk tidings theres understand dead impossible condition arep div div pema longer version essay appeared relnoopener hrefhttpsjustinehsmithsubstackcompreenteringthevampirecastle target_blankjustin e h smiths hinternetaemp divdiv div div hrefhttpsunherdcom202209thephilosophyofcountdraculaappcommentsview commentsa
|
632a95e6a35f34f399642421
|
Biden nominates Lynne Tracy as new ambassador to Russia
|
ppresident biden on tuesday nominated lynne tracy to serve as ambassador to the russian federation to navigate a tense relationship between the us and russia amid the war in ukrainep
ptracy currently serves as the us ambassador to armenia a post that shes held since 2019 p
pbefore that she was the senior adviser for russia in the state departments bureau of european and eurasian affairs and was the deputy chief of mission at us embassy in moscowp
pformer ambassador john sullivan a relnoreferrer noopener hrefhttpsthehillcompolicyinternational3628853usambassadortorussiaretiring target_blankleft russia earlier this montha after serving in the post for almost three years his time in that particular position included russias initial invasion of ukraine in february biden retained sullivan who was former president trumps appointeep
pthe administration said sullivans departure which appeared abrupt was planned and a new ambassador would be named soonp
ptracy who speaks russian has also been deputy chief of mission at the us embassy in turkmenistan a principal officer in pakistan and a principal officer in kazakhstanp
pher domestic assignments include desk officer for kazakhstan and for georgia in the bureau of european and eurasian affairs she has received the state departments distinguished honor award the secretary of states award for heroism and a presidential meritorious service awardp
psince sullivans departure elizabeth rood the deputy chief of mission at the us embassy in moscow has filled the spotp
|
ppresident biden tuesday nominated lynne tracy serve ambassador russian federation navigate tense relationship russia amid war ukrainep ptracy currently serves ambassador armenia post shes held 2019 p pbefore senior adviser russia state departments bureau european eurasian affairs deputy chief mission embassy moscowp pformer ambassador john sullivana relnoreferrer noopener hrefhttpsthehillcompolicyinternational3628853usambassadortorussiaretiring target_blankleft russia earlier monthaafter serving post years time particular position included russias initial invasion ukraine february biden retained sullivan president trumps appointeep pthe administration said sullivans departure appeared abrupt planned new ambassador named soonp ptracy speaks russian deputy chief mission embassy turkmenistan principal officer pakistan principal officer kazakhstanp pher domestic assignments include desk officer kazakhstan georgia bureau european eurasian affairs received state departments distinguished honor award secretary states award heroism presidential meritorious service awardp psince sullivans departure elizabeth rood deputy chief mission embassy moscow filled spotp
|
632a9ae7a35f34f3996424c2
|
Quillette Weekly
|
img altquillette weekly srchttpss3amazonawscomprodstaticcontentquillettecom202209quilletteweekly2pngpthis week we have a diverse selection of essays for you to peruse from a tribute to the late american novelist peter straub to an impassioned defence of truthseeking in the discipline of history barbara kay has penned a touching essay on the young queen elizabeth and you will find an editorial cosigned by all emquillette emeditors in support of ukraine phrpa few weeks ago we published an article by a young record collector max wilson about a wisconsin prison band emupheavalem ppemupheavalem produced a record which would go on to become one of the most sought after 45rpms of all time yet despite this prized record the incredible story of the band had never been told until max penned his article for emquillette emppmax recently visited the last remaining survivor of emupheaval emjoe hayes joe doesnt use the internet so max printed the essay for him pfigureimg srchttpss3amazonawscomprodstaticcontentquillettecom202209untitleddesign1png altquillette weekly width1385 height785figcaptionjoe hayes of emupheaval emphoto max wilsonfigcaptionfigurepif you missed maxs article when it was published you can read it here i can promise that you wont be disappointedpfigurea hrefhttpsquillettecom20220728lostsoulbehindbarsdivdivlost soul behind barsdivdivthe untold story of upheaval a prison band that recorded one of the most soughtafter soul singles of the 1970sdivdivimg altquillette weekly srchttpss3amazonawscomprodstaticcontentquillettecom202107qiconpngspanquillettespanspanmax wilsonspandivdivdivimg altquillette weekly srchttpss3amazonawscomprodstaticcontentquillettecom202207upheavaljpegdivafigurepuntil next weekbremclaireemphrh3fictionh3figurea hrefhttpsquillettecom20220912peterstraubdivdivpeter straub 19432022divdivfarewell to another of the big six novelists from the golden age of american horror fictiondivdivimg altquillette weekly srchttpss3amazonawscomprodstaticcontentquillettecom202107qiconpngspanquillettespanspankevin mimsspandivdivdivimg altquillette weekly srchttpss3amazonawscomprodstaticcontentquillettecom202209peterstraubpngdivafigureh3educationh3figurea hrefhttpsquillettecom20220915mathforfuturedarwinsdivdivmath for future scientists require statistics not calculusdivdivthe case for ending calculus requirements for science majorsdivdivimg altquillette weekly srchttpss3amazonawscomprodstaticcontentquillettecom202107qiconpngspanquillettespanspanrobert c thornettspandivdivdivimg altquillette weekly srchttpss3amazonawscomprodstaticcontentquillettecom202209math1pngdivafigureh3activism vs academia h3figurea hrefhttpsquillettecom20220916childwelfareisbecomingajokedivdivchild welfare is becoming a jokedivdivthe field is mired in risible theory and impenetrable jargon and increasingly divorced from concern with the welfare of childrendivdivimg altquillette weekly srchttpss3amazonawscomprodstaticcontentquillettecom202107qiconpngspanquillettespanspannaomi schaefer rileyspandivdivdivimg altquillette weekly srchttpss3amazonawscomprodstaticcontentquillettecom202209bearpngdivafigurefigurea hrefhttpsquillettecom20220913neverapologizefortryingtotellthetruthdivdivnever apologize for trying to tell the truthdivdivthose who repress inconvenient facts or produce fictitious evidence to nourish a politically convenient story are simply not historiansdivdivimg altquillette weekly srchttpss3amazonawscomprodstaticcontentquillettecom202107qiconpngspanquillettespanspanjeffrey herfspandivdivdivimg altquillette weekly srchttpss3amazonawscomprodstaticcontentquillettecom202209pointingblamepngdivafigureh3historyh3figurea hrefhttpsquillettecom20220914beforeshewastheperfectqueenelizabethwastheperfectprincessdivdivthe young elizabeth seen through a childs eyesdivdivthe diaries of elizabeths wartime companion illustrates the special burdens faced by royaltyand elizabeths fitness to bear themdivdivimg altquillette weekly srchttpss3amazonawscomprodstaticcontentquillettecom202107qiconpngspanquillettespanspanbarbara kayspandivdivdivimg altquillette weekly srchttpss3amazonawscomprodstaticcontentquillettecom2022091600pxprincess_elizabeth_visiting_airborne_troops_may_1944_h38619jpgdivafigureh3politicsh3figurea hrefhttpsquillettecom20220919lessonsfromhannaharendtonarrestingourideologicaldivdivlessons from hannah arendt on arresting our flight from realitydivdivfascism communism and transhumanism all lure us into rejecting the real human condition in favor of ideological constructsdivdivimg altquillette weekly srchttpss3amazonawscomprodstaticcontentquillettecom202107qiconpngspanquillettespanspanroger berkowitzspandivdivdivimg altquillette weekly srchttpss3amazonawscomprodstaticcontentquillettecom202209kustodiev_the_bolshevikjpgdivafigurefigurea hrefhttpsquillettecom20220916horseshoetheorycomestoukrainedivdivhorseshoe theory comes to ukrainedivdivputins western apologists dont reflect the usual conflict between left and rightbut rather comprise an example of both poles making common cause against the centerdivdivimg altquillette weekly srchttpss3amazonawscomprodstaticcontentquillettecom202107qiconpngspanquillettespanspanthe quillette editorial boardspandivdivdivimg altquillette weekly srchttpss3amazonawscomprodstaticcontentquillettecom202209m777s_for_ukraine_1jpgdivafigureh3from around the webh3figurea hrefhttpswwwamericanpurposecomarticlesthemanwhosawamericadivdivthe man who saw americadivdivolivier zunz offers a new portrait of americas most famous french critic alexis de tocquevilledivdivimg altquillette weekly srchttpswwwamericanpurposecomcontentimagessizew256h256202010americanpurposelogowhitebg250x250pngspanamerican purposespanspangustav jnssonspandivdivdivimg altquillette weekly srchttpswwwamericanpurposecomcontentimages202209870x489_tocquevillewebpdivafigurefigureblockquote classtwittertweetp langen dirltrjanan ganesh the myth of western decadence a hrefhttpstcoytbwxbyvushttpstcoytbwxbyvusap ft opinion ftopinion a hrefhttpstwittercomftopinionstatus1570880529599193089ref_srctwsrc5etfwseptember 16 2022ablockquote
figure
|
img altquillette weekly srchttpss3amazonawscomprodstaticcontentquillettecom202209quilletteweekly2pngpthis week diverse selection essays peruse tribute late american novelist peter straub impassioned defence truthseeking discipline history barbara kay penned touching essay young queen elizabeth find editorial cosigned emquillette emeditors support ukraine phrpa weeks ago published article young record collector max wilson wisconsin prison band emupheavalem ppemupheavalem produced record sought 45rpms time despite prized record incredible story band told max penned article emquillette emppmax recently visited remaining survivor emupheaval emjoe hayes joe doesnt use internet max printed essay pfigureimg srchttpss3amazonawscomprodstaticcontentquillettecom202209untitleddesign1png altquillette weekly width1385 height785figcaptionjoe hayes emupheaval emphoto max wilsonfigcaptionfigurepif missed maxs article published read promise wont disappointedpfigurea hrefhttpsquillettecom20220728lostsoulbehindbarsdivdivlost soul barsdivdivthe untold story upheaval prison band recorded soughtafter soul singles 1970sdivdivimg altquillette weekly srchttpss3amazonawscomprodstaticcontentquillettecom202107qiconpngspanquillettespanspanmax wilsonspandivdivdivimg altquillette weekly srchttpss3amazonawscomprodstaticcontentquillettecom202207upheavaljpegdivafigurepuntil weekbremclaireemphrh3fictionh3figurea hrefhttpsquillettecom20220912peterstraubdivdivpeter straub 19432022divdivfarewell big novelists golden age american horror fictiondivdivimg altquillette weekly srchttpss3amazonawscomprodstaticcontentquillettecom202107qiconpngspanquillettespanspankevin mimsspandivdivdivimg altquillette weekly srchttpss3amazonawscomprodstaticcontentquillettecom202209peterstraubpngdivafigureh3educationh3figurea hrefhttpsquillettecom20220915mathforfuturedarwinsdivdivmath future scientists require statistics calculusdivdivthe case ending calculus requirements science majorsdivdivimg altquillette weekly srchttpss3amazonawscomprodstaticcontentquillettecom202107qiconpngspanquillettespanspanrobert c thornettspandivdivdivimg altquillette weekly srchttpss3amazonawscomprodstaticcontentquillettecom202209math1pngdivafigureh3activism vs academia h3figurea hrefhttpsquillettecom20220916childwelfareisbecomingajokedivdivchild welfare jokedivdivthe field mired risible theory impenetrable jargon increasingly divorced concern welfare childrendivdivimg altquillette weekly srchttpss3amazonawscomprodstaticcontentquillettecom202107qiconpngspanquillettespanspannaomi schaefer rileyspandivdivdivimg altquillette weekly srchttpss3amazonawscomprodstaticcontentquillettecom202209bearpngdivafigurefigurea hrefhttpsquillettecom20220913neverapologizefortryingtotellthetruthdivdivnever apologize trying tell truthdivdivthose repress inconvenient facts produce fictitious evidence nourish politically convenient story simply historiansdivdivimg altquillette weekly srchttpss3amazonawscomprodstaticcontentquillettecom202107qiconpngspanquillettespanspanjeffrey herfspandivdivdivimg altquillette weekly srchttpss3amazonawscomprodstaticcontentquillettecom202209pointingblamepngdivafigureh3historyh3figurea hrefhttpsquillettecom20220914beforeshewastheperfectqueenelizabethwastheperfectprincessdivdivthe young elizabeth seen childs eyesdivdivthe diaries elizabeths wartime companion illustrates special burdens faced royaltyand elizabeths fitness bear themdivdivimg altquillette weekly srchttpss3amazonawscomprodstaticcontentquillettecom202107qiconpngspanquillettespanspanbarbara kayspandivdivdivimg altquillette weekly srchttpss3amazonawscomprodstaticcontentquillettecom2022091600pxprincess_elizabeth_visiting_airborne_troops_may_1944_h38619jpgdivafigureh3politicsh3figurea hrefhttpsquillettecom20220919lessonsfromhannaharendtonarrestingourideologicaldivdivlessons hannah arendt arresting flight realitydivdivfascism communism transhumanism lure rejecting real human condition favor ideological constructsdivdivimg altquillette weekly srchttpss3amazonawscomprodstaticcontentquillettecom202107qiconpngspanquillettespanspanroger berkowitzspandivdivdivimg altquillette weekly srchttpss3amazonawscomprodstaticcontentquillettecom202209kustodiev_the_bolshevikjpgdivafigurefigurea hrefhttpsquillettecom20220916horseshoetheorycomestoukrainedivdivhorseshoe theory comes ukrainedivdivputins western apologists dont reflect usual conflict left rightbut comprise example poles making common cause centerdivdivimg altquillette weekly srchttpss3amazonawscomprodstaticcontentquillettecom202107qiconpngspanquillettespanspanthe quillette editorial boardspandivdivdivimg altquillette weekly srchttpss3amazonawscomprodstaticcontentquillettecom202209m777s_for_ukraine_1jpgdivafigureh3from webh3figurea hrefhttpswwwamericanpurposecomarticlesthemanwhosawamericadivdivthe man saw americadivdivolivier zunz offers new portrait americas famous french critic alexis de tocquevilledivdivimg altquillette weekly srchttpswwwamericanpurposecomcontentimagessizew256h256202010americanpurposelogowhitebg250x250pngspanamerican purposespanspangustav jnssonspandivdivdivimg altquillette weekly srchttpswwwamericanpurposecomcontentimages202209870x489_tocquevillewebpdivafigurefigureblockquote classtwittertweetp langen dirltrjanan ganesh myth western decadence hrefhttpstcoytbwxbyvushttpstcoytbwxbyvusap ft opinion ftopinion hrefhttpstwittercomftopinionstatus1570880529599193089ref_srctwsrc5etfwseptember 16 2022ablockquote figure
|
632aa0e4a35f34f399642522
|
Elections and Demography: Democrats’ Continued Slide Among Hispanics
|
figure classwpblockimageimg srchttpswwwaeiorgwpcontentuploads202209electionsdemographybannerjpgx91208 width1278 alt classwpimage1008659737 height273figure
pthis is the inaugural issue of an aeideas series that will focus on elections and demographic voting patterns during the 2022 campaign we will look weekly at demographic subgroup averages from a month of polls while democrats have pulled ahead on the generic ballot republicans will be seeking to capitalize on areas of demographic weakness for democrats come election day this unique snapshot will provide a far better sense than any individual poll of key groups current preferences and how they are moving as we approach november 8thp
pstronggeneric ballot averagesstrongp
pemaug 9sep 9emp
figure classwpblocktabletabletbodytrtd tdtdtdtddemtdtdreptdtddemrep margintdtdnumber of pollstdtrtrtdoveralltdtdtdtd449tdtd424tdtd25tdtd17tdtrtrtdethnicitytdtdemwhiteemtdtd397tdtd502tdtd105tdtd17tdtrtrtd tdtdemhispanicemtdtd514tdtd322tdtd192tdtd13tdtrtrtd tdtdemblackemtdtd709tdtd135tdtd574tdtd15tdtrtrtdeducationtdtdemwhite collegeemtdtd532tdtd404tdtd128tdtd5tdtrtrtd tdtdemwhite no collegeemtdtd302tdtd590tdtd288tdtd5tdtrtrtd tdtdemcollegeemtdtd519tdtd391tdtd128tdtd6tdtrtrtd tdtdemno collegeemtdtd426tdtd466tdtd40tdtd6tdtrtrtdgendertdtdemmaleemtdtd422tdtd458tdtd36tdtd14tdtrtrtd tdtdemfemaleemtdtd483tdtd378tdtd105tdtd14tdtrtrtdincometdtdemlt50kemtdtd443tdtd383tdtd60tdtd9tdtrtrtd tdtdem50100kemtdtd450tdtd427tdtd22tdtd6tdtrtrtd tdtdem100kemtdtd485tdtd423tdtd62tdtd6tdtrtbodytablefigure
pstrongkey findingsstrongp
ullithe average hispanic advantage for the democrats in the last month is around 19 points this is a further decline from the democrats relatively low a relnoreferrer noopener hrefhttpscatalistuswhnational target_blank25point advantagea among this group in the 2020 presidential election and a big decline from their a relnoreferrer noopener hrefhttpscatalistuswhnational target_blank35point advantagea in the 2018 midterm the trend in the last month among hispanics has also been negative for the democrats around a 2point declinelilithe data indicate a yawning 42point gap in the last month between the democrats white college and white noncollege support the democrats are carrying white college voters by 13 points while losing white noncollege voters by 29 the analogous gap in a relnoreferrer noopener hrefhttpscatalistuswhnational target_blank2018a was 27 points and in a relnoreferrer noopener hrefhttpscatalistuswhnational target_blank2020a 33 pointsliliin the last month democrats margin among white college voters increased by 6 points while their deficit worsened by 5 points among white noncollege voters white noncollege voters remain more undecided about their 2022 vote choice than their collegeeducated counterpartslilisome polls show an astounding divergence between democratic support among white college and noncollege voters the most recent a relnoreferrer noopener hrefhttpsmaristpollmaristeduwpcontentuploads202209npr_pbsnewshour_maristpoll_politics_usanosandtables_202209021321pdf target_blankmaristnprpbs polla has democrats carrying white college voters by 6332 while losing white noncollege voters by 6031liliwomen support democrats by 105 points a margin 25 points lower than a relnoreferrer noopener hrefhttpscatalistuswhnational target_blankjoe bidens in 2020a this lagging support complicates arguments that women will vote for democrats at higher margins because of the emdobbs emdecisionliliin a possible positive sign for democrats black and hispanic voters who are generally more disposed to the party are significantly more undecided than white voters the averages not shown here suggest 156 percent of black voters and 164 percent of hispanic voters do not yet know for whom they will vote compared to only 102 percent of white votersliul
pstrongdemographic margin trendsstrongp
figure classwpblocktabletabletbodytrtdtdtd dataaligncenterdemtdtd dataaligncenterreptdtd dataaligncentermargin changebrfrom last weektdtd dataaligncentermargin changebrfrom last monthtdtrtrtdemoverallemtdtd dataaligncenter449tdtd dataaligncenter424tdtd dataaligncenter02tdtd dataaligncenter15tdtrtrtdemwhiteemtdtd dataaligncenter397tdtd dataaligncenter502tdtd dataaligncenter09tdtd dataaligncenter08tdtrtrtdemhispanicemtdtd dataaligncenter514tdtd dataaligncenter322tdtd dataaligncenter04tdtd dataaligncenter16tdtrtrtdemblackemtdtd dataaligncenter709tdtd dataaligncenter135tdtd dataaligncenter28tdtd dataaligncenter16tdtrtrtdemwhite collegeemtdtd dataaligncenter532tdtd dataaligncenter404tdtd dataaligncenter26tdtd dataaligncenter62tdtrtrtdemwhite no collegeemtdtd dataaligncenter302tdtd dataaligncenter590tdtd dataaligncenter08tdtd dataaligncenter54tdtrtrtdemcollegeemtdtd dataaligncenter519tdtd dataaligncenter391tdtd dataaligncenter60tdtd dataaligncenter52tdtrtrtdemno collegeemtdtd dataaligncenter426tdtd dataaligncenter466tdtd dataaligncenter39tdtd dataaligncenter36tdtrtrtdemmaleemtdtd dataaligncenter422tdtd dataaligncenter458tdtd dataaligncenter03tdtd dataaligncenter06tdtrtrtdemfemaleemtdtd dataaligncenter483tdtd dataaligncenter378tdtd dataaligncenter02tdtd dataaligncenter17tdtrtrtdemlt50kemtdtd dataaligncenter443tdtd dataaligncenter383tdtd dataaligncenter56tdtd dataaligncenter24tdtrtrtdem50100kemtdtd dataaligncenter450tdtd dataaligncenter427tdtd dataaligncenter33tdtd dataaligncenter47tdtrtrtdem100kemtdtd dataaligncenter485tdtd dataaligncenter423tdtd dataaligncenter02tdtd dataaligncenter09tdtrtbodytablefigure
pemprevious election data is drawn from ema relnoreferrer noopener hrefhttpscatalistuswhnational target_blankemcatalist crosstab estimatesemaem catalist is a democratic data analytics organizationemp
pemhow we did this this monthlong average is a compilation of online and live caller polls that release crosstabs internal and explicitly partisan polls are excluded this edition averages polls from the economistyougov quinnipiac university morning consultpolitico cbs news emerson the wall street journal rasmussen echelon insights marist collegenprpbs newshour and fox newsemp
divpstronglearn more stronga hrefhttpswwwaeiorgsocietyandculturefromtheaeiarchiveourneighborhoodpartiifrom the aei archive our neighborhood part iia a hrefhttpswwwaeiorgsocietyandculturefromtheaeiarchivesourneighborhoodfrom the aei archive our neighborhooda a hrefhttpswwwaeiorgsocietyandculturefromtheaeiarchiveaeipolicyforumsfrom the aei archive aei policy forumsa a hrefhttpswwwaeiorgsocietyandculturefromthearchivesgorbachevlegacyfrom the aei archive early impressions of gorbachev and a final thoughtapdiv
pthe post a relnofollow hrefhttpswwwaeiorgpoliticsandpublicopinionelectionsanddemographydemocratscontinuedslideamonghispanicselections and demography democrats continued slide among hispanicsa appeared first on a relnofollow hrefhttpswwwaeiorgamerican enterprise institute aeiap
|
figure classwpblockimageimg srchttpswwwaeiorgwpcontentuploads202209electionsdemographybannerjpgx91208 width1278 alt classwpimage1008659737 height273figure pthis inaugural issue aeideas series focus elections demographic voting patterns 2022 campaign look weekly demographic subgroup averages month polls democrats pulled ahead generic ballot republicans seeking capitalize areas demographic weakness democrats come election day unique snapshot provide far better sense individual poll key groups current preferences moving approach november 8thp pstronggeneric ballot averagesstrongp pemaug 9sep 9emp figure classwpblocktabletabletbodytrtdtdtdtdtddemtdtdreptdtddemrep margintdtdnumber pollstdtrtrtdoveralltdtdtdtd449tdtd424tdtd25tdtd17tdtrtrtdethnicitytdtdemwhiteemtdtd397tdtd502tdtd105tdtd17tdtrtrtdtdtdemhispanicemtdtd514tdtd322tdtd192tdtd13tdtrtrtdtdtdemblackemtdtd709tdtd135tdtd574tdtd15tdtrtrtdeducationtdtdemwhite collegeemtdtd532tdtd404tdtd128tdtd5tdtrtrtdtdtdemwhite collegeemtdtd302tdtd590tdtd288tdtd5tdtrtrtdtdtdemcollegeemtdtd519tdtd391tdtd128tdtd6tdtrtrtdtdtdemno collegeemtdtd426tdtd466tdtd40tdtd6tdtrtrtdgendertdtdemmaleemtdtd422tdtd458tdtd36tdtd14tdtrtrtdtdtdemfemaleemtdtd483tdtd378tdtd105tdtd14tdtrtrtdincometdtdemlt50kemtdtd443tdtd383tdtd60tdtd9tdtrtrtdtdtdem50100kemtdtd450tdtd427tdtd22tdtd6tdtrtrtdtdtdem100kemtdtd485tdtd423tdtd62tdtd6tdtrtbodytablefigure pstrongkey findingsstrongp ullithe average hispanic advantage democrats month 19 points decline democrats relatively low relnoreferrer noopener hrefhttpscatalistuswhnational target_blank25point advantagea group 2020 presidential election big decline relnoreferrer noopener hrefhttpscatalistuswhnational target_blank35point advantagea 2018 midterm trend month hispanics negative democrats 2point declinelilithe data indicate yawning 42point gap month democrats white college white noncollege support democrats carrying white college voters 13 points losing white noncollege voters 29 analogous gap relnoreferrer noopener hrefhttpscatalistuswhnational target_blank2018a 27 points relnoreferrer noopener hrefhttpscatalistuswhnational target_blank2020a 33 pointsliliin month democrats margin white college voters increased 6 points deficit worsened 5 points white noncollege voters white noncollege voters remain undecided 2022 vote choice collegeeducated counterpartslilisome polls astounding divergence democratic support white college noncollege voters recent relnoreferrer noopener hrefhttpsmaristpollmaristeduwpcontentuploads202209npr_pbsnewshour_maristpoll_politics_usanosandtables_202209021321pdf target_blankmaristnprpbs polla democrats carrying white college voters 6332 losing white noncollege voters 6031liliwomen support democrats 105 points margin 25 points lower relnoreferrer noopener hrefhttpscatalistuswhnational target_blankjoe bidens 2020a lagging support complicates arguments women vote democrats higher margins emdobbs emdecisionliliin possible positive sign democrats black hispanic voters generally disposed party significantly undecided white voters averages shown suggest 156 percent black voters 164 percent hispanic voters know vote compared 102 percent white votersliul pstrongdemographic margin trendsstrongp figure classwpblocktabletabletbodytrtdtdtd dataaligncenterdemtdtd dataaligncenterreptdtd dataaligncentermargin changebrfrom weektdtd dataaligncentermargin changebrfrom monthtdtrtrtdemoverallemtdtd dataaligncenter449tdtd dataaligncenter424tdtd dataaligncenter02tdtd dataaligncenter15tdtrtrtdemwhiteemtdtd dataaligncenter397tdtd dataaligncenter502tdtd dataaligncenter09tdtd dataaligncenter08tdtrtrtdemhispanicemtdtd dataaligncenter514tdtd dataaligncenter322tdtd dataaligncenter04tdtd dataaligncenter16tdtrtrtdemblackemtdtd dataaligncenter709tdtd dataaligncenter135tdtd dataaligncenter28tdtd dataaligncenter16tdtrtrtdemwhite collegeemtdtd dataaligncenter532tdtd dataaligncenter404tdtd dataaligncenter26tdtd dataaligncenter62tdtrtrtdemwhite collegeemtdtd dataaligncenter302tdtd dataaligncenter590tdtd dataaligncenter08tdtd dataaligncenter54tdtrtrtdemcollegeemtdtd dataaligncenter519tdtd dataaligncenter391tdtd dataaligncenter60tdtd dataaligncenter52tdtrtrtdemno collegeemtdtd dataaligncenter426tdtd dataaligncenter466tdtd dataaligncenter39tdtd dataaligncenter36tdtrtrtdemmaleemtdtd dataaligncenter422tdtd dataaligncenter458tdtd dataaligncenter03tdtd dataaligncenter06tdtrtrtdemfemaleemtdtd dataaligncenter483tdtd dataaligncenter378tdtd dataaligncenter02tdtd dataaligncenter17tdtrtrtdemlt50kemtdtd dataaligncenter443tdtd dataaligncenter383tdtd dataaligncenter56tdtd dataaligncenter24tdtrtrtdem50100kemtdtd dataaligncenter450tdtd dataaligncenter427tdtd dataaligncenter33tdtd dataaligncenter47tdtrtrtdem100kemtdtd dataaligncenter485tdtd dataaligncenter423tdtd dataaligncenter02tdtd dataaligncenter09tdtrtbodytablefigure pemprevious election data drawn ema relnoreferrer noopener hrefhttpscatalistuswhnational target_blankemcatalist crosstab estimatesemaem catalist democratic data analytics organizationemp pemhow monthlong average compilation online live caller polls release crosstabs internal explicitly partisan polls excluded edition averages polls economistyougov quinnipiac university morning consultpolitico cbs news emerson wall street journal rasmussen echelon insights marist collegenprpbs newshour fox newsemp divpstronglearn stronga hrefhttpswwwaeiorgsocietyandculturefromtheaeiarchiveourneighborhoodpartiifrom aei archive neighborhood iia hrefhttpswwwaeiorgsocietyandculturefromtheaeiarchivesourneighborhoodfrom aei archive neighborhooda hrefhttpswwwaeiorgsocietyandculturefromtheaeiarchiveaeipolicyforumsfrom aei archive aei policy forumsa hrefhttpswwwaeiorgsocietyandculturefromthearchivesgorbachevlegacyfrom aei archive early impressions gorbachev final thoughtapdiv pthe post relnofollow hrefhttpswwwaeiorgpoliticsandpublicopinionelectionsanddemographydemocratscontinuedslideamonghispanicselections demography democrats continued slide hispanicsa appeared relnofollow hrefhttpswwwaeiorgamerican enterprise institute aeiap
|
632e343d00beacfbb91d078d
|
Animated Chart of the Day: Recorded Music Sales by Format Share, 1973 to 2022
|
div datasrcvisualisation1458501div
pmy latest animated bar chart race visualization above click the arrow to start shows the format shares of recorded music sales annually from 1973 to 2022 based ona relnoreferrer noopener hrefhttpswwwriaacomwpcontentuploads202209midyear2022riaamusicrevenuereport1pdf target_blank new midyear sales dataa that were released today by the recording industry industry association of america riaa for the first half of 2022 the riaa reports this summary for music sales during the first half of this year p
blockquote classwpblockquotepus recorded music revenues in the first half of 2022 rose 9 to 77 billion at estimated retail value building on the strong growth experienced the prior year the number of paid subscriptions grew to a record high of 90 million with revenues up 10 to 50 billion and comprising almost twothirds of the first half total at wholesale value revenues grew 8 to 49 billionpblockquote
pin the visualization above you can see the followingp
ullithe dominance of vinyl records from 1973 through the early 1980s with more than a 50 market share in every year until 1984 and at least a twothirds market share until 1980lilithe remarkable resurgence of vinyl record sales in the first half of 2022 which have exceeded the market share of cds for the first time in 2020 54 vs 4 2021 66 vs 29 and the first half of 2022 74 vs 26 the 74 format share for vinyl records in the first half of this year was the highest share for lps since 1988lilithe fall of 8track tape sales from about a 25 market share between 19731976 to 0 by 1982 as cassette tapes entered the market lilicassette tapes outsold 8track tapes for the first time in 1980 and then outsold lps in 1984 for the first time and maintained at least a 50 market share between 1984 and 1989lilithe gradual rise of cds starting in 1983 when they were only 050 of recorded music sales overtaking lp sales in 1987 and then cassette sales in 1991 before reaching a peak market share of 957 in 2002 this year cds sales represented only 26 of recorded music sales the lowest share since 24 in 1984 and cds only accounted for 26 of physical sales revenues while vinyl accounted for nearly 34 of physical format revenues lilithe rise in the market share of downloaded music singles and albums from 15 in 2004 to a peak market share of 41 in 2012 when it surpassed the cd market share for the first time through midyear 2022 the market share for downloaded music fell to 33 the lowest since a 15 share in 2004 when itunes were first availablelilithe rise in the market share of strongpaid digital subscriptionstreaming servicesstrong starting from only a 12 market share in 2005 to surpassing the market share for cds in 2014 by 274 to 266 and then surpassing the digital download music share 347 to 337 the following year on the way to a majority market share in 2016 524 and then the new 842 recordhigh market share this year through juneliul
pthe rise and fall of music formats over the last halfcentury for vinyl records 8track tapes cassette tapes cds digital downloads and now streaming music is a good example of the economic concept of strongcreative destructionstrong in the recorded music business according to economist joseph schumpeter the gales of creative destruction describe the processes of industrial mutation that continuously revolutionize the economic structure from within incessantly destroying the old ones incessantly creating new ones physical music formats lps tapes cds have been destroyed and have now pretty much all been replaced with streaming music and in each successive destruction and mutation the music formats got better cheaper more widely available and more convenient p
precord music sales are on track to reach 154 billion by the end of the year which is just a little more than half of the peak music sales of 26 billion in constant 2022 dollars in 1999 what that means is that consumers today spend much less outofpocket today for recorded music than consumers in decades like the 1970s when vinyl records dominated and the 1990s and 2000s when cds were more than 90 of recorded music sales with one remarkable difference consumers today have convenient lowcost streaming access to almost the entire collection of music that has ever been recorded with a a relnoreferrer noopener hrefhttpswwwspotifycomuspremiumplans target_blankspotify subscriptiona that costs only 499 per month for students 999 for individuals and 1599 for families or even free with ads with no price increases since last year and music listeners today arent burdened with large collections of physical lps or cds that take up lots of physical space and are timeconsuming to keep organized nor do they have to buy expensive stereo equipment turntables amplifiers cd players and speakers like in the past p
pits another example of why its such an amazing time to be alive especially if youre a music lover recorded music today is cheaper more abundant and more convenient than ever before in human history for 999 per month you can conveniently access an unlimited amount of highquality music think about it for about 30 cents a day the worlds entire music library is at your fingertips what a tremendous bargain the great what p
pstrongrelatedstrong the abundance of lowcost almost free music also illustrates one of the shortcomings of traditional gdp accounting when it comes to measuring our economic wellbeing or standard of living americans music wellbeing is clearly at an alltime high for the reasons discussed above but according to official gdp statistics that include retail music sales the nations music wellbeing today measured by 154 billion in projected sales this year is about half of what it was in 1999 when music sales were 26 billion in 2022 dollars according to official gdp accounting the golden age of music was back in 1999 during the era of cds when its obvious that were experiencing the most miraculous music renaissance in history with streaming music that isnt remotely being captured by national income accounting p
p p
p p
pthe post a relnofollow hrefhttpswwwaeiorgcarpediemanimatedchartofthedayrecordedmusicsalesbyformatshare1973to2022animated chart of the day recorded music sales by format share 1973 to 2022a appeared first on a relnofollow hrefhttpswwwaeiorgamerican enterprise institute aeiap
|
div datasrcvisualisation1458501div pmy latest animated bar chart race visualization click arrow start shows format shares recorded music sales annually 1973 2022 based ona relnoreferrer noopener hrefhttpswwwriaacomwpcontentuploads202209midyear2022riaamusicrevenuereport1pdf target_blank new midyear sales dataa released today recording industry industry association america riaa half 2022 riaa reports summary music sales half year p blockquote classwpblockquotepus recorded music revenues half 2022 rose 9 77 billion estimated retail value building strong growth experienced prior year number paid subscriptions grew record high 90 million revenues 10 50 billion comprising twothirds half total wholesale value revenues grew 8 49 billionpblockquote pin visualization followingp ullithe dominance vinyl records 1973 early 1980s 50 market share year 1984 twothirds market share 1980lilithe remarkable resurgence vinyl record sales half 2022 exceeded market share cds time 2020 54 vs 4 2021 66 vs 29 half 2022 74 vs 26 74 format share vinyl records half year highest share lps 1988lilithe fall 8track tape sales 25 market share 19731976 0 1982 cassette tapes entered market lilicassette tapes outsold 8track tapes time 1980 outsold lps 1984 time maintained 50 market share 1984 1989lilithe gradual rise cds starting 1983 050 recorded music sales overtaking lp sales 1987 cassette sales 1991 reaching peak market share 957 2002 year cds sales represented 26 recorded music sales lowest share 24 1984 cds accounted 26 physical sales revenues vinyl accounted nearly 34 physical format revenues lilithe rise market share downloaded music singles albums 15 2004 peak market share 41 2012 surpassed cd market share time midyear 2022 market share downloaded music fell 33 lowest 15 share 2004 itunes availablelilithe rise market share strongpaid digital subscriptionstreaming servicesstrong starting 12 market share 2005 surpassing market share cds 2014 274 266 surpassing digital download music share 347 337 following year way majority market share 2016 524 new 842 recordhigh market share year juneliul pthe rise fall music formats halfcentury vinyl records 8track tapes cassette tapes cds digital downloads streaming music good example economic concept strongcreative destructionstrong recorded music business according economist joseph schumpeter gales creative destruction describe processes industrial mutation continuously revolutionize economic structure incessantly destroying old ones incessantly creating new ones physical music formats lps tapes cds destroyed pretty replaced streaming music successive destruction mutation music formats got better cheaper widely available convenient p precord music sales track reach 154 billion end year little half peak music sales 26 billion constant 2022 dollars 1999 means consumers today spend outofpocket today recorded music consumers decades like 1970s vinyl records dominated 1990s 2000s cds 90 recorded music sales remarkable difference consumers today convenient lowcost streaming access entire collection music recorded relnoreferrer noopener hrefhttpswwwspotifycomuspremiumplans target_blankspotify subscriptiona costs 499 month students 999 individuals 1599 families free ads price increases year music listeners today arent burdened large collections physical lps cds lots physical space timeconsuming organized buy expensive stereo equipment turntables amplifiers cd players speakers like past p pits example amazing time alive especially youre music lover recorded music today cheaper abundant convenient human history 999 month conveniently access unlimited highquality music think 30 cents day worlds entire music library fingertips tremendous bargain great p pstrongrelatedstrong abundance lowcost free music illustrates shortcomings traditional gdp accounting comes measuring economic wellbeing standard living americans music wellbeing clearly alltime high reasons discussed according official gdp statistics include retail music sales nations music wellbeing today measured 154 billion projected sales year half 1999 music sales 26 billion 2022 dollars according official gdp accounting golden age music 1999 era cds obvious experiencing miraculous music renaissance history streaming music isnt remotely captured national income accounting p p p p p pthe post relnofollow hrefhttpswwwaeiorgcarpediemanimatedchartofthedayrecordedmusicsalesbyformatshare1973to2022animated chart day recorded music sales format share 1973 2022a appeared relnofollow hrefhttpswwwaeiorgamerican enterprise institute aeiap
|
632e344700beacfbb91d078f
|
What should I ask Ken Burns?
|
pi will be doing a conversation with him here is the beginning of a relnoopener hrefhttpsenwikipediaorgwikiken_burns target_blankhis rather formidable wikipedia entryap
blockquotepbkenneth lauren burnsbsupsup born july 29 1953 is an american filmmaker known for his a titledocumentary film hrefhttpsenwikipediaorgwikidocumentary_filmdocumentarya films and television series many of which chronicle a titleunited states hrefhttpsenwikipediaorgwikiunited_statesamericana a titlehistory of the united states hrefhttpsenwikipediaorgwikihistory_of_the_united_stateshistorya and a titleculture of the united states hrefhttpsenwikipediaorgwikiculture_of_the_united_statesculturea his work is often produced in association with a titlewetatv hrefhttpsenwikipediaorgwikiwetatvwetatva andor the a titlenational endowment for the humanities hrefhttpsenwikipediaorgwikinational_endowment_for_the_humanitiesnational endowment for the humanitiesa and distributed by a titlepbs hrefhttpsenwikipediaorgwikipbspbsap
phis widely known documentary series include ia titlethe civil war miniseries hrefhttpsenwikipediaorgwikithe_civil_war_miniseriesthe civil warai 1990 ia titlebaseball tv series hrefhttpsenwikipediaorgwikibaseball_tv_seriesbaseballai 1994 ia hrefhttpsenwikipediaorgwikijazz_tv_series titlejazz tv seriesjazzai 2001 ia titlethe war miniseries hrefhttpsenwikipediaorgwikithe_war_miniseriesthe warai 2007 ia titlethe national parks americas best idea hrefhttpsenwikipediaorgwikithe_national_parks_america27s_best_ideathe national parks americas best ideaai 2009 ia titleprohibition miniseries hrefhttpsenwikipediaorgwikiprohibition_miniseriesprohibitionai 2011 ia titlethe roosevelts miniseries hrefhttpsenwikipediaorgwikithe_roosevelts_miniseriesthe rooseveltsai 2014 ia titlethe vietnam war tv series hrefhttpsenwikipediaorgwikithe_vietnam_war_tv_seriesthe vietnam warai 2017 and ia titlecountry music miniseries hrefhttpsenwikipediaorgwikicountry_music_miniseriescountry musicai 2019 he was also executive producer of both ia titlethe west miniseries hrefhttpsenwikipediaorgwikithe_west_miniseriesthe westai 1996 and ia titlecancer film hrefhttpsenwikipediaorgwikicancer_filmcancer the emperor of all maladiesai 2015supsup burnss documentaries have earned two a titleacademy awards hrefhttpsenwikipediaorgwikiacademy_awardsacademy awarda nominations for 1981s ia titlebrooklyn bridge film hrefhttpsenwikipediaorgwikibrooklyn_bridge_filmbrooklyn bridgeai and 1985s ia titlethe statue of liberty film hrefhttpsenwikipediaorgwikithe_statue_of_liberty_filmthe statue of libertyai and have won several a hrefhttpsenwikipediaorgwikiemmy_award titleemmy awardemmy awardsa among other honorspblockquote
phis forthcoming book is the lovely a relnoopener hrefhttpswwwamazoncomouramericaphotographickenburnsdp0385353014refsr_1_1crid21rapmx78lld4keywordskenburnsbookqid1663961733sprefixkenburnsbook2caps2c185sr81 target_blankour america a photographic historya so what should i askp
pthe post a relnofollow hrefhttpmarginalrevolutioncommarginalrevolution202209whatshouldiaskkenburnshtmlwhat should i ask ken burnsa appeared first on a relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap
|
pi conversation beginning relnoopener hrefhttpsenwikipediaorgwikiken_burns target_blankhis formidable wikipedia entryap blockquotepbkenneth lauren burnsbsupsup born july 29 1953 american filmmaker known titledocumentary film hrefhttpsenwikipediaorgwikidocumentary_filmdocumentarya films television series chronicle titleunited states hrefhttpsenwikipediaorgwikiunited_statesamericana titlehistory united states hrefhttpsenwikipediaorgwikihistory_of_the_united_stateshistorya titleculture united states hrefhttpsenwikipediaorgwikiculture_of_the_united_statesculturea work produced association titlewetatv hrefhttpsenwikipediaorgwikiwetatvwetatva andor titlenational endowment humanities hrefhttpsenwikipediaorgwikinational_endowment_for_the_humanitiesnational endowment humanitiesa distributed titlepbs hrefhttpsenwikipediaorgwikipbspbsap phis widely known documentary series include ia titlethe civil war miniseries hrefhttpsenwikipediaorgwikithe_civil_war_miniseriesthe civil warai 1990 ia titlebaseball tv series hrefhttpsenwikipediaorgwikibaseball_tv_seriesbaseballai 1994 ia hrefhttpsenwikipediaorgwikijazz_tv_series titlejazz tv seriesjazzai 2001 ia titlethe war miniseries hrefhttpsenwikipediaorgwikithe_war_miniseriesthe warai 2007 ia titlethe national parks americas best idea hrefhttpsenwikipediaorgwikithe_national_parks_america27s_best_ideathe national parks americas best ideaai 2009 ia titleprohibition miniseries hrefhttpsenwikipediaorgwikiprohibition_miniseriesprohibitionai 2011 ia titlethe roosevelts miniseries hrefhttpsenwikipediaorgwikithe_roosevelts_miniseriesthe rooseveltsai 2014 ia titlethe vietnam war tv series hrefhttpsenwikipediaorgwikithe_vietnam_war_tv_seriesthe vietnam warai 2017 ia titlecountry music miniseries hrefhttpsenwikipediaorgwikicountry_music_miniseriescountry musicai 2019 executive producer ia titlethe west miniseries hrefhttpsenwikipediaorgwikithe_west_miniseriesthe westai 1996 ia titlecancer film hrefhttpsenwikipediaorgwikicancer_filmcancer emperor maladiesai 2015supsup burnss documentaries earned titleacademy awards hrefhttpsenwikipediaorgwikiacademy_awardsacademy awarda nominations 1981s ia titlebrooklyn bridge film hrefhttpsenwikipediaorgwikibrooklyn_bridge_filmbrooklyn bridgeai 1985s ia titlethe statue liberty film hrefhttpsenwikipediaorgwikithe_statue_of_liberty_filmthe statue libertyai won hrefhttpsenwikipediaorgwikiemmy_award titleemmy awardemmy awardsa honorspblockquote phis forthcoming book lovely relnoopener hrefhttpswwwamazoncomouramericaphotographickenburnsdp0385353014refsr_1_1crid21rapmx78lld4keywordskenburnsbookqid1663961733sprefixkenburnsbook2caps2c185sr81 target_blankour america photographic historya askp pthe post relnofollow hrefhttpmarginalrevolutioncommarginalrevolution202209whatshouldiaskkenburnshtmlwhat ask ken burnsa appeared relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap
|
632e347e00beacfbb91d0797
|
The Education Department Asked for Public Comments on Sex Discrimination. It Got an Earful About Trans Athletes Instead.
|
div
picture
source sizesminwidth 600px 331px 100vw typeimagewebp srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202209iconphotossix0733022400x1350jpgwebp 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202209iconphotossix0733021200x675jpgwebp 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202209iconphotossix073302800x450jpgwebp 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202209iconphotossix073302600x338jpgwebp 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202209iconphotossix073302331x186jpgwebp 331w
source sizesminwidth 600px 331px 100vw typeimagejpeg srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202209iconphotossix0733022400x1350jpg 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202209iconphotossix0733021200x675jpg 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202209iconphotossix073302800x450jpg 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202209iconphotossix073302600x338jpg 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202209iconphotossix073302331x186jpg 331w
img width1200 altlia thomas swimming srchttpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202209iconphotossix073302800x450jpg height675
picture
div
pspanthespan a hrefhttpswwwedgovnewspressreleasesusdepartmenteducationreleasesproposedchangestitleixregulationsinvitespubliccommentspanpublic commentspanaspan period for education secretary miguel cardonas proposed changes to officialspan a hrefhttpswww2edgovaboutofficeslistocrdocst9nprmpdfspantitle ix regulationsspanaspan ended in august the education department receivedspan a hrefhttpswwwfederalregistergovdocuments20220712202213734nondiscriminationonthebasisofsexineducationprogramsoractivitiesreceivingfederalspanoverspanaspan 210000 comments with around 40 percent of those comments available on a public databasespanp
pspanin june the department released over 700 pages ofspan a hrefhttpswww2edgovaboutofficeslistocrdocst9nprmpdfspanproposed regulationsspana thespan two most controversial provisionsa a hrefhttpsreasoncom20220915bidengutstitleixdueprocessreversal of many of the due process protectionsa for accused students during title ix investigations and a redefinition of quotsex discriminationquot to include discrimination based on sexual orientation and gender identityignited a flurry of bothspan a hrefhttpsreasoncom20220623titleixrulescardonabidensexualmisconductcampusspancriticismspanaspan andspan a hrefhttpswwwnprorg202206231107045291titleix9bidenexpandvictimprotectionsdiscriminationspanpraisespanaspan from media commentators it is unclear when official rules will be released or by how much if at all the proposed regulations will differ from the final rulesspanp
pspanwhile the comment period is theoretically meant to guide regulators decisions and provide feedback on their rules a large portion of the public comments appears to be expressing consternation over a subject irrelevant to this most recent spate of title ix rules transgender athletes in womens sportsspanp
pspancardonas proposed regulations purposefully left out specific rules surrounding transgender athletes instead a hrefhttpswwwedgovnewspressreleasesusdepartmenteducationreleasesproposedchangestitleixregulationsinvitespubliccommentelectinga to quotengage in a separate rulemaking to address title ixs application to athleticsquotspanp
pspanunder the newspan a hrefhttpswww2edgovaboutofficeslistocrdocst9nprmpdfspanrulesspanaspan the department of education would understand quotsex discrimination [as including] discrimination on the basis of sexual orientation and gender identityquot the proposed regulations would also bar schools from quotadopting a policy or engaging in a practice that prevents a person from participating in an education program or activity consistent with their gender identityquot while these proposed regulations would likely apply to other sexsegregated facilities in schools such as bathrooms and locker rooms the department has explicitly waited to announce how they would apply to sports spanp
pthere is also reason to believe there will be a legal fight before the proposed regulations could even be enforced in some states in july a federal judge a hrefhttpswwwpoliticocomnews20220716educationdepartmentstitleixguidancetransgenderstudents00046209placeda a preliminary injunction against the new definition of sex discrimination arguing that it directly conflicts with existing laws in 20 statesp
pspandespite this of the 88000 comments available on thespan a hrefhttpswwwregulationsgovdocumented2021ocr01660001commentfilteraccusespanregulationsgovspanaspan website on september 23 a significant portion appeared to be at least in part expressing concern about transgender athletes for example thespan a hrefhttpswwwregulationsgovdocumented2021ocr01660001commentfiltergender20sportsspantermsspanaspan quotgenderquot and quotsportsquot appeared in 28301 comments quotsexquot and quotsportsquotspan a hrefhttpswwwregulationsgovdocumented2021ocr01660001commentfiltersex20sportsspanappearedspanaspan in a similar 28646 comments thespan a hrefhttpswwwregulationsgovdocumented2021ocr01660001commentfiltersportsspantermspanaspan quotsportsquot alone appeared in 37777 commentsspanp
pspanone commonspan a hrefhttpswwwregulationsgovcommented2021ocr01661814spancommentspanaspanpresumably a sample letter provided by an organization though i wasnt able to determine which oneread quotspanspanthis proposed rule forces girls to give up their educational opportunities to males who perform better than they doquot while it doesnt explicitly mention sports this comment clearly seems to refer to the concern that trans women athletes will take sports scholarships or places on teams from female athletesspanp
pspanin contrast search terms relevant to due process concerns for students accused of sexual assault and other violations were far less common the term quotdue processquot a hrefhttpswwwregulationsgovdocumented2021ocr01660001commentfilter22due20process22gaineda 3032 hits and forms of quotspana hrefhttpswwwregulationsgovdocumented2021ocr01660001commentfilteraccusespanaccusespanaspanquot other forms of the word like quotaccuserquot and quotaccusationquot were included in the search appeared spanspanin only 2796 comments thespan a hrefhttpswwwregulationsgovdocumented2021ocr01660001commentfiltervictimspantermspanaspan quotvictimquot appeared in 2422 commentsspanp
pspanthe intensity of the attention focused on transgender athletes even as the subject has only tangential relation to the current regulations up for debate indicates that public concern over the issue isnt going away anytime soon the public comments submitted on cardonas proposed title ix regulations show how desperately comprehensive rules for transgender athletes are needed in particular we need a rule that recognizes that both women and transgender women are protected classesboth have liberties that need to be preservedspanp
pspanhowever the degree to which the subject has captured public attention will make it difficult to develop sensible policy good minimally invasive policy is rarely compatible with a culture war spanp
pthe post a relnofollow hrefhttpsreasoncom20220923theeducationdepartmentaskedforpubliccommentsonsexdiscriminationitgotanearfulabouttransathletesinsteadthe education department asked for public comments on sex discrimination it got an earful about trans athletes insteada appeared first on a relnofollow hrefhttpsreasoncomreasoncomap
|
div picture source sizesminwidth 600px 331px 100vw typeimagewebp srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202209iconphotossix0733022400x1350jpgwebp 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202209iconphotossix0733021200x675jpgwebp 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202209iconphotossix073302800x450jpgwebp 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202209iconphotossix073302600x338jpgwebp 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202209iconphotossix073302331x186jpgwebp 331w source sizesminwidth 600px 331px 100vw typeimagejpeg srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202209iconphotossix0733022400x1350jpg 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202209iconphotossix0733021200x675jpg 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202209iconphotossix073302800x450jpg 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202209iconphotossix073302600x338jpg 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202209iconphotossix073302331x186jpg 331w img width1200 altlia thomas swimming srchttpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202209iconphotossix073302800x450jpg height675 picture div pspanthespan hrefhttpswwwedgovnewspressreleasesusdepartmenteducationreleasesproposedchangestitleixregulationsinvitespubliccommentspanpublic commentspanaspan period education secretary miguel cardonas proposed changes officialspan hrefhttpswww2edgovaboutofficeslistocrdocst9nprmpdfspantitle ix regulationsspanaspan ended august education department receivedspan hrefhttpswwwfederalregistergovdocuments20220712202213734nondiscriminationonthebasisofsexineducationprogramsoractivitiesreceivingfederalspanoverspanaspan210000 comments 40 percent comments available public databasespanp pspanin june department released 700 pages ofspan hrefhttpswww2edgovaboutofficeslistocrdocst9nprmpdfspanproposed regulationsspana thespan controversial provisionsa hrefhttpsreasoncom20220915bidengutstitleixdueprocessreversal process protectionsa accused students title ix investigations redefinition quotsex discriminationquot include discrimination based sexual orientation gender identityignited flurry bothspan hrefhttpsreasoncom20220623titleixrulescardonabidensexualmisconductcampusspancriticismspanaspan andspan hrefhttpswwwnprorg202206231107045291titleix9bidenexpandvictimprotectionsdiscriminationspanpraisespanaspan media commentators unclear official rules released proposed regulations differ final rulesspanp pspanwhile comment period theoretically meant guide regulators decisions provide feedback rules large portion public comments appears expressing consternation subject irrelevant recent spate title ix rules transgender athletes womens sportsspanp pspancardonas proposed regulations purposefully left specific rules surrounding transgender athletes instead hrefhttpswwwedgovnewspressreleasesusdepartmenteducationreleasesproposedchangestitleixregulationsinvitespubliccommentelectinga quotengage separate rulemaking address title ixs application athleticsquotspanp pspanunder newspan hrefhttpswww2edgovaboutofficeslistocrdocst9nprmpdfspanrulesspanaspan department education understand quotsex discrimination [as including] discrimination basis sexual orientation gender identityquot proposed regulations bar schools quotadopting policy engaging practice prevents person participating education program activity consistent gender identityquot proposed regulations likely apply sexsegregated facilities schools bathrooms locker rooms department explicitly waited announce apply sports spanp pthere reason believe legal fight proposed regulations enforced states july federal judge hrefhttpswwwpoliticocomnews20220716educationdepartmentstitleixguidancetransgenderstudents00046209placeda preliminary injunction new definition sex discrimination arguing directly conflicts existing laws 20 statesp pspandespite 88000 comments available thespan hrefhttpswwwregulationsgovdocumented2021ocr01660001commentfilteraccusespanregulationsgovspanaspan website september 23 significant portion appeared expressing concern transgender athletes example thespan hrefhttpswwwregulationsgovdocumented2021ocr01660001commentfiltergender20sportsspantermsspanaspan quotgenderquot quotsportsquot appeared 28301 comments quotsexquot quotsportsquotspan hrefhttpswwwregulationsgovdocumented2021ocr01660001commentfiltersex20sportsspanappearedspanaspan similar 28646 comments thespan hrefhttpswwwregulationsgovdocumented2021ocr01660001commentfiltersportsspantermspanaspan quotsportsquot appeared 37777 commentsspanp pspanone commonspan hrefhttpswwwregulationsgovcommented2021ocr01661814spancommentspanaspanpresumably sample letter provided organization wasnt able determine oneread quotspanspanthis proposed rule forces girls educational opportunities males perform better doquot doesnt explicitly mention sports comment clearly refer concern trans women athletes sports scholarships places teams female athletesspanp pspanin contrast search terms relevant process concerns students accused sexual assault violations far common term quotdue processquot hrefhttpswwwregulationsgovdocumented2021ocr01660001commentfilter22due20process22gaineda 3032 hits forms quotspana hrefhttpswwwregulationsgovdocumented2021ocr01660001commentfilteraccusespanaccusespanaspanquot forms word like quotaccuserquot quotaccusationquot included search appeared spanspanin 2796comments thespan hrefhttpswwwregulationsgovdocumented2021ocr01660001commentfiltervictimspantermspanaspan quotvictimquot appeared 2422commentsspanp pspanthe intensity attention focused transgender athletes subject tangential relation current regulations debate indicates public concern issue isnt going away anytime soon public comments submitted cardonas proposed title ix regulations desperately comprehensive rules transgender athletes needed particular need rule recognizes women transgender women protected classesboth liberties need preservedspanp pspanhowever degree subject captured public attention difficult develop sensible policy good minimally invasive policy rarely compatible culture warspanp pthe post relnofollow hrefhttpsreasoncom20220923theeducationdepartmentaskedforpubliccommentsonsexdiscriminationitgotanearfulabouttransathletesinsteadthe education department asked public comments sex discrimination got earful trans athletes insteada appeared relnofollow hrefhttpsreasoncomreasoncomap
|
632e348000beacfbb91d0799
|
Let’s Be Honest About the Iran Nuclear Deal
|
there are several politically inconvenient realities its detractors and defenders should consider
|
politically inconvenient realities detractors defenders consider
|
632e370b00beacfbb91d07e5
|
The revenge of the material economy
|
pthe post a relnofollow hrefhttpswwwspikedonlinecom20220923therevengeofthematerialeconomythe revenge of the material economya appeared first on a relnofollow hrefhttpswwwspikedonlinecomspikedap
|
pthe post relnofollow hrefhttpswwwspikedonlinecom20220923therevengeofthematerialeconomythe revenge material economya appeared relnofollow hrefhttpswwwspikedonlinecomspikedap
|
632e373a00beacfbb91d07eb
|
The quote machine
|
pthe pages of the gazette are rich with research history analysis debate and voices over the years weve heard from scholars researchers scientists artists and authors of course but also soldiers activists nurses even a racecar driver after taking a look back we wanted to share what we found this collection is necessarily and intentionally incomplete and also very much alive read on and then come back in a month to see whose inspired moment has been added to the listp
p p
div
figure
div
img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg width1350 altquotation mark srcsethttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2300x31jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21024x106jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2768x80jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21536x159jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_qm_test22048x212jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21500x155jpg 1500w height140 div
figure
div
h3i am oddly mistrustful of easeh3
div
figure
div
img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202209202209_ql_messud1350x491jpg width1350 altclaire messud srcsethttpsnewsharvardeduwpcontentuploads202209202209_ql_messud1350x491jpg 1350w httpsnewsharvardeduwpcontentuploads202209202209_ql_messud300x109jpg 300w httpsnewsharvardeduwpcontentuploads202209202209_ql_messud1024x373jpg 1024w httpsnewsharvardeduwpcontentuploads202209202209_ql_messud768x280jpg 768w httpsnewsharvardeduwpcontentuploads202209202209_ql_messud1536x559jpg 1536w httpsnewsharvardeduwpcontentuploads202209202209_ql_messud2048x745jpg 2048w httpsnewsharvardeduwpcontentuploads202209202209_ql_messud1500x546jpg 1500w height491 div
figure
div
pspan claire messud author a hrefhttpsnewsharvardedugazettestory201602turnsofnarrativeturns of narrativeaspanp
hr
div
figure
div
img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg width1350 altquotation mark srcsethttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2300x31jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21024x106jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2768x80jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21536x159jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_qm_test22048x212jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21500x155jpg 1500w height140 div
figure
div
h3i think i learned through art through dada through surrealism how to trust in myself and when i learned how to trust in myself the last place i wanted to be was inside i wanted to go out i wanted to be engaged in the worldh3
pspan jeff koons artist a hrefhttpsnewsharvardedugazettestory201702jeffkoonshighkingofmiddlebrowhigh king of middlebrowaspanp
hr
div
figure
div
img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg width1350 altquotation mark srcsethttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2300x31jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21024x106jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2768x80jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21536x159jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_qm_test22048x212jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21500x155jpg 1500w height140 div
figure
div
h3experience is the higgs boson of normativity its the value that gives so many of our values their value why for example do we value honesty you could say that honesty is valuable in and of itself but would we value honesty in this gutlevel way if it were not generally beneficial when people are dishonest it causes harm it negatively impacts our lived experienceh3
div
figure
div
img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_ql_greenej_test1350x491jpg width1350 altjoshua greene srcsethttpsnewsharvardeduwpcontentuploads202208202208_ql_greenej_test1350x491jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_ql_greenej_test300x109jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_ql_greenej_test1024x373jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_ql_greenej_test768x280jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_ql_greenej_test1536x559jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_ql_greenej_test2048x745jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_ql_greenej_test1500x546jpg 1500w height491 div
figure
div
pspan joshua greene psychologist a hrefhttpsnewsharvardedugazettestory201311deeppragmatismasamoralenginedeep pragmatism as a moral engineaspanp
hr
div
figure
div
img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg width1350 altquotation mark srcsethttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2300x31jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21024x106jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2768x80jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21536x159jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_qm_test22048x212jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21500x155jpg 1500w height140 div
figure
div
h3as the sun rose and it got hotter and hotter we started passing the horses near the top of the mountain around mile 18 passing those horses was one of the biggest thrills of my running life ive also never felt so competitive as i was racing those horses toward the end i had an indescribably primal urge to beat themh3
div
figure
div
img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_ql_liebermand_test1350x491jpg width1350 altdaniel lieberman srcsethttpsnewsharvardeduwpcontentuploads202208202208_ql_liebermand_test1350x491jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_ql_liebermand_test300x109jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_ql_liebermand_test1024x373jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_ql_liebermand_test768x280jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_ql_liebermand_test1536x559jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_ql_liebermand_test2048x745jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_ql_liebermand_test1500x546jpg 1500w height491 div
figure
div
pspan daniel lieberman evolutionary biologist a hrefhttpsnewsharvardedugazettestory201804harvardevolutionarybiologistdanielliebermanonthepastpresentandfutureofspeedhow fast can we runaspanp
hr
div
figure
div
img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg width1350 altquotation mark srcsethttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2300x31jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21024x106jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2768x80jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21536x159jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_qm_test22048x212jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21500x155jpg 1500w height140 div
figure
div
h3loneliness kills its as powerful as smoking or alcoholismh3
pspan robert waldinger psychiatrist a hrefhttpsnewsharvardedugazettestory201704overnearly80yearsharvardstudyhasbeenshowinghowtoliveahealthyandhappylifegood genes are nice but joy is betteraspanp
hr
div
figure
div
img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg width1350 altquotation mark srcsethttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2300x31jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21024x106jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2768x80jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21536x159jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_qm_test22048x212jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21500x155jpg 1500w height140 div
figure
div
h3i love writing essays and i hate writing books the ideas for the books ive written generally come from things that i come across in the archives and that i think are important and that i wish people knew about i wish someone else would write a book about them so that i could read it so that it could exist and be read by other people but since no one has already written that book i feel like i have to its awfulh3
div
figure
div
img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_ql_leporej_test1350x491jpg width1350 altjill lepore srcsethttpsnewsharvardeduwpcontentuploads202208202208_ql_leporej_test1350x491jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_ql_leporej_test300x109jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_ql_leporej_test1024x373jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_ql_leporej_test768x280jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_ql_leporej_test1536x559jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_ql_leporej_test2048x745jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_ql_leporej_test1500x546jpg 1500w height491 div
figure
div
pspan jill lepore historian a hrefhttpsnewsharvardedugazettestory201704thewritinglifeofharvardhistorianjillleporethe art of the matteraspanp
hr
div
figure
div
img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg width1350 altquotation mark srcsethttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2300x31jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21024x106jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2768x80jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21536x159jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_qm_test22048x212jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21500x155jpg 1500w height140 div
figure
div
h3i remember walking on the street past a person who had been at the firm where i was someone with whom i had worked and the person just passed by me and didnt even know who i was i recognized him he didnt recognize me and i remember thinking i gave time to this enterprise that i could have given to my mother it might have felt more justifiable in some way if i were actually doing something that i loved doing i think she would have understood that so thats my regret and she would say that thats ridiculous i didnt have as much time with her as i expected i would haveh3
div
figure
div
img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_ql_agr1350x491jpg width1350 altannette gordon reed srcsethttpsnewsharvardeduwpcontentuploads202208202208_ql_agr1350x491jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_ql_agr300x109jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_ql_agr1024x373jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_ql_agr768x280jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_ql_agr1536x559jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_ql_agr2048x745jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_ql_agr1500x546jpg 1500w height491 div
figure
div
pspan annette gordonreed historian a hrefhttpsnewsharvardedugazettestory201705pulitzerprizewinnerannettegordonreedreflectsonherpersonalhistoryexperienceaspanp
hr
div
figure
div
img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg width1350 altquotation mark srcsethttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2300x31jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21024x106jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2768x80jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21536x159jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_qm_test22048x212jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21500x155jpg 1500w height140 div
figure
div
h3good poetry all has a similar quality which is it moves us it sings to us it says something perhaps surprising or unexpected or maybe it says something we hadnt realized we thought or knew or felt it gives voice but it also seeks silenceh3
div
figure
div
img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_ql_youngk1350x491jpg width1350 altkevin young srcsethttpsnewsharvardeduwpcontentuploads202208202208_ql_youngk1350x491jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_ql_youngk300x109jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_ql_youngk1024x373jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_ql_youngk768x280jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_ql_youngk1536x559jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_ql_youngk2048x745jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_ql_youngk1500x546jpg 1500w height491 div
figure
div
pspan kevin young poet a hrefhttpsnewsharvardedugazettestory202011kevinyoung92discussesnewroleasmuseumdirectorkevin young and a unified theory of black culture and himselfaspanp
hr
div
figure
div
img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg width1350 altquotation mark srcsethttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2300x31jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21024x106jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2768x80jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21536x159jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_qm_test22048x212jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21500x155jpg 1500w height140 div
figure
div
h3you walk in and theres a performance that onetime performance for that patient you want the scar to be beautiful because the kids are going to have that for god willing 70 or 80 yearsh3
pspan terry buchmiller surgeon and musician a hrefhttpsnewsharvardedugazettestory201505leavingabeautifulscarleaving a beautiful scaraspanp
hr
div
figure
div
img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg width1350 altquotation mark srcsethttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2300x31jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21024x106jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2768x80jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21536x159jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_qm_test22048x212jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21500x155jpg 1500w height140 div
figure
div
h3if determinism the predictability of the universe breaks down in black holes it could break down in other situations even worse if determinism breaks down we cant be sure of our past history either the history books and our memories could just be illusions it is the past that tells us who we are without it we lose our identityh3
div
figure
div
img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_ql_hawking1350x491jpg width1350 altstephen hawking srcsethttpsnewsharvardeduwpcontentuploads202208202208_ql_hawking1350x491jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_ql_hawking300x109jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_ql_hawking1024x373jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_ql_hawking768x280jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_ql_hawking1536x559jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_ql_hawking2048x745jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_ql_hawking1500x546jpg 1500w height491 div
figure
div
pspan stephen hawking 19422018 physicist a hrefhttpsnewsharvardedugazettestory201604hawkingatharvardhawking at harvardaspanp
hr
div
figure
div
img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg width1350 altquotation mark srcsethttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2300x31jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21024x106jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2768x80jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21536x159jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_qm_test22048x212jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21500x155jpg 1500w height140 div
figure
div
h3why do i talk about the benefits of failure simply because failure meant a stripping away of the inessential i stopped pretending to myself that i was anything other than what i was and began to direct all my energy into finishing the only work that mattered to meh3
div
figure
div
img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_ql_rowling1350x491jpg width1350 altjk rowling srcsethttpsnewsharvardeduwpcontentuploads202208202208_ql_rowling1350x491jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_ql_rowling300x109jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_ql_rowling1024x373jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_ql_rowling768x280jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_ql_rowling1536x559jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_ql_rowling2048x745jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_ql_rowling1500x546jpg 1500w height491 div
figure
div
pspan jk rowling novelist a hrefhttpsnewsharvardedugazettestory200806textofjkrowlingspeechthe fringe benefits of failure and the importance of imaginationaspanp
hr
div
figure
div
img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg width1350 altquotation mark srcsethttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2300x31jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21024x106jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2768x80jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21536x159jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_qm_test22048x212jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21500x155jpg 1500w height140 div
figure
div
h3ignorance acknowledged is an opportunity ignorance denied is a closed door and it takes courage to admit to the truth of what you do not knowh3
div
figure
div
img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_ql_adichie1350x491jpg width1350 altchimamanda ngozi adichie srcsethttpsnewsharvardeduwpcontentuploads202208202208_ql_adichie1350x491jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_ql_adichie300x109jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_ql_adichie1024x373jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_ql_adichie768x280jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_ql_adichie1536x559jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_ql_adichie2048x745jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_ql_adichie1500x546jpg 1500w height491 div
figure
div
pspan chimamanda ngozi adichie novelist a hrefhttpsnewsharvardedugazettestory201805harvardsclassdayspeakerurgesstudentstoprotectandvaluethetruthintheirownlivesadichie protect and value the truthaspanp
hr
div
figure
div
img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg width1350 altquotation mark srcsethttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2300x31jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21024x106jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2768x80jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21536x159jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_qm_test22048x212jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21500x155jpg 1500w height140 div
figure
div
h3wellbehaved women seldom make historyh3
div
figure
div
img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202209202209_ql_ulrich1350x491jpg width1350 altlaurel thatcher ulrich srcsethttpsnewsharvardeduwpcontentuploads202209202209_ql_ulrich1350x491jpg 1350w httpsnewsharvardeduwpcontentuploads202209202209_ql_ulrich300x109jpg 300w httpsnewsharvardeduwpcontentuploads202209202209_ql_ulrich1024x373jpg 1024w httpsnewsharvardeduwpcontentuploads202209202209_ql_ulrich768x280jpg 768w httpsnewsharvardeduwpcontentuploads202209202209_ql_ulrich1536x559jpg 1536w httpsnewsharvardeduwpcontentuploads202209202209_ql_ulrich2048x745jpg 2048w httpsnewsharvardeduwpcontentuploads202209202209_ql_ulrich1500x546jpg 1500w height491 div
figure
div
pspan laurel thatcher ulrich historian a hrefhttpsnewsharvardedugazettestory201410ihadtheadvantageofdisadvantageexperienceaspanp
hr
div
figure
div
img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg width1350 altquotation mark srcsethttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2300x31jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21024x106jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2768x80jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21536x159jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_qm_test22048x212jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21500x155jpg 1500w height140 div
figure
div
h3life teaches that presence matters people respond to commitment and deliberateness when you put away your phone to have a conversation thats the decision that counts people care about your offer of attention empathy is built on such little gestures the ones that communicate that you dont know what someone else has to say but that you want to learnh3
pspan sherry turkle psychologist a hrefhttpsnewsharvardedugazettestory201705atphibetakappaceremonyacalltoempathyat pbk ceremony a call to empathyaspanp
hr
div
figure
div
img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg width1350 altquotation mark srcsethttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2300x31jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21024x106jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2768x80jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21536x159jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_qm_test22048x212jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21500x155jpg 1500w height140 div
figure
div
h3im not a writer who is hidden away from the world my work is political part of the role of the writer i believe is to take dangerous positions on behalf of those whose voices are not so easily heardh3
div
figure
div
img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_ql_cole1350x491jpg width1350 altteju cole srcsethttpsnewsharvardeduwpcontentuploads202208202208_ql_cole1350x491jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_ql_cole300x109jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_ql_cole1024x373jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_ql_cole768x280jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_ql_cole1536x559jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_ql_cole2048x745jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_ql_cole1500x546jpg 1500w height491 div
figure
div
pspan teju cole novelist and critic a hrefhttpsnewsharvardedugazettestory201812opencityauthortejucoletoteachcreativewritingatharvardauthor will urge creativewriting students beyond genre limitsaspanp
hr
div
figure
div
img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg width1350 altquotation mark srcsethttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2300x31jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21024x106jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2768x80jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21536x159jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_qm_test22048x212jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21500x155jpg 1500w height140 div
figure
div
h3expressions of goodness are never trivial in my work they are never incidental in my writing in fact i want them to have lifechanging properties and to illuminate decisively the moral questions embedded in the narrativeh3
div
figure
div
img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_ql_morrison1350x491jpg width1350 alttoni morrison srcsethttpsnewsharvardeduwpcontentuploads202208202208_ql_morrison1350x491jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_ql_morrison300x109jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_ql_morrison1024x373jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_ql_morrison768x280jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_ql_morrison1536x559jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_ql_morrison2048x745jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_ql_morrison1500x546jpg 1500w height491 div
figure
div
pspan toni morrison 19312019 novelist a hrefhttpsnewsharvardedugazettestory201212goodbutneversimplegood but never simpleaspanp
hr
div
figure
div
img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg width1350 altquotation mark srcsethttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2300x31jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21024x106jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2768x80jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21536x159jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_qm_test22048x212jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21500x155jpg 1500w height140 div
figure
div
h3we dont have a system that makes it possible to vanquish our foes and live for 1000 years in power for which i am grateful and yet thats what youd think if you listen to politicians that we can treat each other with contempt and hatred and win and silence our foes and kick them off our platforms and campuses thats a way to be miserable and ultimately to loseh3
div
figure
div
img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_ql_brooks1350x491jpg width1350 altarthur brooks srcsethttpsnewsharvardeduwpcontentuploads202208202208_ql_brooks1350x491jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_ql_brooks300x109jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_ql_brooks1024x373jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_ql_brooks768x280jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_ql_brooks1536x559jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_ql_brooks2048x745jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_ql_brooks1500x546jpg 1500w height491 div
figure
div
pspan arthur brooks social scientist a hrefhttpsnewsharvardedugazettestory202106happinessscholarofferslessonsinhealingriftshappiness scholar cites three ways to start healing riftsaspanp
hr
div
figure
div
img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg width1350 altquotation mark srcsethttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2300x31jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21024x106jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2768x80jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21536x159jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_qm_test22048x212jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21500x155jpg 1500w height140 div
figure
div
h3this romanticization of a good death you cant have a good death if youre a 23yearold girl with a huge ovarian mass like the one my colleagues just removed in mirebalais in central haiti you cant have a good death if youre the 17yearold girl i saw in mumbai last monday with drugresistant tuberculosis her parents weeping as her options were running out holding someones hand as they die bullshit fight they want you toh3
div
figure
div
img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_ql_farmer1350x491jpg width1350 alt srcsethttpsnewsharvardeduwpcontentuploads202208202208_ql_farmer1350x491jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_ql_farmer300x109jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_ql_farmer1024x373jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_ql_farmer768x280jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_ql_farmer1536x559jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_ql_farmer2048x745jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_ql_farmer1500x546jpg 1500w height491 div
figure
div
pspan paul farmer 19592022 physician and cofounder of partners in health a hrefhttpsnewsharvardedugazettestory201805harvardspaulfarmerontravelingtheworldtofightinequalityinhealthexperienceaspanp
hr
div
figure
div
img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg width1350 altquotation mark srcsethttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2300x31jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21024x106jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2768x80jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21536x159jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_qm_test22048x212jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21500x155jpg 1500w height140 div
figure
div
h3an awareness of the infirmity of unaided human intuition should be part of the conventional wisdom of every educated personh3
div
figure
div
img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202209202209_ql_pinker21350x491jpg width1350 altsteven pinker srcsethttpsnewsharvardeduwpcontentuploads202209202209_ql_pinker21350x491jpg 1350w httpsnewsharvardeduwpcontentuploads202209202209_ql_pinker2300x109jpg 300w httpsnewsharvardeduwpcontentuploads202209202209_ql_pinker21024x373jpg 1024w httpsnewsharvardeduwpcontentuploads202209202209_ql_pinker2768x280jpg 768w httpsnewsharvardeduwpcontentuploads202209202209_ql_pinker21536x559jpg 1536w httpsnewsharvardeduwpcontentuploads202209202209_ql_pinker22048x745jpg 2048w httpsnewsharvardeduwpcontentuploads202209202209_ql_pinker21500x546jpg 1500w height491 div
figure
div
pspan steven pinker psychologist a hrefhttpsnewsharvardedugazettestory201906focalpointharvardprofessorstevenpinkersaysthetruthliesinthedataanecdotes arent dataaspanp
hr
div
figure
div
img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg width1350 altquotation mark srcsethttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2300x31jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21024x106jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2768x80jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21536x159jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_qm_test22048x212jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21500x155jpg 1500w height140 div
figure
div
h3my ambitions on the racial front have shrunk i feel chastened thats why im talking about racial decency as opposed to racial equality my sense of what is possible in the foreseeable future has been diminishedh3
div
figure
div
img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_ql_kennedy1350x491jpg width1350 alt srcsethttpsnewsharvardeduwpcontentuploads202208202208_ql_kennedy1350x491jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_ql_kennedy300x109jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_ql_kennedy1024x373jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_ql_kennedy768x280jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_ql_kennedy1536x559jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_ql_kennedy2048x745jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_ql_kennedy1500x546jpg 1500w height491 div
figure
div
pspan randall kennedy legal scholar a hrefhttpsnewsharvardedugazettestory202109randallkennedyspeakshismindinhisnewbooksayitloudif randall kennedy ran the worldaspanp
hr
div
figure
div
img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg width1350 altquotation mark srcsethttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2300x31jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21024x106jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2768x80jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21536x159jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_qm_test22048x212jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21500x155jpg 1500w height140 div
figure
div
h3i understand that this is a question of vital importance to many people particularly to other mothers who are artists trying to get their work done and know that i feel for everyone in the struggle but until i see a male writer asked this question im going to respectfully decline to answer ith3
div
figure
div
img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_ql_groff1350x491jpg width1350 altlauren groff srcsethttpsnewsharvardeduwpcontentuploads202208202208_ql_groff1350x491jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_ql_groff300x109jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_ql_groff1024x373jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_ql_groff768x280jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_ql_groff1536x559jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_ql_groff2048x745jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_ql_groff1500x546jpg 1500w height491 div
figure
div
pspan lauren groff novelist in response to question can you talk about your process and how you manage work and family a hrefhttpsnewsharvardedugazettestory201807laurengroffonfloridaasastateofmindalienation proves fertile state of mind for lauren groffaspanp
hr
div
figure
div
img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg width1350 altquotation mark srcsethttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2300x31jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21024x106jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2768x80jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21536x159jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_qm_test22048x212jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21500x155jpg 1500w height140 div
figure
div
h3drugs either contribute to the smooth workings of society and the economy or they muck it up caffeine fosters a kind of consciousness thats very sober and focused and it gives people energy its a great boon to capitalism that wayh3
div
figure
div
img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_ql_pollan1350x491jpg width1350 altmichael pollan srcsethttpsnewsharvardeduwpcontentuploads202208202208_ql_pollan1350x491jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_ql_pollan300x109jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_ql_pollan1024x373jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_ql_pollan768x280jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_ql_pollan1536x559jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_ql_pollan2048x745jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_ql_pollan1500x546jpg 1500w height491 div
figure
div
pspan michael pollan author and journalist a hrefhttpsnewsharvardedugazettestory202108michaelpollandiscussesnewbookthisisyourmindonplantsmichael pollan digs deeper into drugsbr
aspanp
hr
div
figure
div
img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg width1350 altquotation mark srcsethttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2300x31jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21024x106jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2768x80jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21536x159jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_qm_test22048x212jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21500x155jpg 1500w height140 div
figure
div
h3she didnt look like a glamorous woman and she didnt behave like a restrained woman theres this incredible personality at work there that somehow against all odds succeeds with the publich3
pspan marylne altieri curator a hrefhttpsnewsharvardedugazettestory202204becomingjuliachildbecoming julia childaspanp
hr
div
figure
div
img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg width1350 altquotation mark srcsethttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2300x31jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21024x106jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2768x80jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21536x159jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_qm_test22048x212jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21500x155jpg 1500w height140 div
figure
div
h3i think we know a lot more scientifically about love and the brain than we did a couple of decades ago but do we think that makes us better at love or helping people with love probably not muchh3
div
figure
div
img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_ql_schwartz1350x491jpg width1350 altrichard schwartz srcsethttpsnewsharvardeduwpcontentuploads202208202208_ql_schwartz1350x491jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_ql_schwartz300x109jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_ql_schwartz1024x373jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_ql_schwartz768x280jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_ql_schwartz1536x559jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_ql_schwartz2048x745jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_ql_schwartz1500x546jpg 1500w height491 div
figure
div
pspan richard schwartz psychiatrist a hrefhttpsnewsharvardedugazettestory201802scientistsfindafewsurprisesintheirstudyoflovewhen love and science double dateaspanp
hr
div
figure
div
img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg width1350 altquotation mark srcsethttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2300x31jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21024x106jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2768x80jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21536x159jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_qm_test22048x212jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21500x155jpg 1500w height140 div
figure
div
h3you often have the sense with the very first note of a beethoven piece that it bursts into existence as a result of some uncontainable pressure that must have been building for a long time before the piece was born a pressure that finally became unbearableh3
div
figure
div
img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_ql_aucoin1350x491jpg width1350 altmatthew aucoin srcsethttpsnewsharvardeduwpcontentuploads202208202208_ql_aucoin1350x491jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_ql_aucoin300x109jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_ql_aucoin1024x373jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_ql_aucoin768x280jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_ql_aucoin1536x559jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_ql_aucoin2048x745jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_ql_aucoin1500x546jpg 1500w height491 div
figure
div
pspan matthew aucoin composer a hrefhttpsnewsharvardedugazettestory202012harvardcomposersreflectonbeethovenat250beethoven at 250aspanp
hr
div
figure
div
img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg width1350 altquotation mark srcsethttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2300x31jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21024x106jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2768x80jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21536x159jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_qm_test22048x212jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21500x155jpg 1500w height140 div
figure
div
h3the voice i was reading on the page and writing on the page was the voice i really wanted for myselfh3
div
figure
div
img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202209202209_ql_gorman1350x491jpg width1350 altamanda gorman srcsethttpsnewsharvardeduwpcontentuploads202209202209_ql_gorman1350x491jpg 1350w httpsnewsharvardeduwpcontentuploads202209202209_ql_gorman300x109jpg 300w httpsnewsharvardeduwpcontentuploads202209202209_ql_gorman1024x373jpg 1024w httpsnewsharvardeduwpcontentuploads202209202209_ql_gorman768x280jpg 768w httpsnewsharvardeduwpcontentuploads202209202209_ql_gorman1536x559jpg 1536w httpsnewsharvardeduwpcontentuploads202209202209_ql_gorman2048x745jpg 2048w httpsnewsharvardeduwpcontentuploads202209202209_ql_gorman1500x546jpg 1500w height491 div
figure
div
pspan amanda gorman inaugural us youth poet laureate a hrefhttpsnewsharvardedugazettestory201810youthpoetlaureateamandagormandeliverspoematharvardpresidentsinaugurationthe poetic perspectiveaspanp
hr
div
figure
div
img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg width1350 altquotation mark srcsethttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2300x31jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21024x106jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2768x80jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21536x159jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_qm_test22048x212jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21500x155jpg 1500w height140 div
figure
div
h3you should inform your gut and then trust ith3
div
figure
div
img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_ql_kahneman1350x491jpg width1350 altdaniel kahneman srcsethttpsnewsharvardeduwpcontentuploads202208202208_ql_kahneman1350x491jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_ql_kahneman300x109jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_ql_kahneman1024x373jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_ql_kahneman768x280jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_ql_kahneman1536x559jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_ql_kahneman2048x745jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_ql_kahneman1500x546jpg 1500w height491 div
figure
div
pspan daniel kahneman psychologist a hrefhttpsnewsharvardedugazettestory202112danielkahnemanonhowtoinfluenceothersnegotiating the irrationalaspanp
hr
div
figure
div
img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg width1350 altquotation mark srcsethttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2300x31jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21024x106jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2768x80jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21536x159jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_qm_test22048x212jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21500x155jpg 1500w height140 div
figure
div
h3the older i have gotten the less sleep i need the older i get the more i work because my sense is that time is shorter and i want to make the most of ith3
div
figure
div
img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_ql_patterson1350x491jpg width1350 altorlando patterson srcsethttpsnewsharvardeduwpcontentuploads202208202208_ql_patterson1350x491jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_ql_patterson300x109jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_ql_patterson1024x373jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_ql_patterson768x280jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_ql_patterson1536x559jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_ql_patterson2048x745jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_ql_patterson1500x546jpg 1500w height491 div
figure
div
pspan orlando patterson sociologist a hrefhttpsnewsharvardedugazettestory202202is80thenew60is 80 the new 60aspanp
hr
div
figure
div
img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg width1350 altquotation mark srcsethttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2300x31jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21024x106jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2768x80jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21536x159jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_qm_test22048x212jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21500x155jpg 1500w height140 div
figure
div
h3a beautiful narrative arc reassures us that the baffling events around us are meaningful and this is why ulysses appeared to be an instrument of chaos an anarchist bombh3
div
figure
div
img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_ql_birmingham1350x491jpg width1350 altkevin birmingham srcsethttpsnewsharvardeduwpcontentuploads202208202208_ql_birmingham1350x491jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_ql_birmingham300x109jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_ql_birmingham1024x373jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_ql_birmingham768x280jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_ql_birmingham1536x559jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_ql_birmingham2048x745jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_ql_birmingham1500x546jpg 1500w height491 div
figure
div
pspan kevin birmingham author a hrefhttpsnewsharvardedugazettestory202202rockypathtopublicationformostdangerousbookrocky path to publication for most dangerous bookaspanp
hr
div
figure
div
img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg width1350 altquotation mark srcsethttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2300x31jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21024x106jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2768x80jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21536x159jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_qm_test22048x212jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21500x155jpg 1500w height140 div
figure
div
h3i wanted to warn future social movements that listening only to ones own side can generate dangerous amounts of unrealism i worry that parts of the left may be falling into this trap todayh3
div
figure
div
img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_ql_mansbridge1350x491jpg width1350 alt srcsethttpsnewsharvardeduwpcontentuploads202208202208_ql_mansbridge1350x491jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_ql_mansbridge300x109jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_ql_mansbridge1024x373jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_ql_mansbridge768x280jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_ql_mansbridge1536x559jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_ql_mansbridge2048x745jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_ql_mansbridge1500x546jpg 1500w height491 div
figure
div
pspan jane mansbridge political scientist a hrefhttpsnewsharvardedugazettestory202009theevolutionofpoliticalscientistjanemansbridgeslifeandcareerexperienceaspanp
hr
div
figure
div
img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg width1350 altquotation mark srcsethttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2300x31jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21024x106jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2768x80jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21536x159jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_qm_test22048x212jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21500x155jpg 1500w height140 div
figure
div
h3insurgents detonated 30 to 35 pounds of homemade explosives below my feet it took off both legs immediately i sat up after hitting the ground thinking maybe i had a broken leg or something but both legs were goneh3
div
figure
div
img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202209202209_ql_galeazzi1350x491jpg width1350 altgreg galeazzi srcsethttpsnewsharvardeduwpcontentuploads202209202209_ql_galeazzi1350x491jpg 1350w httpsnewsharvardeduwpcontentuploads202209202209_ql_galeazzi300x109jpg 300w httpsnewsharvardeduwpcontentuploads202209202209_ql_galeazzi1024x373jpg 1024w httpsnewsharvardeduwpcontentuploads202209202209_ql_galeazzi768x280jpg 768w httpsnewsharvardeduwpcontentuploads202209202209_ql_galeazzi1536x559jpg 1536w httpsnewsharvardeduwpcontentuploads202209202209_ql_galeazzi2048x745jpg 2048w httpsnewsharvardeduwpcontentuploads202209202209_ql_galeazzi1500x546jpg 1500w height491 div
figure
div
pspan greg galeazzi veteran a hrefhttpsnewsharvardedugazettestory202109veteranandharvardmedicalstudentdiscussesafghanistanbetween army and medical school a stop in hellaspanp
hr
div
figure
div
img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg width1350 altquotation mark srcsethttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2300x31jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21024x106jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2768x80jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21536x159jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_qm_test22048x212jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21500x155jpg 1500w height140 div
figure
div
h3you miss certain features of reality when youre trying to write down simple models of the worldh3
div
figure
div
img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202209202209_ql_chetty1350x491jpg width1350 altraj chetty srcsethttpsnewsharvardeduwpcontentuploads202209202209_ql_chetty1350x491jpg 1350w httpsnewsharvardeduwpcontentuploads202209202209_ql_chetty300x109jpg 300w httpsnewsharvardeduwpcontentuploads202209202209_ql_chetty1024x373jpg 1024w httpsnewsharvardeduwpcontentuploads202209202209_ql_chetty768x280jpg 768w httpsnewsharvardeduwpcontentuploads202209202209_ql_chetty1536x559jpg 1536w httpsnewsharvardeduwpcontentuploads202209202209_ql_chetty2048x745jpg 2048w httpsnewsharvardeduwpcontentuploads202209202209_ql_chetty1500x546jpg 1500w height491 div
figure
div
pspan raj chetty economist a hrefhttpsnewsharvardedugazettestory200912thepersonalsideofeconomicsthe personal side of economicsaspanp
hr
div
figure
div
img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg width1350 altquotation mark srcsethttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2300x31jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21024x106jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2768x80jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21536x159jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_qm_test22048x212jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21500x155jpg 1500w height140 div
figure
div
h3my philosophy is very simple when you see something thats not right not fair not just stand up say something and speak outh3
div
figure
div
img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202209202209_ql_lewis1350x491jpg width1350 altjohn lewis srcsethttpsnewsharvardeduwpcontentuploads202209202209_ql_lewis1350x491jpg 1350w httpsnewsharvardeduwpcontentuploads202209202209_ql_lewis300x109jpg 300w httpsnewsharvardeduwpcontentuploads202209202209_ql_lewis1024x373jpg 1024w httpsnewsharvardeduwpcontentuploads202209202209_ql_lewis768x280jpg 768w httpsnewsharvardeduwpcontentuploads202209202209_ql_lewis1536x559jpg 1536w httpsnewsharvardeduwpcontentuploads202209202209_ql_lewis2048x745jpg 2048w httpsnewsharvardeduwpcontentuploads202209202209_ql_lewis1500x546jpg 1500w height491 div
figure
div
pspan us rep john lewis 19402020 a hrefhttpsnewsharvardedugazettestory201805lewisandfausttellclassof18torisetooccasionfacing the future lewis and faust see reason for hopeaspanp
hr
div
figure
div
img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg width1350 altquotation mark srcsethttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2300x31jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21024x106jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2768x80jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21536x159jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_qm_test22048x212jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21500x155jpg 1500w height140 div
figure
div
h3if you have the resources invest in data quality far more than you invest in data quantity badquality data is essentially wiping out the power you think you haveh3
div
figure
div
img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202209202209_ql_meng1350x491jpg width1350 altxiaoli meng srcsethttpsnewsharvardeduwpcontentuploads202209202209_ql_meng1350x491jpg 1350w httpsnewsharvardeduwpcontentuploads202209202209_ql_meng300x109jpg 300w httpsnewsharvardeduwpcontentuploads202209202209_ql_meng1024x373jpg 1024w httpsnewsharvardeduwpcontentuploads202209202209_ql_meng768x280jpg 768w httpsnewsharvardeduwpcontentuploads202209202209_ql_meng1536x559jpg 1536w httpsnewsharvardeduwpcontentuploads202209202209_ql_meng2048x745jpg 2048w httpsnewsharvardeduwpcontentuploads202209202209_ql_meng1500x546jpg 1500w height491 div
figure
div
pspan xiaoli meng statistician a hrefhttpsnewsharvardedugazettestory202112vaccinationsurveysfellvictimtobigdataparadoxharvardresearcherssay2 early vaccination surveys worse than worthless thanks to big data paradoxaspanp
hr
div
figure
div
img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg width1350 altquotation mark srcsethttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2300x31jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21024x106jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2768x80jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21536x159jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_qm_test22048x212jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21500x155jpg 1500w height140 div
figure
div
h3in an unequal society those who land on top want to believe their success is morally justified in a meritocratic society this means the winners must believe they have earned their success through their talent and hard workh3
div
figure
div
img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202209202209_ql_sandel1350x491jpg width1350 altmichael sandel srcsethttpsnewsharvardeduwpcontentuploads202209202209_ql_sandel1350x491jpg 1350w httpsnewsharvardeduwpcontentuploads202209202209_ql_sandel300x109jpg 300w httpsnewsharvardeduwpcontentuploads202209202209_ql_sandel1024x373jpg 1024w httpsnewsharvardeduwpcontentuploads202209202209_ql_sandel768x280jpg 768w httpsnewsharvardeduwpcontentuploads202209202209_ql_sandel1536x559jpg 1536w httpsnewsharvardeduwpcontentuploads202209202209_ql_sandel2048x745jpg 2048w httpsnewsharvardeduwpcontentuploads202209202209_ql_sandel1500x546jpg 1500w height491 div
figure
div
pspan michael j sandel philosopher a hrefhttpsnewsharvardedugazettestory202101themythofmeritocracyaccordingtomichaelsandeltoppling the myth of meritocracyaspanp
hr
div
figure
div
img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg width1350 altquotation mark srcsethttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2300x31jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21024x106jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2768x80jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21536x159jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_qm_test22048x212jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21500x155jpg 1500w height140 div
figure
div
h3you either have to build up the courage to do something to stop the deaths of innocent children or you eventually will lose your power in this countryh3
div
figure
div
img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_ql_corin1350x491jpg width1350 altjaclyn corin srcsethttpsnewsharvardeduwpcontentuploads202208202208_ql_corin1350x491jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_ql_corin300x109jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_ql_corin1024x373jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_ql_corin768x280jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_ql_corin1536x559jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_ql_corin2048x745jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_ql_corin1500x546jpg 1500w height491 div
figure
div
pspan jaclyn corin march for our lives cofounder a hrefhttpsnewsharvardedugazettestory202206deadlymassshootingsreigniteyouthguncontrolpushmass shootings reignite youth gun control pushaspanp
hr
div
figure
div
img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg width1350 altquotation mark srcsethttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2300x31jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21024x106jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2768x80jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21536x159jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_qm_test22048x212jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21500x155jpg 1500w height140 div
figure
div
h3maybe we need to stop thinking in some cases about a cure for cancer maybe they dont need to be curable for us to have long healthy livesh3
div
figure
div
img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202209202209_ql_rebbeck1350x491jpg width1350 alttimothy rebbeck srcsethttpsnewsharvardeduwpcontentuploads202209202209_ql_rebbeck1350x491jpg 1350w httpsnewsharvardeduwpcontentuploads202209202209_ql_rebbeck300x109jpg 300w httpsnewsharvardeduwpcontentuploads202209202209_ql_rebbeck1024x373jpg 1024w httpsnewsharvardeduwpcontentuploads202209202209_ql_rebbeck768x280jpg 768w httpsnewsharvardeduwpcontentuploads202209202209_ql_rebbeck1536x559jpg 1536w httpsnewsharvardeduwpcontentuploads202209202209_ql_rebbeck2048x745jpg 2048w httpsnewsharvardeduwpcontentuploads202209202209_ql_rebbeck1500x546jpg 1500w height491 div
figure
div
pspan timothy rebbeck professor of cancer prevention a hrefhttpsnewsharvardedugazettestory202203bringingthecancerfightbackdowntoearthbringing the cancer fight back down to earthaspanp
hr
div
figure
div
img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg width1350 altquotation mark srcsethttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2300x31jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21024x106jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2768x80jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21536x159jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_qm_test22048x212jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21500x155jpg 1500w height140 div
figure
div
h3i believe in the power of choice to shape fate even though i recognize the hugely important role that social structures play in limiting ones choices it is the heart of the debate between ralph ellison who stressed the role of choice of agency for black people and richard wright who stressed the determining and deleterious effects of socioeconomic structureh3
div
figure
div
img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202209202209_ql_gates1350x491jpg width1350 althenry louis skip gates jr srcsethttpsnewsharvardeduwpcontentuploads202209202209_ql_gates1350x491jpg 1350w httpsnewsharvardeduwpcontentuploads202209202209_ql_gates300x109jpg 300w httpsnewsharvardeduwpcontentuploads202209202209_ql_gates1024x373jpg 1024w httpsnewsharvardeduwpcontentuploads202209202209_ql_gates768x280jpg 768w httpsnewsharvardeduwpcontentuploads202209202209_ql_gates1536x559jpg 1536w httpsnewsharvardeduwpcontentuploads202209202209_ql_gates2048x745jpg 2048w httpsnewsharvardeduwpcontentuploads202209202209_ql_gates1500x546jpg 1500w height491 div
figure
div
pspan henry louis skip gates jr historian a hrefhttpsnewsharvardedugazettestory201802harvardscholarsgatestatarilluminateafricanamericanfolktalesafricanamerican folklore inspires meeting of the mindsaspanp
hr
div
figure
div
img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg width1350 altquotation mark srcsethttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2300x31jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21024x106jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2768x80jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21536x159jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_qm_test22048x212jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21500x155jpg 1500w height140 div
figure
div
h3we have created a grand con and potentially a dangerous one because we are convincing the rest of the society that technology can do things that it actually cannot doh3
div
figure
div
img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202209202209_ql_gajos1350x491jpg width1350 altkrzysztof gajos srcsethttpsnewsharvardeduwpcontentuploads202209202209_ql_gajos1350x491jpg 1350w httpsnewsharvardeduwpcontentuploads202209202209_ql_gajos300x109jpg 300w httpsnewsharvardeduwpcontentuploads202209202209_ql_gajos1024x373jpg 1024w httpsnewsharvardeduwpcontentuploads202209202209_ql_gajos768x280jpg 768w httpsnewsharvardeduwpcontentuploads202209202209_ql_gajos1536x559jpg 1536w httpsnewsharvardeduwpcontentuploads202209202209_ql_gajos2048x745jpg 2048w httpsnewsharvardeduwpcontentuploads202209202209_ql_gajos1500x546jpg 1500w height491 div
figure
div
pspan krzysztof gajos computer scientist a hrefhttpsnewsharvardedugazettestory202111harvardexpertconsiderstheliterarymeritofaiwhen will a robot write a novelaspanp
hr
div
figure
div
img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg width1350 altquotation mark srcsethttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2300x31jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21024x106jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2768x80jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21536x159jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_qm_test22048x212jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21500x155jpg 1500w height140 div
figure
div
h3i think weve really met a onceinageneration take this job and shove it momenth3
div
figure
div
img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202209202209_ql_katz21350x491jpg width1350 altlawrence katz srcsethttpsnewsharvardeduwpcontentuploads202209202209_ql_katz21350x491jpg 1350w httpsnewsharvardeduwpcontentuploads202209202209_ql_katz2300x109jpg 300w httpsnewsharvardeduwpcontentuploads202209202209_ql_katz21024x373jpg 1024w httpsnewsharvardeduwpcontentuploads202209202209_ql_katz2768x280jpg 768w httpsnewsharvardeduwpcontentuploads202209202209_ql_katz21536x559jpg 1536w httpsnewsharvardeduwpcontentuploads202209202209_ql_katz22048x745jpg 2048w httpsnewsharvardeduwpcontentuploads202209202209_ql_katz21500x546jpg 1500w height491 div
figure
div
pspan lawrence katz labor economist a hrefhttpsnewsharvardedugazettestory202110harvardeconomistshedslightongreatresignationi quit is all the rage blip or sea changeaspanp
hr
div
figure
div
img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg width1350 altquotation mark srcsethttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2300x31jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21024x106jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2768x80jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21536x159jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_qm_test22048x212jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21500x155jpg 1500w height140 div
figure
div
h3we know what a healthy meal looks like we know that exercise is good for you and that pollution is bad for you but we know a lot less about the places where we spend all of our timeh3
div
figure
div
img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202209202209_ql_allen1350x491jpg width1350 altjoe allen srcsethttpsnewsharvardeduwpcontentuploads202209202209_ql_allen1350x491jpg 1350w httpsnewsharvardeduwpcontentuploads202209202209_ql_allen300x109jpg 300w httpsnewsharvardeduwpcontentuploads202209202209_ql_allen1024x373jpg 1024w httpsnewsharvardeduwpcontentuploads202209202209_ql_allen768x280jpg 768w httpsnewsharvardeduwpcontentuploads202209202209_ql_allen1536x559jpg 1536w httpsnewsharvardeduwpcontentuploads202209202209_ql_allen2048x745jpg 2048w httpsnewsharvardeduwpcontentuploads202209202209_ql_allen1500x546jpg 1500w height491 div
figure
div
pspan joe allen public health expert a hrefhttpsnewsharvardedugazettestory201906harvardresearchersoutlinestepstoahealthyhomeis your home making you sickaspanp
hr
div
figure
div
img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg width1350 altquotation mark srcsethttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2300x31jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21024x106jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2768x80jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21536x159jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_qm_test22048x212jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21500x155jpg 1500w height140 div
figure
div
h3the problem really is not that democracy is being prevented so much as that democracy is occurring its precisely the citizens in the major carbonemitting democracies who benefit from cheap gasoline and global tradeh3
pspan jonathan franzen novelist a hrefhttpsnewsharvardedugazettestory201704jonathanfranzenhassomechoicewordsforliberalssome choice words for liberalsaspanp
hr
div
figure
div
img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg width1350 altquotation mark srcsethttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2300x31jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21024x106jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2768x80jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21536x159jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_qm_test22048x212jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21500x155jpg 1500w height140 div
figure
div
h3slightly more women than men get phds in the classics in the us and yet the vast majority of translations that readers read in english for classics are by men this is an issue and we should talk about ith3
div
figure
div
img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202209202209_ql_emilywilson1350x491jpg width1350 altemily wilson srcsethttpsnewsharvardeduwpcontentuploads202209202209_ql_emilywilson1350x491jpg 1350w httpsnewsharvardeduwpcontentuploads202209202209_ql_emilywilson300x109jpg 300w httpsnewsharvardeduwpcontentuploads202209202209_ql_emilywilson1024x373jpg 1024w httpsnewsharvardeduwpcontentuploads202209202209_ql_emilywilson768x280jpg 768w httpsnewsharvardeduwpcontentuploads202209202209_ql_emilywilson1536x559jpg 1536w httpsnewsharvardeduwpcontentuploads202209202209_ql_emilywilson2048x745jpg 2048w httpsnewsharvardeduwpcontentuploads202209202209_ql_emilywilson1500x546jpg 1500w height491 div
figure
div
pspan emily wilson classicist a hrefhttpsnewsharvardedugazettestory201802womanscholarstakeontheodysseynew chapter for the odysseyaspanp
hr
div
figure
div
img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg width1350 altquotation mark srcsethttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2300x31jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21024x106jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2768x80jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21536x159jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_qm_test22048x212jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21500x155jpg 1500w height140 div
figure
div
h3how do i tell a neonatal intensive care unit nurse her assignment today is to hold the ipad for the family of a dying adult intensivecare unit patient so they can say goodbyeh3
div
figure
div
img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202209202209_ql_tenney1350x491jpg width1350 altmary tenney srcsethttpsnewsharvardeduwpcontentuploads202209202209_ql_tenney1350x491jpg 1350w httpsnewsharvardeduwpcontentuploads202209202209_ql_tenney300x109jpg 300w httpsnewsharvardeduwpcontentuploads202209202209_ql_tenney1024x373jpg 1024w httpsnewsharvardeduwpcontentuploads202209202209_ql_tenney768x280jpg 768w httpsnewsharvardeduwpcontentuploads202209202209_ql_tenney1536x559jpg 1536w httpsnewsharvardeduwpcontentuploads202209202209_ql_tenney2048x745jpg 2048w httpsnewsharvardeduwpcontentuploads202209202209_ql_tenney1500x546jpg 1500w height491 div
figure
div
pspan mary tenney nurse a hrefhttpsnewsharvardedugazettestory20211114nursesonlifeandworkduringcovid14 nurses on life and work during covidaspanp
hr
div
figure
div
img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg width1350 altquotation mark srcsethttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2300x31jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21024x106jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2768x80jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21536x159jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_qm_test22048x212jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21500x155jpg 1500w height140 div
figure
div
h3leadership in my mind is about managing change if youre not managing change youre not leading youre presiding and i did not take this job merely to preside over harvardh3
div
figure
div
img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202209202209_qlbacow1350x491jpg width1350 altlarry bacow srcsethttpsnewsharvardeduwpcontentuploads202209202209_qlbacow1350x491jpg 1350w httpsnewsharvardeduwpcontentuploads202209202209_qlbacow300x109jpg 300w httpsnewsharvardeduwpcontentuploads202209202209_qlbacow1024x373jpg 1024w httpsnewsharvardeduwpcontentuploads202209202209_qlbacow768x280jpg 768w httpsnewsharvardeduwpcontentuploads202209202209_qlbacow1536x559jpg 1536w httpsnewsharvardeduwpcontentuploads202209202209_qlbacow2048x745jpg 2048w httpsnewsharvardeduwpcontentuploads202209202209_qlbacow1500x546jpg 1500w height491 div
figure
div
pspan larry bacow harvard president a hrefhttpsnewsharvardedugazettestory201810newharvardpresidentlarrybacowisonalisteningtourlarry bacows listening touraspanp
hr
div
figure
div
img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg width1350 altquotation mark srcsethttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2300x31jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21024x106jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2768x80jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21536x159jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_qm_test22048x212jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21500x155jpg 1500w height140 div
figure
div
h3most of writing is like plumbing and laying the floor and digging the basement and then layering it brick by brick by brick until you have the edificeh3
div
figure
div
img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202209202209_ql_lee1350x491jpg width1350 altmin jin lee srcsethttpsnewsharvardeduwpcontentuploads202209202209_ql_lee1350x491jpg 1350w httpsnewsharvardeduwpcontentuploads202209202209_ql_lee300x109jpg 300w httpsnewsharvardeduwpcontentuploads202209202209_ql_lee1024x373jpg 1024w httpsnewsharvardeduwpcontentuploads202209202209_ql_lee768x280jpg 768w httpsnewsharvardeduwpcontentuploads202209202209_ql_lee1536x559jpg 1536w httpsnewsharvardeduwpcontentuploads202209202209_ql_lee2048x745jpg 2048w httpsnewsharvardeduwpcontentuploads202209202209_ql_lee1500x546jpg 1500w height491 div
figure
div
pspan min jin lee novelist a hrefhttpsnewsharvardedugazettestory201903bestsellingauthorminjinleeisfinishinghertrilogyatradclifferesearching and writing historyaspanp
hr
div
figure
div
img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg width1350 altquotation mark srcsethttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2300x31jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21024x106jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2768x80jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21536x159jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_qm_test22048x212jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21500x155jpg 1500w height140 div
figure
div
h3when you see death all the time you go into this mode of increased energy and sharper focush3
div
figure
div
img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202209202209_ql_essex1350x491jpg width1350 altmax essex srcsethttpsnewsharvardeduwpcontentuploads202209202209_ql_essex1350x491jpg 1350w httpsnewsharvardeduwpcontentuploads202209202209_ql_essex300x109jpg 300w httpsnewsharvardeduwpcontentuploads202209202209_ql_essex1024x373jpg 1024w httpsnewsharvardeduwpcontentuploads202209202209_ql_essex768x280jpg 768w httpsnewsharvardeduwpcontentuploads202209202209_ql_essex1536x559jpg 1536w httpsnewsharvardeduwpcontentuploads202209202209_ql_essex2048x745jpg 2048w httpsnewsharvardeduwpcontentuploads202209202209_ql_essex1500x546jpg 1500w height491 div
figure
div
pspan max essex pioneering aids researcher a hrefhttpsnewsharvardedugazettestory202005pioneeringaidsresearchermaxessexshareslessonsexperienceaspanp
hr
div
figure
div
img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg width1350 altquotation mark srcsethttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2300x31jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21024x106jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2768x80jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21536x159jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_qm_test22048x212jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21500x155jpg 1500w height140 div
figure
div
h3ive just seen dozens and dozens and dozens of every kind of bug imaginable attacking the dreamer there are swarms of every kind of flying insect youve ever heard of there are armies of cockroaches racing at the dreamer there are masses of wriggling worms there were some grasshoppers with vampire fangs there are bed bugs stink bugsh3
div
figure
div
img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202209202209_ql_barrett1350x491jpg width1350 alt srcsethttpsnewsharvardeduwpcontentuploads202209202209_ql_barrett1350x491jpg 1350w httpsnewsharvardeduwpcontentuploads202209202209_ql_barrett300x109jpg 300w httpsnewsharvardeduwpcontentuploads202209202209_ql_barrett1024x373jpg 1024w httpsnewsharvardeduwpcontentuploads202209202209_ql_barrett768x280jpg 768w httpsnewsharvardeduwpcontentuploads202209202209_ql_barrett1536x559jpg 1536w httpsnewsharvardeduwpcontentuploads202209202209_ql_barrett2048x745jpg 2048w httpsnewsharvardeduwpcontentuploads202209202209_ql_barrett1500x546jpg 1500w height491 div
figure
div
pspan deirdre barrett psychologist a hrefhttpsnewsharvardedugazettestory202005harvardresearchersaysdreamsindicativeofvirusfearswhat pandemic dreams may comeaspanp
hr
div
figure
div
img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg width1350 altquotation mark srcsethttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2300x31jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21024x106jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2768x80jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21536x159jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_qm_test22048x212jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21500x155jpg 1500w height140 div
figure
div
h3nature is often alluring and attractive yet natural materials are anything but safeh3
pspan robert paarlberg author a hrefhttpsnewsharvardedugazettestory202102authorrobertpaarlbergarguesagainstbuyingorganiconly eat organic youre paying too much and its not worth itaspanp
hr
div
figure
div
img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg width1350 altquotation mark srcsethttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2300x31jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21024x106jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2768x80jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21536x159jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_qm_test22048x212jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21500x155jpg 1500w height140 div
figure
div
h3that the other officers so casually walked around took notes just stood there chatting bespeaks a wall of everyday routine and indifference that has such profound cultural roots at this point that its not just unconscious biash3
div
figure
div
img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202209202209_ql_bobo1350x491jpg width1350 alt srcsethttpsnewsharvardeduwpcontentuploads202209202209_ql_bobo1350x491jpg 1350w httpsnewsharvardeduwpcontentuploads202209202209_ql_bobo300x109jpg 300w httpsnewsharvardeduwpcontentuploads202209202209_ql_bobo1024x373jpg 1024w httpsnewsharvardeduwpcontentuploads202209202209_ql_bobo768x280jpg 768w httpsnewsharvardeduwpcontentuploads202209202209_ql_bobo1536x559jpg 1536w httpsnewsharvardeduwpcontentuploads202209202209_ql_bobo2048x745jpg 2048w httpsnewsharvardeduwpcontentuploads202209202209_ql_bobo1500x546jpg 1500w height491 div
figure
div
pspan lawrence d bobo sociologist a hrefhttpsnewsharvardedugazettestory202006lawrencedboboexaminespolicekillingsofblackmenthe fire this timeaspanp
hr
div
figure
div
img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg width1350 altquotation mark srcsethttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2300x31jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21024x106jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2768x80jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21536x159jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_qm_test22048x212jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21500x155jpg 1500w height140 div
figure
div
h3in our lifetime [helium] might not run out but for humanity it has a finite supply we cant make any moreh3
pspan anthony lowe electronics technician a hrefhttpsnewsharvardedugazettestory202206heliumshortage40makesitswaytoharvardglobal helium shortage slams brakes at harvard labsaspanp
hr
div
figure
div
img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg width1350 altquotation mark srcsethttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2300x31jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21024x106jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2768x80jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21536x159jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_qm_test22048x212jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21500x155jpg 1500w height140 div
figure
div
h3maybe whats happening is that after all these years my real face is finally emergingh3
div
figure
div
img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202209202209_ql_diaz1350x491jpg width1350 altjunot daz srcsethttpsnewsharvardeduwpcontentuploads202209202209_ql_diaz1350x491jpg 1350w httpsnewsharvardeduwpcontentuploads202209202209_ql_diaz300x109jpg 300w httpsnewsharvardeduwpcontentuploads202209202209_ql_diaz1024x373jpg 1024w httpsnewsharvardeduwpcontentuploads202209202209_ql_diaz768x280jpg 768w httpsnewsharvardeduwpcontentuploads202209202209_ql_diaz1536x559jpg 1536w httpsnewsharvardeduwpcontentuploads202209202209_ql_diaz2048x745jpg 2048w httpsnewsharvardeduwpcontentuploads202209202209_ql_diaz1500x546jpg 1500w height491 div
figure
div
pspan junot daz author a hrefhttpsnewsharvardedugazettestory202103thesoundoflockdowndramaticreadingsofradcliffeessaysold masks new faceaspanp
hr
div
figure
div
img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg width1350 altquotation mark srcsethttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2300x31jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21024x106jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2768x80jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21536x159jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_qm_test22048x212jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21500x155jpg 1500w height140 div
figure
div
h3people with disabilities get called inspiring so often usually for the most insignificant things that the word now feels like a euphemism for pity sometimes when a nondisabled person uses the word to describe a person with a disability its a sign that theyre feeling overwhelmed or uncomfortableh3
div
figure
div
img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202209202209_ql_haben1350x491jpg width1350 althaben girma srcsethttpsnewsharvardeduwpcontentuploads202209202209_ql_haben1350x491jpg 1350w httpsnewsharvardeduwpcontentuploads202209202209_ql_haben300x109jpg 300w httpsnewsharvardeduwpcontentuploads202209202209_ql_haben1024x373jpg 1024w httpsnewsharvardeduwpcontentuploads202209202209_ql_haben768x280jpg 768w httpsnewsharvardeduwpcontentuploads202209202209_ql_haben1536x559jpg 1536w httpsnewsharvardeduwpcontentuploads202209202209_ql_haben2048x745jpg 2048w httpsnewsharvardeduwpcontentuploads202209202209_ql_haben1500x546jpg 1500w height491 div
figure
div
pspan haben girma first deafblind woman to graduate from harvard law school a hrefhttpsnewsharvardedugazettestory201911excerptfromthedeafblindwomanwhoconqueredharvardlawone l only harderaspanp
hr
div
figure
div
img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg width1350 altquotation mark srcsethttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2300x31jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21024x106jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2768x80jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21536x159jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_qm_test22048x212jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21500x155jpg 1500w height140 div
figure
div
h3things are intriguing to me when theyre slightly edited like these shoesh3
div
figure
div
img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202209202209_ql_abloh1350x491jpg width1350 altvirgil abloh srcsethttpsnewsharvardeduwpcontentuploads202209202209_ql_abloh1350x491jpg 1350w httpsnewsharvardeduwpcontentuploads202209202209_ql_abloh300x109jpg 300w httpsnewsharvardeduwpcontentuploads202209202209_ql_abloh1024x373jpg 1024w httpsnewsharvardeduwpcontentuploads202209202209_ql_abloh768x280jpg 768w httpsnewsharvardeduwpcontentuploads202209202209_ql_abloh1536x559jpg 1536w httpsnewsharvardeduwpcontentuploads202209202209_ql_abloh2048x745jpg 2048w httpsnewsharvardeduwpcontentuploads202209202209_ql_abloh1500x546jpg 1500w height491 div
figure
div
pspan virgil abloh 19802021 designer a hrefhttpsnewsharvardedugazettestory201711harvardwelcomesvirgilablohforgsdlectureideas and sneakers were in the airaspanp
hr
div
figure
div
img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg width1350 altquotation mark srcsethttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2300x31jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21024x106jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2768x80jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21536x159jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_qm_test22048x212jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21500x155jpg 1500w height140 div
figure
div
h3its never art for arts sake because even if i do it for myself in my head i have an idealh3
div
figure
div
img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202209202209_ql_ma1350x491jpg width1350 altyoyo ma srcsethttpsnewsharvardeduwpcontentuploads202209202209_ql_ma1350x491jpg 1350w httpsnewsharvardeduwpcontentuploads202209202209_ql_ma300x109jpg 300w httpsnewsharvardeduwpcontentuploads202209202209_ql_ma1024x373jpg 1024w httpsnewsharvardeduwpcontentuploads202209202209_ql_ma768x280jpg 768w httpsnewsharvardeduwpcontentuploads202209202209_ql_ma1536x559jpg 1536w httpsnewsharvardeduwpcontentuploads202209202209_ql_ma2048x745jpg 2048w httpsnewsharvardeduwpcontentuploads202209202209_ql_ma1500x546jpg 1500w height491 div
figure
div
pspan yoyo ma cellist a hrefhttpsnewsharvardedugazettestory201903yoyomaspeakingatharvarditsneverartforartssakei want to make it feltaspanp
hr
div
figure
div
img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg width1350 altquotation mark srcsethttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2300x31jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21024x106jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2768x80jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21536x159jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_qm_test22048x212jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21500x155jpg 1500w height140 div
figure
div
h3that is an extraordinarily important thing morally and economically people who are healthier are more productive people who are healthier are smarterh3
div
figure
div
img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202209202209_ql_summers1350x491jpg width1350 altlawrence summers srcsethttpsnewsharvardeduwpcontentuploads202209202209_ql_summers1350x491jpg 1350w httpsnewsharvardeduwpcontentuploads202209202209_ql_summers300x109jpg 300w httpsnewsharvardeduwpcontentuploads202209202209_ql_summers1024x373jpg 1024w httpsnewsharvardeduwpcontentuploads202209202209_ql_summers768x280jpg 768w httpsnewsharvardeduwpcontentuploads202209202209_ql_summers1536x559jpg 1536w httpsnewsharvardeduwpcontentuploads202209202209_ql_summers2048x745jpg 2048w httpsnewsharvardeduwpcontentuploads202209202209_ql_summers1500x546jpg 1500w height491 div
figure
div
pspan lawrence summers economist and former harvard president a hrefhttpsnewsharvardedugazettestory201504healthasaneconomicenginehealth as an economic engineaspanp
hr
div
figure
div
img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg width1350 altquotation mark srcsethttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2300x31jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21024x106jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2768x80jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21536x159jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_qm_test22048x212jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21500x155jpg 1500w height140 div
figure
div
h3im convinced that all someone has to do to be considered a writer is writeh3
div
figure
div
img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202209202209_ql_reyes1350x491jpg width1350 altruben reyes srcsethttpsnewsharvardeduwpcontentuploads202209202209_ql_reyes1350x491jpg 1350w httpsnewsharvardeduwpcontentuploads202209202209_ql_reyes300x109jpg 300w httpsnewsharvardeduwpcontentuploads202209202209_ql_reyes1024x373jpg 1024w httpsnewsharvardeduwpcontentuploads202209202209_ql_reyes768x280jpg 768w httpsnewsharvardeduwpcontentuploads202209202209_ql_reyes1536x559jpg 1536w httpsnewsharvardeduwpcontentuploads202209202209_ql_reyes2048x745jpg 2048w httpsnewsharvardeduwpcontentuploads202209202209_ql_reyes1500x546jpg 1500w height491 div
figure
div
pspan ruben reyes jr launched student latinx literary magazine a hrefhttpsnewsharvardedugazettestory201902harvardseniorlauncheslatinxliterarymagazinea writers journeyaspanp
hr
div
figure
div
img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg width1350 altquotation mark srcsethttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2300x31jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21024x106jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2768x80jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21536x159jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_qm_test22048x212jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21500x155jpg 1500w height140 div
figure
div
h3i dont know how to take solace in religionh3
div
figure
div
img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202209202209_ql_spiegelman1350x491jpg width1350 altart spiegelman srcsethttpsnewsharvardeduwpcontentuploads202209202209_ql_spiegelman1350x491jpg 1350w httpsnewsharvardeduwpcontentuploads202209202209_ql_spiegelman300x109jpg 300w httpsnewsharvardeduwpcontentuploads202209202209_ql_spiegelman1024x373jpg 1024w httpsnewsharvardeduwpcontentuploads202209202209_ql_spiegelman768x280jpg 768w httpsnewsharvardeduwpcontentuploads202209202209_ql_spiegelman1536x559jpg 1536w httpsnewsharvardeduwpcontentuploads202209202209_ql_spiegelman2048x745jpg 2048w httpsnewsharvardeduwpcontentuploads202209202209_ql_spiegelman1500x546jpg 1500w height491 div
figure
div
pspan art spiegelman cartoonist a hrefhttpsnewsharvardedugazettestory201709mausauthorartspiegelmantalksartandexistenceatharvardfathers killers god and mausaspanp
hr
div
figure
div
img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg width1350 altquotation mark srcsethttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2300x31jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21024x106jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2768x80jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21536x159jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_qm_test22048x212jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21500x155jpg 1500w height140 div
figure
div
h3are there other people who if they had a couple of years to be inventive could have done a revolver or rubber soul every bone in my body cries out no but my brain whispers maybeh3
div
figure
div
img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202209202209_ql_sunstein1350x491jpg width1350 altcass r sunstein srcsethttpsnewsharvardeduwpcontentuploads202209202209_ql_sunstein1350x491jpg 1350w httpsnewsharvardeduwpcontentuploads202209202209_ql_sunstein300x109jpg 300w httpsnewsharvardeduwpcontentuploads202209202209_ql_sunstein1024x373jpg 1024w httpsnewsharvardeduwpcontentuploads202209202209_ql_sunstein768x280jpg 768w httpsnewsharvardeduwpcontentuploads202209202209_ql_sunstein1536x559jpg 1536w httpsnewsharvardeduwpcontentuploads202209202209_ql_sunstein2048x745jpg 2048w httpsnewsharvardeduwpcontentuploads202209202209_ql_sunstein1500x546jpg 1500w height491 div
figure
div
pspan cass r sunstein studies behavioral economics a hrefhttpsnewsharvardedugazettestory202203beatlesgotbywithlittleluckandsomefriendswhy do some bands rocket when others sputter outaspanp
hr
div
figure
div
img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg width1350 altquotation mark srcsethttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2300x31jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21024x106jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2768x80jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21536x159jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_qm_test22048x212jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21500x155jpg 1500w height140 div
figure
div
h3we must acknowledge the harm that harvard has done but it is also important that we do not as has been done in the past bury stories of black resistance excellence and leadershiph3
div
figure
div
img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202209202209_ql_brownnagin1350x491jpg width1350 alttomiko brownnagin srcsethttpsnewsharvardeduwpcontentuploads202209202209_ql_brownnagin1350x491jpg 1350w httpsnewsharvardeduwpcontentuploads202209202209_ql_brownnagin300x109jpg 300w httpsnewsharvardeduwpcontentuploads202209202209_ql_brownnagin1024x373jpg 1024w httpsnewsharvardeduwpcontentuploads202209202209_ql_brownnagin768x280jpg 768w httpsnewsharvardeduwpcontentuploads202209202209_ql_brownnagin1536x559jpg 1536w httpsnewsharvardeduwpcontentuploads202209202209_ql_brownnagin2048x745jpg 2048w httpsnewsharvardeduwpcontentuploads202209202209_ql_brownnagin1500x546jpg 1500w height491 div
figure
div
pspan tomiko brownnagin radcliffe dean a hrefhttpsnewsharvardedugazettestory202204slaveryprobeharvardstiesinseparablefromriseslavery probe harvards ties inseparable from riseaspanp
hr
div
figure
div
img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg width1350 altquotation mark srcsethttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2300x31jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21024x106jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2768x80jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21536x159jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_qm_test22048x212jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21500x155jpg 1500w height140 div
figure
div
h3when my son was diagnosed i knew nothing about diabetes i changed my research focus thinking as any parent would what am i going to do about thish3
div
figure
div
img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202209202209_ql_melton1350x491jpg width1350 altdouglas melton srcsethttpsnewsharvardeduwpcontentuploads202209202209_ql_melton1350x491jpg 1350w httpsnewsharvardeduwpcontentuploads202209202209_ql_melton300x109jpg 300w httpsnewsharvardeduwpcontentuploads202209202209_ql_melton1024x373jpg 1024w httpsnewsharvardeduwpcontentuploads202209202209_ql_melton768x280jpg 768w httpsnewsharvardeduwpcontentuploads202209202209_ql_melton1536x559jpg 1536w httpsnewsharvardeduwpcontentuploads202209202209_ql_melton2048x745jpg 2048w httpsnewsharvardeduwpcontentuploads202209202209_ql_melton1500x546jpg 1500w height491 div
figure
div
pspan douglas melton stem cell researcher a hrefhttpsnewsharvardedugazettestory202111harvarddiabetesresearcherdetailssciencebehindpotentialbreakthroughbreakthrough within reach for diabetes scientist and patients nearest to his heartaspanp
hr
div
figure
div
img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg width1350 altquotation mark srcsethttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2300x31jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21024x106jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2768x80jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21536x159jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_qm_test22048x212jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21500x155jpg 1500w height140 div
figure
div
h3they gave me a choice between swimming in the womens and the mens team the university was supportive of my decision but if i have to break it down the coaches were absolutely key they were behaving like parents who love their kids first and that was incredibly importanth3
div
figure
div
img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202209202209_ql_bailar1350x491jpg width1350 altschuyler bailer srcsethttpsnewsharvardeduwpcontentuploads202209202209_ql_bailar1350x491jpg 1350w httpsnewsharvardeduwpcontentuploads202209202209_ql_bailar300x109jpg 300w httpsnewsharvardeduwpcontentuploads202209202209_ql_bailar1024x373jpg 1024w httpsnewsharvardeduwpcontentuploads202209202209_ql_bailar768x280jpg 768w httpsnewsharvardeduwpcontentuploads202209202209_ql_bailar1536x559jpg 1536w httpsnewsharvardeduwpcontentuploads202209202209_ql_bailar2048x745jpg 2048w httpsnewsharvardeduwpcontentuploads202209202209_ql_bailar1500x546jpg 1500w height491 div
figure
div
pspanschuyler bailar first openly transgender swimmer in ncaa division i a hrefhttpsnewsharvardedugazettestory201905ncaasfirstopenlytransgenderswimmerschuylerbailarfindshisrealselfandflourishesatharvardschuyler bailar races toward his authentic selfaspanp
hr
div
figure
div
img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg width1350 altquotation mark srcsethttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2300x31jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21024x106jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2768x80jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21536x159jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_qm_test22048x212jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21500x155jpg 1500w height140 div
figure
div
h3native students are using education not as a tool of assimilation to strip us of our identities but instead to uplift and advocate for our own tribal communitiesh3
div
figure
div
img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202209202209_ql_maltais1350x491jpg width1350 altsamantha maltais srcsethttpsnewsharvardeduwpcontentuploads202209202209_ql_maltais1350x491jpg 1350w httpsnewsharvardeduwpcontentuploads202209202209_ql_maltais300x109jpg 300w httpsnewsharvardeduwpcontentuploads202209202209_ql_maltais1024x373jpg 1024w httpsnewsharvardeduwpcontentuploads202209202209_ql_maltais768x280jpg 768w httpsnewsharvardeduwpcontentuploads202209202209_ql_maltais1536x559jpg 1536w httpsnewsharvardeduwpcontentuploads202209202209_ql_maltais2048x745jpg 2048w httpsnewsharvardeduwpcontentuploads202209202209_ql_maltais1500x546jpg 1500w height491 div
figure
div
pspan samantha maltais first wampanoag to attend harvard law a hrefhttpsnewsharvardedugazettestory202111awampanoagbreakthroughatharvardlawschoolstudent of history makes historyaspanp
hr
div
figure
div
img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg width1350 altquotation mark srcsethttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2300x31jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21024x106jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2768x80jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21536x159jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_qm_test22048x212jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21500x155jpg 1500w height140 div
figure
div
h3i was on the top of the world a navy seal going to harvard and i couldnt write my own nameh3
div
figure
div
img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202209202209_ql_lopez1350x491jpg width1350 altsergio lopez srcsethttpsnewsharvardeduwpcontentuploads202209202209_ql_lopez1350x491jpg 1350w httpsnewsharvardeduwpcontentuploads202209202209_ql_lopez300x109jpg 300w httpsnewsharvardeduwpcontentuploads202209202209_ql_lopez1024x373jpg 1024w httpsnewsharvardeduwpcontentuploads202209202209_ql_lopez768x280jpg 768w httpsnewsharvardeduwpcontentuploads202209202209_ql_lopez1536x559jpg 1536w httpsnewsharvardeduwpcontentuploads202209202209_ql_lopez2048x745jpg 2048w httpsnewsharvardeduwpcontentuploads202209202209_ql_lopez1500x546jpg 1500w height491 div
figure
div
pspan sergio lopez veteran a hrefhttpsnewsharvardedugazettestory201911anavysealworkstowardprogressafterfacingthetrialofhislifea navy seal who cheated death finds his voiceaspanp
hr
div
figure
div
img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg width1350 altquotation mark srcsethttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2300x31jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21024x106jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2768x80jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21536x159jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_qm_test22048x212jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21500x155jpg 1500w height140 div
figure
div
h3facts and truth are matters of life and death misinformation disinformation delusions and deceit can killh3
div
figure
div
img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202209202209_ql_baron1350x491jpg width1350 altmarty baron srcsethttpsnewsharvardeduwpcontentuploads202209202209_ql_baron1350x491jpg 1350w httpsnewsharvardeduwpcontentuploads202209202209_ql_baron300x109jpg 300w httpsnewsharvardeduwpcontentuploads202209202209_ql_baron1024x373jpg 1024w httpsnewsharvardeduwpcontentuploads202209202209_ql_baron768x280jpg 768w httpsnewsharvardeduwpcontentuploads202209202209_ql_baron1536x559jpg 1536w httpsnewsharvardeduwpcontentuploads202209202209_ql_baron2048x745jpg 2048w httpsnewsharvardeduwpcontentuploads202209202209_ql_baron1500x546jpg 1500w height491 div
figure
div
pspan marty baron washington post editor a hrefhttpsnewsharvardedugazettestory202005martinbaronsmessagetoclassof2020factsandtruthmatterthe danger of misinformation disinformation delusions and deceitaspanp
hr
div
figure
div
img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg width1350 altquotation mark srcsethttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2300x31jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21024x106jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2768x80jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21536x159jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_qm_test22048x212jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21500x155jpg 1500w height140 div
figure
div
h3it is harder for me to imagine a female actor striking a female comedian who made a comment or a bad joke then i start thinking is gender a piece of thish3
pspan anna precht director of mclean hospitals 3east boys intensive program a hrefhttpsnewsharvardedugazettestory202203waitwhatifwillsmithwasjustbeingamanwait what if will smith was just being a manaspanp
hr
div
figure
div
img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg width1350 altquotation mark srcsethttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2300x31jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21024x106jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2768x80jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21536x159jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_qm_test22048x212jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21500x155jpg 1500w height140 div
figure
div
h3humans are the most social animal on the planet and conversation is the bread and butter of social life we may not live by bread alone but we die without ith3
pspan daniel gilbert social psychologist a hrefhttpsnewsharvardedugazettestory202103researchersfindconversationsdontendwhenpeoplewantthemtoknow why conversations either seem too short or too longaspanp
hr
div
figure
div
img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg width1350 altquotation mark srcsethttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2300x31jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21024x106jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2768x80jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21536x159jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_qm_test22048x212jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21500x155jpg 1500w height140 div
figure
div
h3i always joke that i live in boston and its a city of 3 million people but i actually socialize more and meet more people when im at the south poleh3
pspan marion dierickx researcher a hrefhttpsnewsharvardedugazettestory201909harvardscientistsatthesouthpolelife on the iceaspanp
hr
div
figure
div
img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg width1350 altquotation mark srcsethttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2300x31jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21024x106jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2768x80jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21536x159jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_qm_test22048x212jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21500x155jpg 1500w height140 div
figure
div
h3search until you find a passion and go all out to excel in its expressionh3
div
figure
div
img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202209202209_ql_eowilson1350x491jpg width1350 alteo wilson srcsethttpsnewsharvardeduwpcontentuploads202209202209_ql_eowilson1350x491jpg 1350w httpsnewsharvardeduwpcontentuploads202209202209_ql_eowilson300x109jpg 300w httpsnewsharvardeduwpcontentuploads202209202209_ql_eowilson1024x373jpg 1024w httpsnewsharvardeduwpcontentuploads202209202209_ql_eowilson768x280jpg 768w httpsnewsharvardeduwpcontentuploads202209202209_ql_eowilson1536x559jpg 1536w httpsnewsharvardeduwpcontentuploads202209202209_ql_eowilson2048x745jpg 2048w httpsnewsharvardeduwpcontentuploads202209202209_ql_eowilson1500x546jpg 1500w height491 div
figure
div
pspan eo wilson 19292021 biologist a hrefhttpsnewsharvardedugazettestory201404searchuntilyoufindapassionandgoallouttoexcelinitsexpressionexperienceaspanp
hr
div
figure
div
img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg width1350 altquotation mark srcsethttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2300x31jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21024x106jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2768x80jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21536x159jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_qm_test22048x212jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21500x155jpg 1500w height140 div
figure
div
h3what the hell why dont i just go to harvard and turn my life upside downh3
div
figure
div
img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202209202209_ql_faust1350x491jpg width1350 altdrew faust srcsethttpsnewsharvardeduwpcontentuploads202209202209_ql_faust1350x491jpg 1350w httpsnewsharvardeduwpcontentuploads202209202209_ql_faust300x109jpg 300w httpsnewsharvardeduwpcontentuploads202209202209_ql_faust1024x373jpg 1024w httpsnewsharvardeduwpcontentuploads202209202209_ql_faust768x280jpg 768w httpsnewsharvardeduwpcontentuploads202209202209_ql_faust1536x559jpg 1536w httpsnewsharvardeduwpcontentuploads202209202209_ql_faust2048x745jpg 2048w httpsnewsharvardeduwpcontentuploads202209202209_ql_faust1500x546jpg 1500w height491 div
figure
div
pspan drew faust former harvard president a hrefhttpsnewsharvardedugazettestory201805harvardpresidentdrewfaustonlifedeathexperienceaspanp
hr
div
figure
div
img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg width1350 altquotation mark srcsethttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2300x31jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21024x106jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2768x80jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21536x159jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_qm_test22048x212jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21500x155jpg 1500w height140 div
figure
div
h3people often ask me if i could go back in time what would i most want to see and do in the world of the american revolution and my answer is im a woman i wouldnt want to go back in time for five minutesh3
div
figure
div
img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202209202209_ql_kamensky1350x491jpg width1350 altjane kamensky srcsethttpsnewsharvardeduwpcontentuploads202209202209_ql_kamensky1350x491jpg 1350w httpsnewsharvardeduwpcontentuploads202209202209_ql_kamensky300x109jpg 300w httpsnewsharvardeduwpcontentuploads202209202209_ql_kamensky1024x373jpg 1024w httpsnewsharvardeduwpcontentuploads202209202209_ql_kamensky768x280jpg 768w httpsnewsharvardeduwpcontentuploads202209202209_ql_kamensky1536x559jpg 1536w httpsnewsharvardeduwpcontentuploads202209202209_ql_kamensky2048x745jpg 2048w httpsnewsharvardeduwpcontentuploads202209202209_ql_kamensky1500x546jpg 1500w height491 div
figure
div
pspan jane kamensky historian a hrefhttpsnewsharvardedugazettestory202205whenabortionwasntalegalissuewhen abortion wasnt a legal issueaspanp
hr
div
figure
div
img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg width1350 altquotation mark srcsethttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2300x31jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21024x106jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2768x80jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21536x159jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_qm_test22048x212jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21500x155jpg 1500w height140 div
figure
div
h3our individual liberties are not givens democracy is not something we can take for granted neither is peace and neither is prosperity but if we break down the walls that hem us in if we step out into the open and have the courage to embrace new beginnings everything is possibleh3
div
figure
div
img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202209202209_ql_merkel1350x491jpg width1350 altangela merkel srcsethttpsnewsharvardeduwpcontentuploads202209202209_ql_merkel1350x491jpg 1350w httpsnewsharvardeduwpcontentuploads202209202209_ql_merkel300x109jpg 300w httpsnewsharvardeduwpcontentuploads202209202209_ql_merkel1024x373jpg 1024w httpsnewsharvardeduwpcontentuploads202209202209_ql_merkel768x280jpg 768w httpsnewsharvardeduwpcontentuploads202209202209_ql_merkel1536x559jpg 1536w httpsnewsharvardeduwpcontentuploads202209202209_ql_merkel2048x745jpg 2048w httpsnewsharvardeduwpcontentuploads202209202209_ql_merkel1500x546jpg 1500w height491 div
figure
div
pspan angela merkel chancellor of germany a hrefhttpsnewsharvardedugazettestory201905atharvardcommencementmerkeltellsgradsbreakthewallsthathemyouinmerkel advises graduates break the walls that hem you inaspanp
hr
div
figure
div
img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg width1350 altquotation mark srcsethttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2300x31jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21024x106jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2768x80jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21536x159jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_qm_test22048x212jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21500x155jpg 1500w height140 div
figure
div
h3there are so many bad things that can happen well short of civil war that i wish we as a country were talking more abouth3
pspan jay ulfelder political scientist a hrefhttpsnewsharvardedugazettestory202201harvardpoliticalscientistsaysuscivilwarunlikelywe dont need a civil war to be in serious troubleaspanp
hr
div
figure
div
img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg width1350 altquotation mark srcsethttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2300x31jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21024x106jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2768x80jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21536x159jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_qm_test22048x212jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21500x155jpg 1500w height140 div
figure
div
h3in late 1969 had you asked the question what do you think about the environment i think the most common response would have been what is the environmenth3
div
figure
div
img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202209202209_ql_hayes1350x491jpg width1350 altdenis hayes srcsethttpsnewsharvardeduwpcontentuploads202209202209_ql_hayes1350x491jpg 1350w httpsnewsharvardeduwpcontentuploads202209202209_ql_hayes300x109jpg 300w httpsnewsharvardeduwpcontentuploads202209202209_ql_hayes1024x373jpg 1024w httpsnewsharvardeduwpcontentuploads202209202209_ql_hayes768x280jpg 768w httpsnewsharvardeduwpcontentuploads202209202209_ql_hayes1536x559jpg 1536w httpsnewsharvardeduwpcontentuploads202209202209_ql_hayes2048x745jpg 2048w httpsnewsharvardeduwpcontentuploads202209202209_ql_hayes1500x546jpg 1500w height491 div
figure
div
pspan denis hayes earth day cofounder a hrefhttpsnewsharvardedugazettestory202004denishayesoneofearthdaysfounders50yearsagoreflectshow earth day gave birth to environmental movementaspanp
hr
div
figure
div
img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg width1350 altquotation mark srcsethttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2300x31jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21024x106jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2768x80jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21536x159jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_qm_test22048x212jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21500x155jpg 1500w height140 div
figure
div
h3think about it grey parrot outperforms harvard undergrads thats pretty freaking awesome we had students concentrating in engineering premeds this that seniors and he just kicked their buttsh3
pspan hrag pailian researcher a hrefhttpsnewsharvardedugazettestory202007africangreyparrotoutperformschildrenandcollegestudentswhen a bird brain tops harvard students on a testaspanp
hr
div
figure
div
img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg width1350 altquotation mark srcsethttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2300x31jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21024x106jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2768x80jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21536x159jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_qm_test22048x212jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21500x155jpg 1500w height140 div
figure
div
h3psychologists have a certain way of studying intelligence they have a certain notion of what intelligence means and how to test for it i was kind of a bull in a china shop when i came out with my theory psychologists never liked my ideas educators found that it spoke to themh3
div
figure
div
img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202209202209_ql_gardner1350x491jpg width1350 althoward gardner srcsethttpsnewsharvardeduwpcontentuploads202209202209_ql_gardner1350x491jpg 1350w httpsnewsharvardeduwpcontentuploads202209202209_ql_gardner300x109jpg 300w httpsnewsharvardeduwpcontentuploads202209202209_ql_gardner1024x373jpg 1024w httpsnewsharvardeduwpcontentuploads202209202209_ql_gardner768x280jpg 768w httpsnewsharvardeduwpcontentuploads202209202209_ql_gardner1536x559jpg 1536w httpsnewsharvardeduwpcontentuploads202209202209_ql_gardner2048x745jpg 2048w httpsnewsharvardeduwpcontentuploads202209202209_ql_gardner1500x546jpg 1500w height491 div
figure
div
pspan howard gardner psychologist a hrefhttpsnewsharvardedugazettestory201805harvardscholarhowardgardnerreflectsonhislifeandworkexperienceaspanp
hr
div
figure
div
img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg width1350 altquotation mark srcsethttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2300x31jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21024x106jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2768x80jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21536x159jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_qm_test22048x212jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21500x155jpg 1500w height140 div
figure
div
h3psychologists say that humans can handle four independent variables and when we get to five were lost so ai is coming at the perfect time it has the potential to rescue us from data overloadh3
div
figure
div
img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202209202209_ql_truog1350x491jpg width1350 altrobert truog srcsethttpsnewsharvardeduwpcontentuploads202209202209_ql_truog1350x491jpg 1350w httpsnewsharvardeduwpcontentuploads202209202209_ql_truog300x109jpg 300w httpsnewsharvardeduwpcontentuploads202209202209_ql_truog1024x373jpg 1024w httpsnewsharvardeduwpcontentuploads202209202209_ql_truog768x280jpg 768w httpsnewsharvardeduwpcontentuploads202209202209_ql_truog1536x559jpg 1536w httpsnewsharvardeduwpcontentuploads202209202209_ql_truog2048x745jpg 2048w httpsnewsharvardeduwpcontentuploads202209202209_ql_truog1500x546jpg 1500w height491 div
figure
div
pspan robert truog bioethicist a hrefhttpsnewsharvardedugazettestory202011risksandbenefitsofanairevolutioninmedicineai revolution in medicineaspanp
hr
div
figure
div
img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg width1350 altquotation mark srcsethttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2300x31jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21024x106jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2768x80jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21536x159jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_qm_test22048x212jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21500x155jpg 1500w height140 div
figure
div
h3both in politics and in everyday life one of the worst things we could do is get used to death treat it as unremarkable or as anything other than a lossh3
pspan susanna siegel philosopher a hrefhttpsnewsharvardedugazettestory202111howdeathshapeslifeaccordingtoaharvardphilosopherhow death shapes lifeaspanp
hr
div
figure
div
img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg width1350 altquotation mark srcsethttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2300x31jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21024x106jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2768x80jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21536x159jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_qm_test22048x212jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21500x155jpg 1500w height140 div
figure
div
h3that would be natasha rostov in war and peace who goes from a most vital enchanting and unpredictable girl to the most boring and conventional of women completely ruined by motherhood and of course tolstoyh3
div
figure
div
img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202209202209_ql_jen1350x491jpg width1350 altgish jen srcsethttpsnewsharvardeduwpcontentuploads202209202209_ql_jen1350x491jpg 1350w httpsnewsharvardeduwpcontentuploads202209202209_ql_jen300x109jpg 300w httpsnewsharvardeduwpcontentuploads202209202209_ql_jen1024x373jpg 1024w httpsnewsharvardeduwpcontentuploads202209202209_ql_jen768x280jpg 768w httpsnewsharvardeduwpcontentuploads202209202209_ql_jen1536x559jpg 1536w httpsnewsharvardeduwpcontentuploads202209202209_ql_jen2048x745jpg 2048w httpsnewsharvardeduwpcontentuploads202209202209_ql_jen1500x546jpg 1500w height491 div
figure
div
pspan gish jen novelist a hrefhttpsnewsharvardedugazettestory202206whoisyourfavoriteliteraryherovillainwho is your favorite literary hero villainaspanp
hr
div
figure
div
img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg width1350 altquotation mark srcsethttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2300x31jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21024x106jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2768x80jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21536x159jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_qm_test22048x212jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21500x155jpg 1500w height140 div
figure
div
h3my own reactions to hearing music or seeing dance or theater that i really love is the almost irresistible urge that i have to leave as soon as possibleh3
div
figure
div
img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202209202209_ql_anderson1350x491jpg width1350 altlaurie anderson srcsethttpsnewsharvardeduwpcontentuploads202209202209_ql_anderson1350x491jpg 1350w httpsnewsharvardeduwpcontentuploads202209202209_ql_anderson300x109jpg 300w httpsnewsharvardeduwpcontentuploads202209202209_ql_anderson1024x373jpg 1024w httpsnewsharvardeduwpcontentuploads202209202209_ql_anderson768x280jpg 768w httpsnewsharvardeduwpcontentuploads202209202209_ql_anderson1536x559jpg 1536w httpsnewsharvardeduwpcontentuploads202209202209_ql_anderson2048x745jpg 2048w httpsnewsharvardeduwpcontentuploads202209202209_ql_anderson1500x546jpg 1500w height491 div
figure
div
pspan laurie anderson artist a hrefhttpsnewsharvardedugazettestory202102laurieandersonbringsheruniquestyletothenortonlectureso superwomanaspanp
hr
div
figure
div
img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg width1350 altquotation mark srcsethttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2300x31jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21024x106jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2768x80jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21536x159jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_qm_test22048x212jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21500x155jpg 1500w height140 div
figure
div
h3the mere fact that you started with something does not mean you were entitled to ith3
div
figure
div
img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202209202209_ql_cohen1350x491jpg width1350 alti glenn cohen srcsethttpsnewsharvardeduwpcontentuploads202209202209_ql_cohen1350x491jpg 1350w httpsnewsharvardeduwpcontentuploads202209202209_ql_cohen300x109jpg 300w httpsnewsharvardeduwpcontentuploads202209202209_ql_cohen1024x373jpg 1024w httpsnewsharvardeduwpcontentuploads202209202209_ql_cohen768x280jpg 768w httpsnewsharvardeduwpcontentuploads202209202209_ql_cohen1536x559jpg 1536w httpsnewsharvardeduwpcontentuploads202209202209_ql_cohen2048x745jpg 2048w httpsnewsharvardeduwpcontentuploads202209202209_ql_cohen1500x546jpg 1500w height491 div
figure
div
pspan i glenn cohen law professor a hrefhttpsnewsharvardedugazettestory201907focalpointiglenncohenarguesagainstbaselinebiasone thing to change question that status quoaspanp
hr
div
figure
div
img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg width1350 altquotation mark srcsethttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2300x31jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21024x106jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2768x80jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21536x159jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_qm_test22048x212jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21500x155jpg 1500w height140 div
figure
div
h3the real core of someone telling another to put on a mask is fearh3
pspan david h rosmarin psychologist a hrefhttpsnewsharvardedugazettestory202008acloserlookatamericaspandemicfueledangersoothing advice for mad americaaspanp
hr
div
figure
div
img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg width1350 altquotation mark srcsethttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2300x31jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21024x106jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2768x80jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21536x159jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_qm_test22048x212jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21500x155jpg 1500w height140 div
figure
div
h3it was really like direct action it was like the radical feminists invading the miss america contest or the black panthers standing in front of oakland city hall with riflesh3
pspan michael bronski author of a queer history of the united states a hrefhttpsnewsharvardedugazettestory201906harvardscholarsreflectonthehistoryandlegacyofthestonewallriotsstonewall then and nowaspanp
hr
div
figure
div
img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg width1350 altquotation mark srcsethttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2300x31jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21024x106jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2768x80jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21536x159jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_qm_test22048x212jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21500x155jpg 1500w height140 div
figure
div
h3in this situation we dont simply want to frantically struggle to restore the status quo because the status quo wasnt operating at an effective level and certainly wasnt serving all of our children fairlyh3
div
figure
div
img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202209202209_ql_reville1350x491jpg width1350 altpaul reville srcsethttpsnewsharvardeduwpcontentuploads202209202209_ql_reville1350x491jpg 1350w httpsnewsharvardeduwpcontentuploads202209202209_ql_reville300x109jpg 300w httpsnewsharvardeduwpcontentuploads202209202209_ql_reville1024x373jpg 1024w httpsnewsharvardeduwpcontentuploads202209202209_ql_reville768x280jpg 768w httpsnewsharvardeduwpcontentuploads202209202209_ql_reville1536x559jpg 1536w httpsnewsharvardeduwpcontentuploads202209202209_ql_reville2048x745jpg 2048w httpsnewsharvardeduwpcontentuploads202209202209_ql_reville1500x546jpg 1500w height491 div
figure
div
pspan paul reville former massachusetts secretary of education a hrefhttpsnewsharvardedugazettestory202004thepandemicsimpactoneducationtime to fix american education with raceforspace resolveaspanp
hr
div
figure
div
img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg width1350 altquotation mark srcsethttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2300x31jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21024x106jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2768x80jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21536x159jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_qm_test22048x212jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21500x155jpg 1500w height140 div
figure
div
h3there is this idea of america as the shining city on the hill as this example of democracy achieved as the redeemer nation baldwin is insisting and i agree with him that if were going to grow up as a nation we have to confront that fantasy we have to confront that lieh3
pspan eddie s glaude jr chair of department of african american studies at princeton university a hrefhttpsnewsharvardedugazettestory202204howuscanconfrontmythofitsdemocracyaccordingtoeddieglaudeblack progress white angeraspanp
hr
div
figure
div
img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg width1350 altquotation mark srcsethttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2300x31jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21024x106jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2768x80jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21536x159jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_qm_test22048x212jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21500x155jpg 1500w height140 div
figure
div
h3theres an irony in the fact that a country that has always been predicated on reinvention and looking to the future now seems to draw its greatest strength from an event that happened 80 years in the pasth3
div
figure
div
img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202209202209_ql_samet1350x491jpg width1350 altelizabeth samet srcsethttpsnewsharvardeduwpcontentuploads202209202209_ql_samet1350x491jpg 1350w httpsnewsharvardeduwpcontentuploads202209202209_ql_samet300x109jpg 300w httpsnewsharvardeduwpcontentuploads202209202209_ql_samet1024x373jpg 1024w httpsnewsharvardeduwpcontentuploads202209202209_ql_samet768x280jpg 768w httpsnewsharvardeduwpcontentuploads202209202209_ql_samet1536x559jpg 1536w httpsnewsharvardeduwpcontentuploads202209202209_ql_samet2048x745jpg 2048w httpsnewsharvardeduwpcontentuploads202209202209_ql_samet1500x546jpg 1500w height491 div
figure
div
pspan elizabeth d samet west point scholar a hrefhttpsnewsharvardedugazettestory202201whyworldwariiwasntallthatgoodhow good war wasnt all that goodaspanp
hr
div
figure
div
img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg width1350 altquotation mark srcsethttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2300x31jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21024x106jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2768x80jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21536x159jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_qm_test22048x212jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21500x155jpg 1500w height140 div
figure
div
h3for centuries weve demonized the curiosity of women like eve and pandora blaming them for bringing sin and evil into the world yet curiosity has served women well in our cultural imaginationh3
div
figure
div
img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202209202209_ql_tatar1350x491jpg width1350 altmaria tatar srcsethttpsnewsharvardeduwpcontentuploads202209202209_ql_tatar1350x491jpg 1350w httpsnewsharvardeduwpcontentuploads202209202209_ql_tatar300x109jpg 300w httpsnewsharvardeduwpcontentuploads202209202209_ql_tatar1024x373jpg 1024w httpsnewsharvardeduwpcontentuploads202209202209_ql_tatar768x280jpg 768w httpsnewsharvardeduwpcontentuploads202209202209_ql_tatar1536x559jpg 1536w httpsnewsharvardeduwpcontentuploads202209202209_ql_tatar2048x745jpg 2048w httpsnewsharvardeduwpcontentuploads202209202209_ql_tatar1500x546jpg 1500w height491 div
figure
div
pspan maria tatar john l loeb professor of germanic languages and literatures a hrefhttpsnewsharvardedugazettestory202111harvardscholarcelebratesheroinesgenuine heroinesaspanp
hr
div
figure
div
img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg width1350 altquotation mark srcsethttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2300x31jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21024x106jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2768x80jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21536x159jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_qm_test22048x212jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21500x155jpg 1500w height140 div
figure
div
h3i kept wondering what venus as an enslaved person would be would she have ever imagined a future in which someone like me attending harvard was possibleh3
div
figure
div
img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202209202209_ql_omonuk1350x491jpg width1350 altsuzannah omonuk srcsethttpsnewsharvardeduwpcontentuploads202209202209_ql_omonuk1350x491jpg 1350w httpsnewsharvardeduwpcontentuploads202209202209_ql_omonuk300x109jpg 300w httpsnewsharvardeduwpcontentuploads202209202209_ql_omonuk1024x373jpg 1024w httpsnewsharvardeduwpcontentuploads202209202209_ql_omonuk768x280jpg 768w httpsnewsharvardeduwpcontentuploads202209202209_ql_omonuk1536x559jpg 1536w httpsnewsharvardeduwpcontentuploads202209202209_ql_omonuk2048x745jpg 2048w httpsnewsharvardeduwpcontentuploads202209202209_ql_omonuk1500x546jpg 1500w height491 div
figure
div
pspan suzannah omonuk poet a hrefhttpsnewsharvardedugazettestory202104studentpoemgivesvoicetoenslavedwomanoncampusin18thcenturya poem for venusaspanp
hr
div
figure
div
img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg width1350 altquotation mark srcsethttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2300x31jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21024x106jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2768x80jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21536x159jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_qm_test22048x212jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21500x155jpg 1500w height140 div
figure
div
h3i see archives now as the richest source of real life you never know what detail what strange twist will come together and open up a new picture for youh3
pspan irina klyagin archivist a hrefhttpsnewsharvardedugazettestory202111harvardlibrarianunearthslessoninsovietarchiveprized manuscript and valuable lesson unearthed in soviet archiveaspanp
p p
hr
div
figure
div
img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg width1350 altquotation mark srcsethttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2300x31jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21024x106jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2768x80jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21536x159jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_qm_test22048x212jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21500x155jpg 1500w height140 div
figure
div
h3everyone has called me intense with that bad connotation like you wont smile im proud that im intense im not going to apologize for thath3
div
figure
div
img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202209202209_ql_straus1350x491jpg width1350 altaurora straus srcsethttpsnewsharvardeduwpcontentuploads202209202209_ql_straus1350x491jpg 1350w httpsnewsharvardeduwpcontentuploads202209202209_ql_straus300x109jpg 300w httpsnewsharvardeduwpcontentuploads202209202209_ql_straus1024x373jpg 1024w httpsnewsharvardeduwpcontentuploads202209202209_ql_straus768x280jpg 768w httpsnewsharvardeduwpcontentuploads202209202209_ql_straus1536x559jpg 1536w httpsnewsharvardeduwpcontentuploads202209202209_ql_straus2048x745jpg 2048w httpsnewsharvardeduwpcontentuploads202209202209_ql_straus1500x546jpg 1500w height491 div
figure
div
pspan aurora straus professional race car driver a hrefhttpsnewsharvardedugazettestory201905harvardstudentandracecardriveraurorastrauscompeteswithpurposelife in the fast laneaspanp
hr
div
figure
div
img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg width1350 altquotation mark srcsethttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2300x31jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21024x106jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2768x80jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21536x159jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_qm_test22048x212jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21500x155jpg 1500w height140 div
figure
div
h3i went from thinking shes my oddball greataunt to thinking shes really a geniush3
div
figure
div
img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202209202209_ql_deloria1350x491jpg width1350 altphilip deloria srcsethttpsnewsharvardeduwpcontentuploads202209202209_ql_deloria1350x491jpg 1350w httpsnewsharvardeduwpcontentuploads202209202209_ql_deloria300x109jpg 300w httpsnewsharvardeduwpcontentuploads202209202209_ql_deloria1024x373jpg 1024w httpsnewsharvardeduwpcontentuploads202209202209_ql_deloria768x280jpg 768w httpsnewsharvardeduwpcontentuploads202209202209_ql_deloria1536x559jpg 1536w httpsnewsharvardeduwpcontentuploads202209202209_ql_deloria2048x745jpg 2048w httpsnewsharvardeduwpcontentuploads202209202209_ql_deloria1500x546jpg 1500w height491 div
figure
div
pspan philip deloria historian a hrefhttpsnewsharvardedugazettestory201907insiouxauntsworkhistorianfindsartonfringesofmodernismtraditiona colorful figureaspanp
hr
div
figure
div
img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg width1350 altquotation mark srcsethttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2300x31jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21024x106jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2768x80jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21536x159jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_qm_test22048x212jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21500x155jpg 1500w height140 div
figure
div
h3clarity is of course important but for me the really important thing in translating even prose is that all writing has a kind of music to ith3
pspan arthur goldhammer translator a hrefhttpsnewsharvardedugazettestory202009arthurgoldhammerontheartoftranslationin translation he found his raison dtreaspanp
hr
div
figure
div
img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg width1350 altquotation mark srcsethttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2300x31jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21024x106jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2768x80jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21536x159jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_qm_test22048x212jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21500x155jpg 1500w height140 div
figure
div
h3you cannot outrun a bad diet nor can you outeat an inactive lifestyleh3
div
figure
div
img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202209202209_ql_ilee1350x491jpg width1350 altiminn lee srcsethttpsnewsharvardeduwpcontentuploads202209202209_ql_ilee1350x491jpg 1350w httpsnewsharvardeduwpcontentuploads202209202209_ql_ilee300x109jpg 300w httpsnewsharvardeduwpcontentuploads202209202209_ql_ilee1024x373jpg 1024w httpsnewsharvardeduwpcontentuploads202209202209_ql_ilee768x280jpg 768w httpsnewsharvardeduwpcontentuploads202209202209_ql_ilee1536x559jpg 1536w httpsnewsharvardeduwpcontentuploads202209202209_ql_ilee2048x745jpg 2048w httpsnewsharvardeduwpcontentuploads202209202209_ql_ilee1500x546jpg 1500w height491 div
figure
div
pspan imin lee epidemiologist a hrefhttpsnewsharvardedugazettestory202207gorgetodaysweattomorrowthatsnothowitworksgorge today sweat tomorrow thats not how it worksaspanp
p p
hr
div
figure
div
img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg width1350 altquotation mark srcsethttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2300x31jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21024x106jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2768x80jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21536x159jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_qm_test22048x212jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21500x155jpg 1500w height140 div
figure
div
h3being at sea is a really pure form of living all you care about are the basics of sleeping eating taking care of yourself taking care of the boat making sure everythings working and being totally aware of the weatherh3
pspan jim hammitt professor of economics and decision sciences a hrefhttpsnewsharvardedugazettestory202110chanschoolshammittsailssolotobermudawinsracesailing alone under the stars and fastaspanp
p p
|
pthe pages gazette rich research history analysis debate voices years weve heard scholars researchers scientists artists authors course soldiers activists nurses racecar driver taking look wanted share found collection necessarily intentionally incomplete alive read come month inspired moment added listp pp div figure div img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg width1350 altquotation mark srcsethttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2300x31jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21024x106jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2768x80jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21536x159jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_qm_test22048x212jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21500x155jpg 1500w height140 div figure div h3i oddly mistrustful easeh3 div figure div img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202209202209_ql_messud1350x491jpg width1350 altclaire messud srcsethttpsnewsharvardeduwpcontentuploads202209202209_ql_messud1350x491jpg 1350w httpsnewsharvardeduwpcontentuploads202209202209_ql_messud300x109jpg 300w httpsnewsharvardeduwpcontentuploads202209202209_ql_messud1024x373jpg 1024w httpsnewsharvardeduwpcontentuploads202209202209_ql_messud768x280jpg 768w httpsnewsharvardeduwpcontentuploads202209202209_ql_messud1536x559jpg 1536w httpsnewsharvardeduwpcontentuploads202209202209_ql_messud2048x745jpg 2048w httpsnewsharvardeduwpcontentuploads202209202209_ql_messud1500x546jpg 1500w height491 div figure div pspan claire messud author hrefhttpsnewsharvardedugazettestory201602turnsofnarrativeturns narrativeaspanp hr div figure div img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg width1350 altquotation mark srcsethttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2300x31jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21024x106jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2768x80jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21536x159jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_qm_test22048x212jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21500x155jpg 1500w height140 div figure div h3i think learned art dada surrealism trust learned trust place wanted inside wanted wanted engaged worldh3 pspan jeff koons artist hrefhttpsnewsharvardedugazettestory201702jeffkoonshighkingofmiddlebrowhigh king middlebrowaspanp hr div figure div img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg width1350 altquotation mark srcsethttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2300x31jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21024x106jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2768x80jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21536x159jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_qm_test22048x212jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21500x155jpg 1500w height140 div figure div h3experience higgs boson normativity value gives values value example value honesty honesty valuable value honesty gutlevel way generally beneficial people dishonest causes harm negatively impacts lived experienceh3 div figure div img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_ql_greenej_test1350x491jpg width1350 altjoshua greene srcsethttpsnewsharvardeduwpcontentuploads202208202208_ql_greenej_test1350x491jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_ql_greenej_test300x109jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_ql_greenej_test1024x373jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_ql_greenej_test768x280jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_ql_greenej_test1536x559jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_ql_greenej_test2048x745jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_ql_greenej_test1500x546jpg 1500w height491 div figure div pspan joshua greene psychologist hrefhttpsnewsharvardedugazettestory201311deeppragmatismasamoralenginedeep pragmatism moral engineaspanp hr div figure div img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg width1350 altquotation mark srcsethttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2300x31jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21024x106jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2768x80jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21536x159jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_qm_test22048x212jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21500x155jpg 1500w height140 div figure div h3as sun rose got hotter hotter started passing horses near mountain mile 18 passing horses biggest thrills running life ive felt competitive racing horses end indescribably primal urge beat themh3 div figure div img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_ql_liebermand_test1350x491jpg width1350 altdaniel lieberman srcsethttpsnewsharvardeduwpcontentuploads202208202208_ql_liebermand_test1350x491jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_ql_liebermand_test300x109jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_ql_liebermand_test1024x373jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_ql_liebermand_test768x280jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_ql_liebermand_test1536x559jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_ql_liebermand_test2048x745jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_ql_liebermand_test1500x546jpg 1500w height491 div figure div pspan daniel lieberman evolutionary biologist hrefhttpsnewsharvardedugazettestory201804harvardevolutionarybiologistdanielliebermanonthepastpresentandfutureofspeedhow fast runaspanp hr div figure div img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg width1350 altquotation mark srcsethttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2300x31jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21024x106jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2768x80jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21536x159jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_qm_test22048x212jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21500x155jpg 1500w height140 div figure div h3loneliness kills powerful smoking alcoholismh3 pspan robert waldinger psychiatrist hrefhttpsnewsharvardedugazettestory201704overnearly80yearsharvardstudyhasbeenshowinghowtoliveahealthyandhappylifegood genes nice joy betteraspanp hr div figure div img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg width1350 altquotation mark srcsethttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2300x31jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21024x106jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2768x80jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21536x159jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_qm_test22048x212jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21500x155jpg 1500w height140 div figure div h3i love writing essays hate writing books ideas books ive written generally come things come archives think important wish people knew wish write book read exist read people written book feel like awfulh3 div figure div img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_ql_leporej_test1350x491jpg width1350 altjill lepore srcsethttpsnewsharvardeduwpcontentuploads202208202208_ql_leporej_test1350x491jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_ql_leporej_test300x109jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_ql_leporej_test1024x373jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_ql_leporej_test768x280jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_ql_leporej_test1536x559jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_ql_leporej_test2048x745jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_ql_leporej_test1500x546jpg 1500w height491 div figure div pspan jill lepore historian hrefhttpsnewsharvardedugazettestory201704thewritinglifeofharvardhistorianjillleporethe art matteraspanp hr div figure div img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg width1350 altquotation mark srcsethttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2300x31jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21024x106jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2768x80jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21536x159jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_qm_test22048x212jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21500x155jpg 1500w height140 div figure div h3i remember walking street past person firm worked person passed didnt know recognized didnt recognize remember thinking gave time enterprise given mother felt justifiable way actually loved think understood thats regret thats ridiculous didnt time expected haveh3 div figure div img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_ql_agr1350x491jpg width1350 altannette gordon reed srcsethttpsnewsharvardeduwpcontentuploads202208202208_ql_agr1350x491jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_ql_agr300x109jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_ql_agr1024x373jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_ql_agr768x280jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_ql_agr1536x559jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_ql_agr2048x745jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_ql_agr1500x546jpg 1500w height491 div figure div pspan annette gordonreed historian hrefhttpsnewsharvardedugazettestory201705pulitzerprizewinnerannettegordonreedreflectsonherpersonalhistoryexperienceaspanp hr div figure div img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg width1350 altquotation mark srcsethttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2300x31jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21024x106jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2768x80jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21536x159jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_qm_test22048x212jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21500x155jpg 1500w height140 div figure div h3good poetry similar quality moves sings says surprising unexpected maybe says hadnt realized thought knew felt gives voice seeks silenceh3 div figure div img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_ql_youngk1350x491jpg width1350 altkevin young srcsethttpsnewsharvardeduwpcontentuploads202208202208_ql_youngk1350x491jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_ql_youngk300x109jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_ql_youngk1024x373jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_ql_youngk768x280jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_ql_youngk1536x559jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_ql_youngk2048x745jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_ql_youngk1500x546jpg 1500w height491 div figure div pspan kevin young poet hrefhttpsnewsharvardedugazettestory202011kevinyoung92discussesnewroleasmuseumdirectorkevin young unified theory black culture himselfaspanp hr div figure div img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg width1350 altquotation mark srcsethttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2300x31jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21024x106jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2768x80jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21536x159jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_qm_test22048x212jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21500x155jpg 1500w height140 div figure div h3you walk theres performance onetime performance patient want scar beautiful kids going god willing 70 80 yearsh3 pspan terry buchmiller surgeon musician hrefhttpsnewsharvardedugazettestory201505leavingabeautifulscarleaving beautiful scaraspanp hr div figure div img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg width1350 altquotation mark srcsethttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2300x31jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21024x106jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2768x80jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21536x159jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_qm_test22048x212jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21500x155jpg 1500w height140 div figure div h3if determinism predictability universe breaks black holes break situations worse determinism breaks cant sure past history history books memories illusions past tells lose identityh3 div figure div img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_ql_hawking1350x491jpg width1350 altstephen hawking srcsethttpsnewsharvardeduwpcontentuploads202208202208_ql_hawking1350x491jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_ql_hawking300x109jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_ql_hawking1024x373jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_ql_hawking768x280jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_ql_hawking1536x559jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_ql_hawking2048x745jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_ql_hawking1500x546jpg 1500w height491 div figure div pspan stephen hawking 19422018 physicist hrefhttpsnewsharvardedugazettestory201604hawkingatharvardhawking harvardaspanp hr div figure div img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg width1350 altquotation mark srcsethttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2300x31jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21024x106jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2768x80jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21536x159jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_qm_test22048x212jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21500x155jpg 1500w height140 div figure div h3why talk benefits failure simply failure meant stripping away inessential stopped pretending began direct energy finishing work mattered meh3 div figure div img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_ql_rowling1350x491jpg width1350 altjk rowling srcsethttpsnewsharvardeduwpcontentuploads202208202208_ql_rowling1350x491jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_ql_rowling300x109jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_ql_rowling1024x373jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_ql_rowling768x280jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_ql_rowling1536x559jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_ql_rowling2048x745jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_ql_rowling1500x546jpg 1500w height491 div figure div pspan jk rowling novelist hrefhttpsnewsharvardedugazettestory200806textofjkrowlingspeechthe fringe benefits failure importance imaginationaspanp hr div figure div img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg width1350 altquotation mark srcsethttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2300x31jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21024x106jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2768x80jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21536x159jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_qm_test22048x212jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21500x155jpg 1500w height140 div figure div h3ignorance acknowledged opportunity ignorance denied closed door takes courage admit truth knowh3 div figure div img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_ql_adichie1350x491jpg width1350 altchimamanda ngozi adichie srcsethttpsnewsharvardeduwpcontentuploads202208202208_ql_adichie1350x491jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_ql_adichie300x109jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_ql_adichie1024x373jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_ql_adichie768x280jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_ql_adichie1536x559jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_ql_adichie2048x745jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_ql_adichie1500x546jpg 1500w height491 div figure div pspan chimamanda ngozi adichie novelist hrefhttpsnewsharvardedugazettestory201805harvardsclassdayspeakerurgesstudentstoprotectandvaluethetruthintheirownlivesadichie protect value truthaspanp hr div figure div img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg width1350 altquotation mark srcsethttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2300x31jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21024x106jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2768x80jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21536x159jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_qm_test22048x212jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21500x155jpg 1500w height140 div figure div h3wellbehaved women seldom historyh3 div figure div img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202209202209_ql_ulrich1350x491jpg width1350 altlaurel thatcher ulrich srcsethttpsnewsharvardeduwpcontentuploads202209202209_ql_ulrich1350x491jpg 1350w httpsnewsharvardeduwpcontentuploads202209202209_ql_ulrich300x109jpg 300w httpsnewsharvardeduwpcontentuploads202209202209_ql_ulrich1024x373jpg 1024w httpsnewsharvardeduwpcontentuploads202209202209_ql_ulrich768x280jpg 768w httpsnewsharvardeduwpcontentuploads202209202209_ql_ulrich1536x559jpg 1536w httpsnewsharvardeduwpcontentuploads202209202209_ql_ulrich2048x745jpg 2048w httpsnewsharvardeduwpcontentuploads202209202209_ql_ulrich1500x546jpg 1500w height491 div figure div pspan laurel thatcher ulrich historian hrefhttpsnewsharvardedugazettestory201410ihadtheadvantageofdisadvantageexperienceaspanp hr div figure div img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg width1350 altquotation mark srcsethttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2300x31jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21024x106jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2768x80jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21536x159jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_qm_test22048x212jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21500x155jpg 1500w height140 div figure div h3life teaches presence matters people respond commitment deliberateness away phone conversation thats decision counts people care offer attention empathy built little gestures ones communicate dont know want learnh3 pspan sherry turkle psychologist hrefhttpsnewsharvardedugazettestory201705atphibetakappaceremonyacalltoempathyat pbk ceremony empathyaspanp hr div figure div img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg width1350 altquotation mark srcsethttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2300x31jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21024x106jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2768x80jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21536x159jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_qm_test22048x212jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21500x155jpg 1500w height140 div figure div h3im writer hidden away world work political role writer believe dangerous positions behalf voices easily heardh3 div figure div img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_ql_cole1350x491jpg width1350 altteju cole srcsethttpsnewsharvardeduwpcontentuploads202208202208_ql_cole1350x491jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_ql_cole300x109jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_ql_cole1024x373jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_ql_cole768x280jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_ql_cole1536x559jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_ql_cole2048x745jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_ql_cole1500x546jpg 1500w height491 div figure div pspan teju cole novelist critic hrefhttpsnewsharvardedugazettestory201812opencityauthortejucoletoteachcreativewritingatharvardauthor urge creativewriting students genre limitsaspanp hr div figure div img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg width1350 altquotation mark srcsethttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2300x31jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21024x106jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2768x80jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21536x159jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_qm_test22048x212jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21500x155jpg 1500w height140 div figure div h3expressions goodness trivial work incidental writing fact want lifechanging properties illuminate decisively moral questions embedded narrativeh3 div figure div img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_ql_morrison1350x491jpg width1350 alttoni morrison srcsethttpsnewsharvardeduwpcontentuploads202208202208_ql_morrison1350x491jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_ql_morrison300x109jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_ql_morrison1024x373jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_ql_morrison768x280jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_ql_morrison1536x559jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_ql_morrison2048x745jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_ql_morrison1500x546jpg 1500w height491 div figure div pspan toni morrison 19312019 novelist hrefhttpsnewsharvardedugazettestory201212goodbutneversimplegood simpleaspanp hr div figure div img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg width1350 altquotation mark srcsethttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2300x31jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21024x106jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2768x80jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21536x159jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_qm_test22048x212jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21500x155jpg 1500w height140 div figure div h3we dont system makes possible vanquish foes live 1000 years power grateful thats youd think listen politicians treat contempt hatred win silence foes kick platforms campuses thats way miserable ultimately loseh3 div figure div img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_ql_brooks1350x491jpg width1350 altarthur brooks srcsethttpsnewsharvardeduwpcontentuploads202208202208_ql_brooks1350x491jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_ql_brooks300x109jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_ql_brooks1024x373jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_ql_brooks768x280jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_ql_brooks1536x559jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_ql_brooks2048x745jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_ql_brooks1500x546jpg 1500w height491 div figure div pspan arthur brooks social scientist hrefhttpsnewsharvardedugazettestory202106happinessscholarofferslessonsinhealingriftshappiness scholar cites ways start healing riftsaspanp hr div figure div img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg width1350 altquotation mark srcsethttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2300x31jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21024x106jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2768x80jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21536x159jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_qm_test22048x212jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21500x155jpg 1500w height140 div figure div h3this romanticization good death cant good death youre 23yearold girl huge ovarian mass like colleagues removed mirebalais central haiti cant good death youre 17yearold girl saw mumbai monday drugresistant tuberculosis parents weeping options running holding someones hand die bullshit fight want toh3 div figure div img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_ql_farmer1350x491jpg width1350 alt srcsethttpsnewsharvardeduwpcontentuploads202208202208_ql_farmer1350x491jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_ql_farmer300x109jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_ql_farmer1024x373jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_ql_farmer768x280jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_ql_farmer1536x559jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_ql_farmer2048x745jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_ql_farmer1500x546jpg 1500w height491 div figure div pspan paul farmer 19592022 physician cofounder partners health hrefhttpsnewsharvardedugazettestory201805harvardspaulfarmerontravelingtheworldtofightinequalityinhealthexperienceaspanp hr div figure div img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg width1350 altquotation mark srcsethttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2300x31jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21024x106jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2768x80jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21536x159jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_qm_test22048x212jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21500x155jpg 1500w height140 div figure div h3an awareness infirmity unaided human intuition conventional wisdom educated personh3 div figure div img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202209202209_ql_pinker21350x491jpg width1350 altsteven pinker srcsethttpsnewsharvardeduwpcontentuploads202209202209_ql_pinker21350x491jpg 1350w httpsnewsharvardeduwpcontentuploads202209202209_ql_pinker2300x109jpg 300w httpsnewsharvardeduwpcontentuploads202209202209_ql_pinker21024x373jpg 1024w httpsnewsharvardeduwpcontentuploads202209202209_ql_pinker2768x280jpg 768w httpsnewsharvardeduwpcontentuploads202209202209_ql_pinker21536x559jpg 1536w httpsnewsharvardeduwpcontentuploads202209202209_ql_pinker22048x745jpg 2048w httpsnewsharvardeduwpcontentuploads202209202209_ql_pinker21500x546jpg 1500w height491 div figure div pspan steven pinker psychologist hrefhttpsnewsharvardedugazettestory201906focalpointharvardprofessorstevenpinkersaysthetruthliesinthedataanecdotes arent dataaspanp hr div figure div img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg width1350 altquotation mark srcsethttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2300x31jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21024x106jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2768x80jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21536x159jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_qm_test22048x212jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21500x155jpg 1500w height140 div figure div h3my ambitions racial shrunk feel chastened thats im talking racial decency opposed racial equality sense possible foreseeable future diminishedh3 div figure div img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_ql_kennedy1350x491jpg width1350 alt srcsethttpsnewsharvardeduwpcontentuploads202208202208_ql_kennedy1350x491jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_ql_kennedy300x109jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_ql_kennedy1024x373jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_ql_kennedy768x280jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_ql_kennedy1536x559jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_ql_kennedy2048x745jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_ql_kennedy1500x546jpg 1500w height491 div figure div pspan randall kennedy legal scholar hrefhttpsnewsharvardedugazettestory202109randallkennedyspeakshismindinhisnewbooksayitloudif randall kennedy ran worldaspanp hr div figure div img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg width1350 altquotation mark srcsethttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2300x31jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21024x106jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2768x80jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21536x159jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_qm_test22048x212jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21500x155jpg 1500w height140 div figure div h3i understand question vital importance people particularly mothers artists trying work know feel struggle male writer asked question im going respectfully decline answer ith3 div figure div img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_ql_groff1350x491jpg width1350 altlauren groff srcsethttpsnewsharvardeduwpcontentuploads202208202208_ql_groff1350x491jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_ql_groff300x109jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_ql_groff1024x373jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_ql_groff768x280jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_ql_groff1536x559jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_ql_groff2048x745jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_ql_groff1500x546jpg 1500w height491 div figure div pspan lauren groff novelist response question talk process manage work family hrefhttpsnewsharvardedugazettestory201807laurengroffonfloridaasastateofmindalienation proves fertile state mind lauren groffaspanp hr div figure div img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg width1350 altquotation mark srcsethttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2300x31jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21024x106jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2768x80jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21536x159jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_qm_test22048x212jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21500x155jpg 1500w height140 div figure div h3drugs contribute smooth workings society economy muck caffeine fosters kind consciousness thats sober focused gives people energy great boon capitalism wayh3 div figure div img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_ql_pollan1350x491jpg width1350 altmichael pollan srcsethttpsnewsharvardeduwpcontentuploads202208202208_ql_pollan1350x491jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_ql_pollan300x109jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_ql_pollan1024x373jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_ql_pollan768x280jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_ql_pollan1536x559jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_ql_pollan2048x745jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_ql_pollan1500x546jpg 1500w height491 div figure div pspan michael pollan author journalist hrefhttpsnewsharvardedugazettestory202108michaelpollandiscussesnewbookthisisyourmindonplantsmichael pollan digs deeper drugsbr aspanp hr div figure div img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg width1350 altquotation mark srcsethttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2300x31jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21024x106jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2768x80jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21536x159jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_qm_test22048x212jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21500x155jpg 1500w height140 div figure div h3she didnt look like glamorous woman didnt behave like restrained woman theres incredible personality work odds succeeds publich3 pspan marylne altieri curator hrefhttpsnewsharvardedugazettestory202204becomingjuliachildbecoming julia childaspanp hr div figure div img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg width1350 altquotation mark srcsethttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2300x31jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21024x106jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2768x80jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21536x159jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_qm_test22048x212jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21500x155jpg 1500w height140 div figure div h3i think know lot scientifically love brain couple decades ago think makes better love helping people love probably muchh3 div figure div img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_ql_schwartz1350x491jpg width1350 altrichard schwartz srcsethttpsnewsharvardeduwpcontentuploads202208202208_ql_schwartz1350x491jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_ql_schwartz300x109jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_ql_schwartz1024x373jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_ql_schwartz768x280jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_ql_schwartz1536x559jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_ql_schwartz2048x745jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_ql_schwartz1500x546jpg 1500w height491 div figure div pspan richard schwartz psychiatrist hrefhttpsnewsharvardedugazettestory201802scientistsfindafewsurprisesintheirstudyoflovewhen love science double dateaspanp hr div figure div img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg width1350 altquotation mark srcsethttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2300x31jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21024x106jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2768x80jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21536x159jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_qm_test22048x212jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21500x155jpg 1500w height140 div figure div h3you sense note beethoven piece bursts existence result uncontainable pressure building long time piece born pressure finally unbearableh3 div figure div img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_ql_aucoin1350x491jpg width1350 altmatthew aucoin srcsethttpsnewsharvardeduwpcontentuploads202208202208_ql_aucoin1350x491jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_ql_aucoin300x109jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_ql_aucoin1024x373jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_ql_aucoin768x280jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_ql_aucoin1536x559jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_ql_aucoin2048x745jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_ql_aucoin1500x546jpg 1500w height491 div figure div pspan matthew aucoin composer hrefhttpsnewsharvardedugazettestory202012harvardcomposersreflectonbeethovenat250beethoven 250aspanp hr div figure div img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg width1350 altquotation mark srcsethttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2300x31jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21024x106jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2768x80jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21536x159jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_qm_test22048x212jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21500x155jpg 1500w height140 div figure div h3the voice reading page writing page voice wanted myselfh3 div figure div img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202209202209_ql_gorman1350x491jpg width1350 altamanda gorman srcsethttpsnewsharvardeduwpcontentuploads202209202209_ql_gorman1350x491jpg 1350w httpsnewsharvardeduwpcontentuploads202209202209_ql_gorman300x109jpg 300w httpsnewsharvardeduwpcontentuploads202209202209_ql_gorman1024x373jpg 1024w httpsnewsharvardeduwpcontentuploads202209202209_ql_gorman768x280jpg 768w httpsnewsharvardeduwpcontentuploads202209202209_ql_gorman1536x559jpg 1536w httpsnewsharvardeduwpcontentuploads202209202209_ql_gorman2048x745jpg 2048w httpsnewsharvardeduwpcontentuploads202209202209_ql_gorman1500x546jpg 1500w height491 div figure div pspan amanda gorman inaugural youth poet laureate hrefhttpsnewsharvardedugazettestory201810youthpoetlaureateamandagormandeliverspoematharvardpresidentsinaugurationthe poetic perspectiveaspanp hr div figure div img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg width1350 altquotation mark srcsethttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2300x31jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21024x106jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2768x80jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21536x159jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_qm_test22048x212jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21500x155jpg 1500w height140 div figure div h3you inform gut trust ith3 div figure div img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_ql_kahneman1350x491jpg width1350 altdaniel kahneman srcsethttpsnewsharvardeduwpcontentuploads202208202208_ql_kahneman1350x491jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_ql_kahneman300x109jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_ql_kahneman1024x373jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_ql_kahneman768x280jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_ql_kahneman1536x559jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_ql_kahneman2048x745jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_ql_kahneman1500x546jpg 1500w height491 div figure div pspan daniel kahneman psychologist hrefhttpsnewsharvardedugazettestory202112danielkahnemanonhowtoinfluenceothersnegotiating irrationalaspanp hr div figure div img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg width1350 altquotation mark srcsethttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2300x31jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21024x106jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2768x80jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21536x159jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_qm_test22048x212jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21500x155jpg 1500w height140 div figure div h3the older gotten sleep need older work sense time shorter want ith3 div figure div img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_ql_patterson1350x491jpg width1350 altorlando patterson srcsethttpsnewsharvardeduwpcontentuploads202208202208_ql_patterson1350x491jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_ql_patterson300x109jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_ql_patterson1024x373jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_ql_patterson768x280jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_ql_patterson1536x559jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_ql_patterson2048x745jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_ql_patterson1500x546jpg 1500w height491 div figure div pspan orlando patterson sociologist hrefhttpsnewsharvardedugazettestory202202is80thenew60is 80 new 60aspanp hr div figure div img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg width1350 altquotation mark srcsethttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2300x31jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21024x106jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2768x80jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21536x159jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_qm_test22048x212jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21500x155jpg 1500w height140 div figure div h3a beautiful narrative arc reassures baffling events meaningful ulysses appeared instrument chaos anarchist bombh3 div figure div img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_ql_birmingham1350x491jpg width1350 altkevin birmingham srcsethttpsnewsharvardeduwpcontentuploads202208202208_ql_birmingham1350x491jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_ql_birmingham300x109jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_ql_birmingham1024x373jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_ql_birmingham768x280jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_ql_birmingham1536x559jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_ql_birmingham2048x745jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_ql_birmingham1500x546jpg 1500w height491 div figure div pspan kevin birmingham author hrefhttpsnewsharvardedugazettestory202202rockypathtopublicationformostdangerousbookrocky path publication dangerous bookaspanp hr div figure div img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg width1350 altquotation mark srcsethttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2300x31jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21024x106jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2768x80jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21536x159jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_qm_test22048x212jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21500x155jpg 1500w height140 div figure div h3i wanted warn future social movements listening ones generate dangerous amounts unrealism worry parts left falling trap todayh3 div figure div img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_ql_mansbridge1350x491jpg width1350 alt srcsethttpsnewsharvardeduwpcontentuploads202208202208_ql_mansbridge1350x491jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_ql_mansbridge300x109jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_ql_mansbridge1024x373jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_ql_mansbridge768x280jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_ql_mansbridge1536x559jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_ql_mansbridge2048x745jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_ql_mansbridge1500x546jpg 1500w height491 div figure div pspan jane mansbridge political scientist hrefhttpsnewsharvardedugazettestory202009theevolutionofpoliticalscientistjanemansbridgeslifeandcareerexperienceaspanp hr div figure div img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg width1350 altquotation mark srcsethttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2300x31jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21024x106jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2768x80jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21536x159jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_qm_test22048x212jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21500x155jpg 1500w height140 div figure div h3insurgents detonated 30 35 pounds homemade explosives feet took legs immediately sat hitting ground thinking maybe broken leg legs goneh3 div figure div img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202209202209_ql_galeazzi1350x491jpg width1350 altgreg galeazzi srcsethttpsnewsharvardeduwpcontentuploads202209202209_ql_galeazzi1350x491jpg 1350w httpsnewsharvardeduwpcontentuploads202209202209_ql_galeazzi300x109jpg 300w httpsnewsharvardeduwpcontentuploads202209202209_ql_galeazzi1024x373jpg 1024w httpsnewsharvardeduwpcontentuploads202209202209_ql_galeazzi768x280jpg 768w httpsnewsharvardeduwpcontentuploads202209202209_ql_galeazzi1536x559jpg 1536w httpsnewsharvardeduwpcontentuploads202209202209_ql_galeazzi2048x745jpg 2048w httpsnewsharvardeduwpcontentuploads202209202209_ql_galeazzi1500x546jpg 1500w height491 div figure div pspan greg galeazzi veteran hrefhttpsnewsharvardedugazettestory202109veteranandharvardmedicalstudentdiscussesafghanistanbetween army medical school stop hellaspanp hr div figure div img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg width1350 altquotation mark srcsethttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2300x31jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21024x106jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2768x80jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21536x159jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_qm_test22048x212jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21500x155jpg 1500w height140 div figure div h3you miss certain features reality youre trying write simple models worldh3 div figure div img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202209202209_ql_chetty1350x491jpg width1350 altraj chetty srcsethttpsnewsharvardeduwpcontentuploads202209202209_ql_chetty1350x491jpg 1350w httpsnewsharvardeduwpcontentuploads202209202209_ql_chetty300x109jpg 300w httpsnewsharvardeduwpcontentuploads202209202209_ql_chetty1024x373jpg 1024w httpsnewsharvardeduwpcontentuploads202209202209_ql_chetty768x280jpg 768w httpsnewsharvardeduwpcontentuploads202209202209_ql_chetty1536x559jpg 1536w httpsnewsharvardeduwpcontentuploads202209202209_ql_chetty2048x745jpg 2048w httpsnewsharvardeduwpcontentuploads202209202209_ql_chetty1500x546jpg 1500w height491 div figure div pspan raj chetty economist hrefhttpsnewsharvardedugazettestory200912thepersonalsideofeconomicsthe personal economicsaspanp hr div figure div img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg width1350 altquotation mark srcsethttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2300x31jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21024x106jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2768x80jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21536x159jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_qm_test22048x212jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21500x155jpg 1500w height140 div figure div h3my philosophy simple thats right fair stand speak outh3 div figure div img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202209202209_ql_lewis1350x491jpg width1350 altjohn lewis srcsethttpsnewsharvardeduwpcontentuploads202209202209_ql_lewis1350x491jpg 1350w httpsnewsharvardeduwpcontentuploads202209202209_ql_lewis300x109jpg 300w httpsnewsharvardeduwpcontentuploads202209202209_ql_lewis1024x373jpg 1024w httpsnewsharvardeduwpcontentuploads202209202209_ql_lewis768x280jpg 768w httpsnewsharvardeduwpcontentuploads202209202209_ql_lewis1536x559jpg 1536w httpsnewsharvardeduwpcontentuploads202209202209_ql_lewis2048x745jpg 2048w httpsnewsharvardeduwpcontentuploads202209202209_ql_lewis1500x546jpg 1500w height491 div figure div pspan rep john lewis 19402020 hrefhttpsnewsharvardedugazettestory201805lewisandfausttellclassof18torisetooccasionfacing future lewis faust reason hopeaspanp hr div figure div img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg width1350 altquotation mark srcsethttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2300x31jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21024x106jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2768x80jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21536x159jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_qm_test22048x212jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21500x155jpg 1500w height140 div figure div h3if resources invest data quality far invest data quantity badquality data essentially wiping power think haveh3 div figure div img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202209202209_ql_meng1350x491jpg width1350 altxiaoli meng srcsethttpsnewsharvardeduwpcontentuploads202209202209_ql_meng1350x491jpg 1350w httpsnewsharvardeduwpcontentuploads202209202209_ql_meng300x109jpg 300w httpsnewsharvardeduwpcontentuploads202209202209_ql_meng1024x373jpg 1024w httpsnewsharvardeduwpcontentuploads202209202209_ql_meng768x280jpg 768w httpsnewsharvardeduwpcontentuploads202209202209_ql_meng1536x559jpg 1536w httpsnewsharvardeduwpcontentuploads202209202209_ql_meng2048x745jpg 2048w httpsnewsharvardeduwpcontentuploads202209202209_ql_meng1500x546jpg 1500w height491 div figure div pspan xiaoli meng statistician hrefhttpsnewsharvardedugazettestory202112vaccinationsurveysfellvictimtobigdataparadoxharvardresearcherssay2 early vaccination surveys worse worthless thanks big data paradoxaspanp hr div figure div img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg width1350 altquotation mark srcsethttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2300x31jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21024x106jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2768x80jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21536x159jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_qm_test22048x212jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21500x155jpg 1500w height140 div figure div h3in unequal society land want believe success morally justified meritocratic society means winners believe earned success talent hard workh3 div figure div img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202209202209_ql_sandel1350x491jpg width1350 altmichael sandel srcsethttpsnewsharvardeduwpcontentuploads202209202209_ql_sandel1350x491jpg 1350w httpsnewsharvardeduwpcontentuploads202209202209_ql_sandel300x109jpg 300w httpsnewsharvardeduwpcontentuploads202209202209_ql_sandel1024x373jpg 1024w httpsnewsharvardeduwpcontentuploads202209202209_ql_sandel768x280jpg 768w httpsnewsharvardeduwpcontentuploads202209202209_ql_sandel1536x559jpg 1536w httpsnewsharvardeduwpcontentuploads202209202209_ql_sandel2048x745jpg 2048w httpsnewsharvardeduwpcontentuploads202209202209_ql_sandel1500x546jpg 1500w height491 div figure div pspan michael j sandel philosopher hrefhttpsnewsharvardedugazettestory202101themythofmeritocracyaccordingtomichaelsandeltoppling myth meritocracyaspanp hr div figure div img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg width1350 altquotation mark srcsethttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2300x31jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21024x106jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2768x80jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21536x159jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_qm_test22048x212jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21500x155jpg 1500w height140 div figure div h3you build courage stop deaths innocent children eventually lose power countryh3 div figure div img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_ql_corin1350x491jpg width1350 altjaclyn corin srcsethttpsnewsharvardeduwpcontentuploads202208202208_ql_corin1350x491jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_ql_corin300x109jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_ql_corin1024x373jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_ql_corin768x280jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_ql_corin1536x559jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_ql_corin2048x745jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_ql_corin1500x546jpg 1500w height491 div figure div pspan jaclyn corin march lives cofounder hrefhttpsnewsharvardedugazettestory202206deadlymassshootingsreigniteyouthguncontrolpushmass shootings reignite youth gun control pushaspanp hr div figure div img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg width1350 altquotation mark srcsethttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2300x31jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21024x106jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2768x80jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21536x159jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_qm_test22048x212jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21500x155jpg 1500w height140 div figure div h3maybe need stop thinking cases cure cancer maybe dont need curable long healthy livesh3 div figure div img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202209202209_ql_rebbeck1350x491jpg width1350 alttimothy rebbeck srcsethttpsnewsharvardeduwpcontentuploads202209202209_ql_rebbeck1350x491jpg 1350w httpsnewsharvardeduwpcontentuploads202209202209_ql_rebbeck300x109jpg 300w httpsnewsharvardeduwpcontentuploads202209202209_ql_rebbeck1024x373jpg 1024w httpsnewsharvardeduwpcontentuploads202209202209_ql_rebbeck768x280jpg 768w httpsnewsharvardeduwpcontentuploads202209202209_ql_rebbeck1536x559jpg 1536w httpsnewsharvardeduwpcontentuploads202209202209_ql_rebbeck2048x745jpg 2048w httpsnewsharvardeduwpcontentuploads202209202209_ql_rebbeck1500x546jpg 1500w height491 div figure div pspan timothy rebbeck professor cancer prevention hrefhttpsnewsharvardedugazettestory202203bringingthecancerfightbackdowntoearthbringing cancer fight earthaspanp hr div figure div img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg width1350 altquotation mark srcsethttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2300x31jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21024x106jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2768x80jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21536x159jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_qm_test22048x212jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21500x155jpg 1500w height140 div figure div h3i believe power choice shape fate recognize hugely important role social structures play limiting ones choices heart debate ralph ellison stressed role choice agency black people richard wright stressed determining deleterious effects socioeconomic structureh3 div figure div img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202209202209_ql_gates1350x491jpg width1350 althenry louis skip gates jr srcsethttpsnewsharvardeduwpcontentuploads202209202209_ql_gates1350x491jpg 1350w httpsnewsharvardeduwpcontentuploads202209202209_ql_gates300x109jpg 300w httpsnewsharvardeduwpcontentuploads202209202209_ql_gates1024x373jpg 1024w httpsnewsharvardeduwpcontentuploads202209202209_ql_gates768x280jpg 768w httpsnewsharvardeduwpcontentuploads202209202209_ql_gates1536x559jpg 1536w httpsnewsharvardeduwpcontentuploads202209202209_ql_gates2048x745jpg 2048w httpsnewsharvardeduwpcontentuploads202209202209_ql_gates1500x546jpg 1500w height491 div figure div pspan henry louis skip gates jr historian hrefhttpsnewsharvardedugazettestory201802harvardscholarsgatestatarilluminateafricanamericanfolktalesafricanamerican folklore inspires meeting mindsaspanp hr div figure div img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg width1350 altquotation mark srcsethttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2300x31jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21024x106jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2768x80jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21536x159jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_qm_test22048x212jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21500x155jpg 1500w height140 div figure div h3we created grand con potentially dangerous convincing rest society technology things actually doh3 div figure div img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202209202209_ql_gajos1350x491jpg width1350 altkrzysztof gajos srcsethttpsnewsharvardeduwpcontentuploads202209202209_ql_gajos1350x491jpg 1350w httpsnewsharvardeduwpcontentuploads202209202209_ql_gajos300x109jpg 300w httpsnewsharvardeduwpcontentuploads202209202209_ql_gajos1024x373jpg 1024w httpsnewsharvardeduwpcontentuploads202209202209_ql_gajos768x280jpg 768w httpsnewsharvardeduwpcontentuploads202209202209_ql_gajos1536x559jpg 1536w httpsnewsharvardeduwpcontentuploads202209202209_ql_gajos2048x745jpg 2048w httpsnewsharvardeduwpcontentuploads202209202209_ql_gajos1500x546jpg 1500w height491 div figure div pspan krzysztof gajos computer scientist hrefhttpsnewsharvardedugazettestory202111harvardexpertconsiderstheliterarymeritofaiwhen robot write novelaspanp hr div figure div img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg width1350 altquotation mark srcsethttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2300x31jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21024x106jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2768x80jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21536x159jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_qm_test22048x212jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21500x155jpg 1500w height140 div figure div h3i think weve met onceinageneration job shove momenth3 div figure div img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202209202209_ql_katz21350x491jpg width1350 altlawrence katz srcsethttpsnewsharvardeduwpcontentuploads202209202209_ql_katz21350x491jpg 1350w httpsnewsharvardeduwpcontentuploads202209202209_ql_katz2300x109jpg 300w httpsnewsharvardeduwpcontentuploads202209202209_ql_katz21024x373jpg 1024w httpsnewsharvardeduwpcontentuploads202209202209_ql_katz2768x280jpg 768w httpsnewsharvardeduwpcontentuploads202209202209_ql_katz21536x559jpg 1536w httpsnewsharvardeduwpcontentuploads202209202209_ql_katz22048x745jpg 2048w httpsnewsharvardeduwpcontentuploads202209202209_ql_katz21500x546jpg 1500w height491 div figure div pspan lawrence katz labor economist hrefhttpsnewsharvardedugazettestory202110harvardeconomistshedslightongreatresignationi quit rage blip sea changeaspanp hr div figure div img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg width1350 altquotation mark srcsethttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2300x31jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21024x106jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2768x80jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21536x159jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_qm_test22048x212jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21500x155jpg 1500w height140 div figure div h3we know healthy meal looks like know exercise good pollution bad know lot places spend timeh3 div figure div img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202209202209_ql_allen1350x491jpg width1350 altjoe allen srcsethttpsnewsharvardeduwpcontentuploads202209202209_ql_allen1350x491jpg 1350w httpsnewsharvardeduwpcontentuploads202209202209_ql_allen300x109jpg 300w httpsnewsharvardeduwpcontentuploads202209202209_ql_allen1024x373jpg 1024w httpsnewsharvardeduwpcontentuploads202209202209_ql_allen768x280jpg 768w httpsnewsharvardeduwpcontentuploads202209202209_ql_allen1536x559jpg 1536w httpsnewsharvardeduwpcontentuploads202209202209_ql_allen2048x745jpg 2048w httpsnewsharvardeduwpcontentuploads202209202209_ql_allen1500x546jpg 1500w height491 div figure div pspan joe allen public health expert hrefhttpsnewsharvardedugazettestory201906harvardresearchersoutlinestepstoahealthyhomeis home making sickaspanp hr div figure div img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg width1350 altquotation mark srcsethttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2300x31jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21024x106jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2768x80jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21536x159jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_qm_test22048x212jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21500x155jpg 1500w height140 div figure div h3the problem democracy prevented democracy occurring precisely citizens major carbonemitting democracies benefit cheap gasoline global tradeh3 pspan jonathan franzen novelist hrefhttpsnewsharvardedugazettestory201704jonathanfranzenhassomechoicewordsforliberalssome choice words liberalsaspanp hr div figure div img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg width1350 altquotation mark srcsethttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2300x31jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21024x106jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2768x80jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21536x159jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_qm_test22048x212jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21500x155jpg 1500w height140 div figure div h3slightly women men phds classics vast majority translations readers read english classics men issue talk ith3 div figure div img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202209202209_ql_emilywilson1350x491jpg width1350 altemily wilson srcsethttpsnewsharvardeduwpcontentuploads202209202209_ql_emilywilson1350x491jpg 1350w httpsnewsharvardeduwpcontentuploads202209202209_ql_emilywilson300x109jpg 300w httpsnewsharvardeduwpcontentuploads202209202209_ql_emilywilson1024x373jpg 1024w httpsnewsharvardeduwpcontentuploads202209202209_ql_emilywilson768x280jpg 768w httpsnewsharvardeduwpcontentuploads202209202209_ql_emilywilson1536x559jpg 1536w httpsnewsharvardeduwpcontentuploads202209202209_ql_emilywilson2048x745jpg 2048w httpsnewsharvardeduwpcontentuploads202209202209_ql_emilywilson1500x546jpg 1500w height491 div figure div pspan emily wilson classicist hrefhttpsnewsharvardedugazettestory201802womanscholarstakeontheodysseynew chapter odysseyaspanp hr div figure div img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg width1350 altquotation mark srcsethttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2300x31jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21024x106jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2768x80jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21536x159jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_qm_test22048x212jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21500x155jpg 1500w height140 div figure div h3how tell neonatal intensive care unit nurse assignment today hold ipad family dying adult intensivecare unit patient goodbyeh3 div figure div img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202209202209_ql_tenney1350x491jpg width1350 altmary tenney srcsethttpsnewsharvardeduwpcontentuploads202209202209_ql_tenney1350x491jpg 1350w httpsnewsharvardeduwpcontentuploads202209202209_ql_tenney300x109jpg 300w httpsnewsharvardeduwpcontentuploads202209202209_ql_tenney1024x373jpg 1024w httpsnewsharvardeduwpcontentuploads202209202209_ql_tenney768x280jpg 768w httpsnewsharvardeduwpcontentuploads202209202209_ql_tenney1536x559jpg 1536w httpsnewsharvardeduwpcontentuploads202209202209_ql_tenney2048x745jpg 2048w httpsnewsharvardeduwpcontentuploads202209202209_ql_tenney1500x546jpg 1500w height491 div figure div pspan mary tenney nurse hrefhttpsnewsharvardedugazettestory20211114nursesonlifeandworkduringcovid14 nurses life work covidaspanp hr div figure div img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg width1350 altquotation mark srcsethttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2300x31jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21024x106jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2768x80jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21536x159jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_qm_test22048x212jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21500x155jpg 1500w height140 div figure div h3leadership mind managing change youre managing change youre leading youre presiding job merely preside harvardh3 div figure div img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202209202209_qlbacow1350x491jpg width1350 altlarry bacow srcsethttpsnewsharvardeduwpcontentuploads202209202209_qlbacow1350x491jpg 1350w httpsnewsharvardeduwpcontentuploads202209202209_qlbacow300x109jpg 300w httpsnewsharvardeduwpcontentuploads202209202209_qlbacow1024x373jpg 1024w httpsnewsharvardeduwpcontentuploads202209202209_qlbacow768x280jpg 768w httpsnewsharvardeduwpcontentuploads202209202209_qlbacow1536x559jpg 1536w httpsnewsharvardeduwpcontentuploads202209202209_qlbacow2048x745jpg 2048w httpsnewsharvardeduwpcontentuploads202209202209_qlbacow1500x546jpg 1500w height491 div figure div pspan larry bacow harvard president hrefhttpsnewsharvardedugazettestory201810newharvardpresidentlarrybacowisonalisteningtourlarry bacows listening touraspanp hr div figure div img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg width1350 altquotation mark srcsethttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2300x31jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21024x106jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2768x80jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21536x159jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_qm_test22048x212jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21500x155jpg 1500w height140 div figure div h3most writing like plumbing laying floor digging basement layering brick brick brick edificeh3 div figure div img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202209202209_ql_lee1350x491jpg width1350 altmin jin lee srcsethttpsnewsharvardeduwpcontentuploads202209202209_ql_lee1350x491jpg 1350w httpsnewsharvardeduwpcontentuploads202209202209_ql_lee300x109jpg 300w httpsnewsharvardeduwpcontentuploads202209202209_ql_lee1024x373jpg 1024w httpsnewsharvardeduwpcontentuploads202209202209_ql_lee768x280jpg 768w httpsnewsharvardeduwpcontentuploads202209202209_ql_lee1536x559jpg 1536w httpsnewsharvardeduwpcontentuploads202209202209_ql_lee2048x745jpg 2048w httpsnewsharvardeduwpcontentuploads202209202209_ql_lee1500x546jpg 1500w height491 div figure div pspan min jin lee novelist hrefhttpsnewsharvardedugazettestory201903bestsellingauthorminjinleeisfinishinghertrilogyatradclifferesearching writing historyaspanp hr div figure div img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg width1350 altquotation mark srcsethttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2300x31jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21024x106jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2768x80jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21536x159jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_qm_test22048x212jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21500x155jpg 1500w height140 div figure div h3when death time mode increased energy sharper focush3 div figure div img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202209202209_ql_essex1350x491jpg width1350 altmax essex srcsethttpsnewsharvardeduwpcontentuploads202209202209_ql_essex1350x491jpg 1350w httpsnewsharvardeduwpcontentuploads202209202209_ql_essex300x109jpg 300w httpsnewsharvardeduwpcontentuploads202209202209_ql_essex1024x373jpg 1024w httpsnewsharvardeduwpcontentuploads202209202209_ql_essex768x280jpg 768w httpsnewsharvardeduwpcontentuploads202209202209_ql_essex1536x559jpg 1536w httpsnewsharvardeduwpcontentuploads202209202209_ql_essex2048x745jpg 2048w httpsnewsharvardeduwpcontentuploads202209202209_ql_essex1500x546jpg 1500w height491 div figure div pspan max essex pioneering aids researcher hrefhttpsnewsharvardedugazettestory202005pioneeringaidsresearchermaxessexshareslessonsexperienceaspanp hr div figure div img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg width1350 altquotation mark srcsethttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2300x31jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21024x106jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2768x80jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21536x159jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_qm_test22048x212jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21500x155jpg 1500w height140 div figure div h3ive seen dozens dozens dozens kind bug imaginable attacking dreamer swarms kind flying insect youve heard armies cockroaches racing dreamer masses wriggling worms grasshoppers vampire fangs bed bugs stink bugsh3 div figure div img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202209202209_ql_barrett1350x491jpg width1350 alt srcsethttpsnewsharvardeduwpcontentuploads202209202209_ql_barrett1350x491jpg 1350w httpsnewsharvardeduwpcontentuploads202209202209_ql_barrett300x109jpg 300w httpsnewsharvardeduwpcontentuploads202209202209_ql_barrett1024x373jpg 1024w httpsnewsharvardeduwpcontentuploads202209202209_ql_barrett768x280jpg 768w httpsnewsharvardeduwpcontentuploads202209202209_ql_barrett1536x559jpg 1536w httpsnewsharvardeduwpcontentuploads202209202209_ql_barrett2048x745jpg 2048w httpsnewsharvardeduwpcontentuploads202209202209_ql_barrett1500x546jpg 1500w height491 div figure div pspan deirdre barrett psychologist hrefhttpsnewsharvardedugazettestory202005harvardresearchersaysdreamsindicativeofvirusfearswhat pandemic dreams comeaspanp hr div figure div img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg width1350 altquotation mark srcsethttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2300x31jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21024x106jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2768x80jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21536x159jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_qm_test22048x212jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21500x155jpg 1500w height140 div figure div h3nature alluring attractive natural materials safeh3 pspan robert paarlberg author hrefhttpsnewsharvardedugazettestory202102authorrobertpaarlbergarguesagainstbuyingorganiconly eat organic youre paying worth itaspanp hr div figure div img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg width1350 altquotation mark srcsethttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2300x31jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21024x106jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2768x80jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21536x159jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_qm_test22048x212jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21500x155jpg 1500w height140 div figure div h3that officers casually walked took notes stood chatting bespeaks wall everyday routine indifference profound cultural roots point unconscious biash3 div figure div img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202209202209_ql_bobo1350x491jpg width1350 alt srcsethttpsnewsharvardeduwpcontentuploads202209202209_ql_bobo1350x491jpg 1350w httpsnewsharvardeduwpcontentuploads202209202209_ql_bobo300x109jpg 300w httpsnewsharvardeduwpcontentuploads202209202209_ql_bobo1024x373jpg 1024w httpsnewsharvardeduwpcontentuploads202209202209_ql_bobo768x280jpg 768w httpsnewsharvardeduwpcontentuploads202209202209_ql_bobo1536x559jpg 1536w httpsnewsharvardeduwpcontentuploads202209202209_ql_bobo2048x745jpg 2048w httpsnewsharvardeduwpcontentuploads202209202209_ql_bobo1500x546jpg 1500w height491 div figure div pspan lawrence d bobo sociologist hrefhttpsnewsharvardedugazettestory202006lawrencedboboexaminespolicekillingsofblackmenthe fire timeaspanp hr div figure div img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg width1350 altquotation mark srcsethttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2300x31jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21024x106jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2768x80jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21536x159jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_qm_test22048x212jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21500x155jpg 1500w height140 div figure div h3in lifetime [helium] run humanity finite supply cant moreh3 pspan anthony lowe electronics technician hrefhttpsnewsharvardedugazettestory202206heliumshortage40makesitswaytoharvardglobal helium shortage slams brakes harvard labsaspanp hr div figure div img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg width1350 altquotation mark srcsethttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2300x31jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21024x106jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2768x80jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21536x159jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_qm_test22048x212jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21500x155jpg 1500w height140 div figure div h3maybe whats happening years real face finally emergingh3 div figure div img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202209202209_ql_diaz1350x491jpg width1350 altjunot daz srcsethttpsnewsharvardeduwpcontentuploads202209202209_ql_diaz1350x491jpg 1350w httpsnewsharvardeduwpcontentuploads202209202209_ql_diaz300x109jpg 300w httpsnewsharvardeduwpcontentuploads202209202209_ql_diaz1024x373jpg 1024w httpsnewsharvardeduwpcontentuploads202209202209_ql_diaz768x280jpg 768w httpsnewsharvardeduwpcontentuploads202209202209_ql_diaz1536x559jpg 1536w httpsnewsharvardeduwpcontentuploads202209202209_ql_diaz2048x745jpg 2048w httpsnewsharvardeduwpcontentuploads202209202209_ql_diaz1500x546jpg 1500w height491 div figure div pspan junot daz author hrefhttpsnewsharvardedugazettestory202103thesoundoflockdowndramaticreadingsofradcliffeessaysold masks new faceaspanp hr div figure div img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg width1350 altquotation mark srcsethttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2300x31jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21024x106jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2768x80jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21536x159jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_qm_test22048x212jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21500x155jpg 1500w height140 div figure div h3people disabilities called inspiring usually insignificant things word feels like euphemism pity nondisabled person uses word describe person disability sign theyre feeling overwhelmed uncomfortableh3 div figure div img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202209202209_ql_haben1350x491jpg width1350 althaben girma srcsethttpsnewsharvardeduwpcontentuploads202209202209_ql_haben1350x491jpg 1350w httpsnewsharvardeduwpcontentuploads202209202209_ql_haben300x109jpg 300w httpsnewsharvardeduwpcontentuploads202209202209_ql_haben1024x373jpg 1024w httpsnewsharvardeduwpcontentuploads202209202209_ql_haben768x280jpg 768w httpsnewsharvardeduwpcontentuploads202209202209_ql_haben1536x559jpg 1536w httpsnewsharvardeduwpcontentuploads202209202209_ql_haben2048x745jpg 2048w httpsnewsharvardeduwpcontentuploads202209202209_ql_haben1500x546jpg 1500w height491 div figure div pspan haben girma deafblind woman graduate harvard law school hrefhttpsnewsharvardedugazettestory201911excerptfromthedeafblindwomanwhoconqueredharvardlawone l harderaspanp hr div figure div img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg width1350 altquotation mark srcsethttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2300x31jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21024x106jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2768x80jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21536x159jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_qm_test22048x212jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21500x155jpg 1500w height140 div figure div h3things intriguing theyre slightly edited like shoesh3 div figure div img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202209202209_ql_abloh1350x491jpg width1350 altvirgil abloh srcsethttpsnewsharvardeduwpcontentuploads202209202209_ql_abloh1350x491jpg 1350w httpsnewsharvardeduwpcontentuploads202209202209_ql_abloh300x109jpg 300w httpsnewsharvardeduwpcontentuploads202209202209_ql_abloh1024x373jpg 1024w httpsnewsharvardeduwpcontentuploads202209202209_ql_abloh768x280jpg 768w httpsnewsharvardeduwpcontentuploads202209202209_ql_abloh1536x559jpg 1536w httpsnewsharvardeduwpcontentuploads202209202209_ql_abloh2048x745jpg 2048w httpsnewsharvardeduwpcontentuploads202209202209_ql_abloh1500x546jpg 1500w height491 div figure div pspan virgil abloh 19802021 designer hrefhttpsnewsharvardedugazettestory201711harvardwelcomesvirgilablohforgsdlectureideas sneakers airaspanp hr div figure div img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg width1350 altquotation mark srcsethttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2300x31jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21024x106jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2768x80jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21536x159jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_qm_test22048x212jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21500x155jpg 1500w height140 div figure div h3its art arts sake head idealh3 div figure div img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202209202209_ql_ma1350x491jpg width1350 altyoyo ma srcsethttpsnewsharvardeduwpcontentuploads202209202209_ql_ma1350x491jpg 1350w httpsnewsharvardeduwpcontentuploads202209202209_ql_ma300x109jpg 300w httpsnewsharvardeduwpcontentuploads202209202209_ql_ma1024x373jpg 1024w httpsnewsharvardeduwpcontentuploads202209202209_ql_ma768x280jpg 768w httpsnewsharvardeduwpcontentuploads202209202209_ql_ma1536x559jpg 1536w httpsnewsharvardeduwpcontentuploads202209202209_ql_ma2048x745jpg 2048w httpsnewsharvardeduwpcontentuploads202209202209_ql_ma1500x546jpg 1500w height491 div figure div pspan yoyo ma cellist hrefhttpsnewsharvardedugazettestory201903yoyomaspeakingatharvarditsneverartforartssakei want feltaspanp hr div figure div img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg width1350 altquotation mark srcsethttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2300x31jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21024x106jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2768x80jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21536x159jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_qm_test22048x212jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21500x155jpg 1500w height140 div figure div h3that extraordinarily important thing morally economically people healthier productive people healthier smarterh3 div figure div img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202209202209_ql_summers1350x491jpg width1350 altlawrence summers srcsethttpsnewsharvardeduwpcontentuploads202209202209_ql_summers1350x491jpg 1350w httpsnewsharvardeduwpcontentuploads202209202209_ql_summers300x109jpg 300w httpsnewsharvardeduwpcontentuploads202209202209_ql_summers1024x373jpg 1024w httpsnewsharvardeduwpcontentuploads202209202209_ql_summers768x280jpg 768w httpsnewsharvardeduwpcontentuploads202209202209_ql_summers1536x559jpg 1536w httpsnewsharvardeduwpcontentuploads202209202209_ql_summers2048x745jpg 2048w httpsnewsharvardeduwpcontentuploads202209202209_ql_summers1500x546jpg 1500w height491 div figure div pspan lawrence summers economist harvard president hrefhttpsnewsharvardedugazettestory201504healthasaneconomicenginehealth economic engineaspanp hr div figure div img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg width1350 altquotation mark srcsethttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2300x31jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21024x106jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2768x80jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21536x159jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_qm_test22048x212jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21500x155jpg 1500w height140 div figure div h3im convinced considered writer writeh3 div figure div img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202209202209_ql_reyes1350x491jpg width1350 altruben reyes srcsethttpsnewsharvardeduwpcontentuploads202209202209_ql_reyes1350x491jpg 1350w httpsnewsharvardeduwpcontentuploads202209202209_ql_reyes300x109jpg 300w httpsnewsharvardeduwpcontentuploads202209202209_ql_reyes1024x373jpg 1024w httpsnewsharvardeduwpcontentuploads202209202209_ql_reyes768x280jpg 768w httpsnewsharvardeduwpcontentuploads202209202209_ql_reyes1536x559jpg 1536w httpsnewsharvardeduwpcontentuploads202209202209_ql_reyes2048x745jpg 2048w httpsnewsharvardeduwpcontentuploads202209202209_ql_reyes1500x546jpg 1500w height491 div figure div pspan ruben reyes jr launched student latinx literary magazine hrefhttpsnewsharvardedugazettestory201902harvardseniorlauncheslatinxliterarymagazinea writers journeyaspanp hr div figure div img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg width1350 altquotation mark srcsethttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2300x31jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21024x106jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2768x80jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21536x159jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_qm_test22048x212jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21500x155jpg 1500w height140 div figure div h3i dont know solace religionh3 div figure div img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202209202209_ql_spiegelman1350x491jpg width1350 altart spiegelman srcsethttpsnewsharvardeduwpcontentuploads202209202209_ql_spiegelman1350x491jpg 1350w httpsnewsharvardeduwpcontentuploads202209202209_ql_spiegelman300x109jpg 300w httpsnewsharvardeduwpcontentuploads202209202209_ql_spiegelman1024x373jpg 1024w httpsnewsharvardeduwpcontentuploads202209202209_ql_spiegelman768x280jpg 768w httpsnewsharvardeduwpcontentuploads202209202209_ql_spiegelman1536x559jpg 1536w httpsnewsharvardeduwpcontentuploads202209202209_ql_spiegelman2048x745jpg 2048w httpsnewsharvardeduwpcontentuploads202209202209_ql_spiegelman1500x546jpg 1500w height491 div figure div pspan art spiegelman cartoonist hrefhttpsnewsharvardedugazettestory201709mausauthorartspiegelmantalksartandexistenceatharvardfathers killers god mausaspanp hr div figure div img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg width1350 altquotation mark srcsethttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2300x31jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21024x106jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2768x80jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21536x159jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_qm_test22048x212jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21500x155jpg 1500w height140 div figure div h3are people couple years inventive revolver rubber soul bone body cries brain whispers maybeh3 div figure div img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202209202209_ql_sunstein1350x491jpg width1350 altcass r sunstein srcsethttpsnewsharvardeduwpcontentuploads202209202209_ql_sunstein1350x491jpg 1350w httpsnewsharvardeduwpcontentuploads202209202209_ql_sunstein300x109jpg 300w httpsnewsharvardeduwpcontentuploads202209202209_ql_sunstein1024x373jpg 1024w httpsnewsharvardeduwpcontentuploads202209202209_ql_sunstein768x280jpg 768w httpsnewsharvardeduwpcontentuploads202209202209_ql_sunstein1536x559jpg 1536w httpsnewsharvardeduwpcontentuploads202209202209_ql_sunstein2048x745jpg 2048w httpsnewsharvardeduwpcontentuploads202209202209_ql_sunstein1500x546jpg 1500w height491 div figure div pspan cass r sunstein studies behavioral economics hrefhttpsnewsharvardedugazettestory202203beatlesgotbywithlittleluckandsomefriendswhy bands rocket sputter outaspanp hr div figure div img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg width1350 altquotation mark srcsethttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2300x31jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21024x106jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2768x80jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21536x159jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_qm_test22048x212jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21500x155jpg 1500w height140 div figure div h3we acknowledge harm harvard important past bury stories black resistance excellence leadershiph3 div figure div img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202209202209_ql_brownnagin1350x491jpg width1350 alttomiko brownnagin srcsethttpsnewsharvardeduwpcontentuploads202209202209_ql_brownnagin1350x491jpg 1350w httpsnewsharvardeduwpcontentuploads202209202209_ql_brownnagin300x109jpg 300w httpsnewsharvardeduwpcontentuploads202209202209_ql_brownnagin1024x373jpg 1024w httpsnewsharvardeduwpcontentuploads202209202209_ql_brownnagin768x280jpg 768w httpsnewsharvardeduwpcontentuploads202209202209_ql_brownnagin1536x559jpg 1536w httpsnewsharvardeduwpcontentuploads202209202209_ql_brownnagin2048x745jpg 2048w httpsnewsharvardeduwpcontentuploads202209202209_ql_brownnagin1500x546jpg 1500w height491 div figure div pspan tomiko brownnagin radcliffe dean hrefhttpsnewsharvardedugazettestory202204slaveryprobeharvardstiesinseparablefromriseslavery probe harvards ties inseparable riseaspanp hr div figure div img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg width1350 altquotation mark srcsethttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2300x31jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21024x106jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2768x80jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21536x159jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_qm_test22048x212jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21500x155jpg 1500w height140 div figure div h3when son diagnosed knew diabetes changed research focus thinking parent going thish3 div figure div img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202209202209_ql_melton1350x491jpg width1350 altdouglas melton srcsethttpsnewsharvardeduwpcontentuploads202209202209_ql_melton1350x491jpg 1350w httpsnewsharvardeduwpcontentuploads202209202209_ql_melton300x109jpg 300w httpsnewsharvardeduwpcontentuploads202209202209_ql_melton1024x373jpg 1024w httpsnewsharvardeduwpcontentuploads202209202209_ql_melton768x280jpg 768w httpsnewsharvardeduwpcontentuploads202209202209_ql_melton1536x559jpg 1536w httpsnewsharvardeduwpcontentuploads202209202209_ql_melton2048x745jpg 2048w httpsnewsharvardeduwpcontentuploads202209202209_ql_melton1500x546jpg 1500w height491 div figure div pspan douglas melton stem cell researcher hrefhttpsnewsharvardedugazettestory202111harvarddiabetesresearcherdetailssciencebehindpotentialbreakthroughbreakthrough reach diabetes scientist patients nearest heartaspanp hr div figure div img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg width1350 altquotation mark srcsethttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2300x31jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21024x106jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2768x80jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21536x159jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_qm_test22048x212jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21500x155jpg 1500w height140 div figure div h3they gave choice swimming womens mens team university supportive decision break coaches absolutely key behaving like parents love kids incredibly importanth3 div figure div img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202209202209_ql_bailar1350x491jpg width1350 altschuyler bailer srcsethttpsnewsharvardeduwpcontentuploads202209202209_ql_bailar1350x491jpg 1350w httpsnewsharvardeduwpcontentuploads202209202209_ql_bailar300x109jpg 300w httpsnewsharvardeduwpcontentuploads202209202209_ql_bailar1024x373jpg 1024w httpsnewsharvardeduwpcontentuploads202209202209_ql_bailar768x280jpg 768w httpsnewsharvardeduwpcontentuploads202209202209_ql_bailar1536x559jpg 1536w httpsnewsharvardeduwpcontentuploads202209202209_ql_bailar2048x745jpg 2048w httpsnewsharvardeduwpcontentuploads202209202209_ql_bailar1500x546jpg 1500w height491 div figure div pspanschuyler bailar openly transgender swimmer ncaa division hrefhttpsnewsharvardedugazettestory201905ncaasfirstopenlytransgenderswimmerschuylerbailarfindshisrealselfandflourishesatharvardschuyler bailar races authentic selfaspanp hr div figure div img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg width1350 altquotation mark srcsethttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2300x31jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21024x106jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2768x80jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21536x159jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_qm_test22048x212jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21500x155jpg 1500w height140 div figure div h3native students education tool assimilation strip identities instead uplift advocate tribal communitiesh3 div figure div img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202209202209_ql_maltais1350x491jpg width1350 altsamantha maltais srcsethttpsnewsharvardeduwpcontentuploads202209202209_ql_maltais1350x491jpg 1350w httpsnewsharvardeduwpcontentuploads202209202209_ql_maltais300x109jpg 300w httpsnewsharvardeduwpcontentuploads202209202209_ql_maltais1024x373jpg 1024w httpsnewsharvardeduwpcontentuploads202209202209_ql_maltais768x280jpg 768w httpsnewsharvardeduwpcontentuploads202209202209_ql_maltais1536x559jpg 1536w httpsnewsharvardeduwpcontentuploads202209202209_ql_maltais2048x745jpg 2048w httpsnewsharvardeduwpcontentuploads202209202209_ql_maltais1500x546jpg 1500w height491 div figure div pspan samantha maltais wampanoag attend harvard law hrefhttpsnewsharvardedugazettestory202111awampanoagbreakthroughatharvardlawschoolstudent history makes historyaspanp hr div figure div img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg width1350 altquotation mark srcsethttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2300x31jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21024x106jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2768x80jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21536x159jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_qm_test22048x212jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21500x155jpg 1500w height140 div figure div h3i world navy seal going harvard couldnt write nameh3 div figure div img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202209202209_ql_lopez1350x491jpg width1350 altsergio lopez srcsethttpsnewsharvardeduwpcontentuploads202209202209_ql_lopez1350x491jpg 1350w httpsnewsharvardeduwpcontentuploads202209202209_ql_lopez300x109jpg 300w httpsnewsharvardeduwpcontentuploads202209202209_ql_lopez1024x373jpg 1024w httpsnewsharvardeduwpcontentuploads202209202209_ql_lopez768x280jpg 768w httpsnewsharvardeduwpcontentuploads202209202209_ql_lopez1536x559jpg 1536w httpsnewsharvardeduwpcontentuploads202209202209_ql_lopez2048x745jpg 2048w httpsnewsharvardeduwpcontentuploads202209202209_ql_lopez1500x546jpg 1500w height491 div figure div pspan sergio lopez veteran hrefhttpsnewsharvardedugazettestory201911anavysealworkstowardprogressafterfacingthetrialofhislifea navy seal cheated death finds voiceaspanp hr div figure div img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg width1350 altquotation mark srcsethttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2300x31jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21024x106jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2768x80jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21536x159jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_qm_test22048x212jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21500x155jpg 1500w height140 div figure div h3facts truth matters life death misinformation disinformation delusions deceit killh3 div figure div img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202209202209_ql_baron1350x491jpg width1350 altmarty baron srcsethttpsnewsharvardeduwpcontentuploads202209202209_ql_baron1350x491jpg 1350w httpsnewsharvardeduwpcontentuploads202209202209_ql_baron300x109jpg 300w httpsnewsharvardeduwpcontentuploads202209202209_ql_baron1024x373jpg 1024w httpsnewsharvardeduwpcontentuploads202209202209_ql_baron768x280jpg 768w httpsnewsharvardeduwpcontentuploads202209202209_ql_baron1536x559jpg 1536w httpsnewsharvardeduwpcontentuploads202209202209_ql_baron2048x745jpg 2048w httpsnewsharvardeduwpcontentuploads202209202209_ql_baron1500x546jpg 1500w height491 div figure div pspan marty baron washington post editor hrefhttpsnewsharvardedugazettestory202005martinbaronsmessagetoclassof2020factsandtruthmatterthe danger misinformation disinformation delusions deceitaspanp hr div figure div img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg width1350 altquotation mark srcsethttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2300x31jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21024x106jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2768x80jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21536x159jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_qm_test22048x212jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21500x155jpg 1500w height140 div figure div h3it harder imagine female actor striking female comedian comment bad joke start thinking gender piece thish3 pspan anna precht director mclean hospitals 3east boys intensive program hrefhttpsnewsharvardedugazettestory202203waitwhatifwillsmithwasjustbeingamanwait smith manaspanp hr div figure div img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg width1350 altquotation mark srcsethttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2300x31jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21024x106jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2768x80jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21536x159jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_qm_test22048x212jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21500x155jpg 1500w height140 div figure div h3humans social animal planet conversation bread butter social life live bread die ith3 pspan daniel gilbert social psychologist hrefhttpsnewsharvardedugazettestory202103researchersfindconversationsdontendwhenpeoplewantthemtoknow conversations short longaspanp hr div figure div img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg width1350 altquotation mark srcsethttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2300x31jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21024x106jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2768x80jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21536x159jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_qm_test22048x212jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21500x155jpg 1500w height140 div figure div h3i joke live boston city 3 million people actually socialize meet people im south poleh3 pspan marion dierickx researcher hrefhttpsnewsharvardedugazettestory201909harvardscientistsatthesouthpolelife iceaspanp hr div figure div img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg width1350 altquotation mark srcsethttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2300x31jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21024x106jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2768x80jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21536x159jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_qm_test22048x212jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21500x155jpg 1500w height140 div figure div h3search find passion excel expressionh3 div figure div img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202209202209_ql_eowilson1350x491jpg width1350 alteo wilson srcsethttpsnewsharvardeduwpcontentuploads202209202209_ql_eowilson1350x491jpg 1350w httpsnewsharvardeduwpcontentuploads202209202209_ql_eowilson300x109jpg 300w httpsnewsharvardeduwpcontentuploads202209202209_ql_eowilson1024x373jpg 1024w httpsnewsharvardeduwpcontentuploads202209202209_ql_eowilson768x280jpg 768w httpsnewsharvardeduwpcontentuploads202209202209_ql_eowilson1536x559jpg 1536w httpsnewsharvardeduwpcontentuploads202209202209_ql_eowilson2048x745jpg 2048w httpsnewsharvardeduwpcontentuploads202209202209_ql_eowilson1500x546jpg 1500w height491 div figure div pspan eo wilson 19292021 biologist hrefhttpsnewsharvardedugazettestory201404searchuntilyoufindapassionandgoallouttoexcelinitsexpressionexperienceaspanp hr div figure div img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg width1350 altquotation mark srcsethttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2300x31jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21024x106jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2768x80jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21536x159jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_qm_test22048x212jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21500x155jpg 1500w height140 div figure div h3what hell dont harvard turn life upside downh3 div figure div img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202209202209_ql_faust1350x491jpg width1350 altdrew faust srcsethttpsnewsharvardeduwpcontentuploads202209202209_ql_faust1350x491jpg 1350w httpsnewsharvardeduwpcontentuploads202209202209_ql_faust300x109jpg 300w httpsnewsharvardeduwpcontentuploads202209202209_ql_faust1024x373jpg 1024w httpsnewsharvardeduwpcontentuploads202209202209_ql_faust768x280jpg 768w httpsnewsharvardeduwpcontentuploads202209202209_ql_faust1536x559jpg 1536w httpsnewsharvardeduwpcontentuploads202209202209_ql_faust2048x745jpg 2048w httpsnewsharvardeduwpcontentuploads202209202209_ql_faust1500x546jpg 1500w height491 div figure div pspan drew faust harvard president hrefhttpsnewsharvardedugazettestory201805harvardpresidentdrewfaustonlifedeathexperienceaspanp hr div figure div img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg width1350 altquotation mark srcsethttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2300x31jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21024x106jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2768x80jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21536x159jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_qm_test22048x212jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21500x155jpg 1500w height140 div figure div h3people ask time want world american revolution answer im woman wouldnt want time minutesh3 div figure div img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202209202209_ql_kamensky1350x491jpg width1350 altjane kamensky srcsethttpsnewsharvardeduwpcontentuploads202209202209_ql_kamensky1350x491jpg 1350w httpsnewsharvardeduwpcontentuploads202209202209_ql_kamensky300x109jpg 300w httpsnewsharvardeduwpcontentuploads202209202209_ql_kamensky1024x373jpg 1024w httpsnewsharvardeduwpcontentuploads202209202209_ql_kamensky768x280jpg 768w httpsnewsharvardeduwpcontentuploads202209202209_ql_kamensky1536x559jpg 1536w httpsnewsharvardeduwpcontentuploads202209202209_ql_kamensky2048x745jpg 2048w httpsnewsharvardeduwpcontentuploads202209202209_ql_kamensky1500x546jpg 1500w height491 div figure div pspan jane kamensky historian hrefhttpsnewsharvardedugazettestory202205whenabortionwasntalegalissuewhen abortion wasnt legal issueaspanp hr div figure div img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg width1350 altquotation mark srcsethttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2300x31jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21024x106jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2768x80jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21536x159jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_qm_test22048x212jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21500x155jpg 1500w height140 div figure div h3our individual liberties givens democracy granted peace prosperity break walls hem step open courage embrace new beginnings possibleh3 div figure div img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202209202209_ql_merkel1350x491jpg width1350 altangela merkel srcsethttpsnewsharvardeduwpcontentuploads202209202209_ql_merkel1350x491jpg 1350w httpsnewsharvardeduwpcontentuploads202209202209_ql_merkel300x109jpg 300w httpsnewsharvardeduwpcontentuploads202209202209_ql_merkel1024x373jpg 1024w httpsnewsharvardeduwpcontentuploads202209202209_ql_merkel768x280jpg 768w httpsnewsharvardeduwpcontentuploads202209202209_ql_merkel1536x559jpg 1536w httpsnewsharvardeduwpcontentuploads202209202209_ql_merkel2048x745jpg 2048w httpsnewsharvardeduwpcontentuploads202209202209_ql_merkel1500x546jpg 1500w height491 div figure div pspan angela merkel chancellor germany hrefhttpsnewsharvardedugazettestory201905atharvardcommencementmerkeltellsgradsbreakthewallsthathemyouinmerkel advises graduates break walls hem inaspanp hr div figure div img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg width1350 altquotation mark srcsethttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2300x31jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21024x106jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2768x80jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21536x159jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_qm_test22048x212jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21500x155jpg 1500w height140 div figure div h3there bad things happen short civil war wish country talking abouth3 pspan jay ulfelder political scientist hrefhttpsnewsharvardedugazettestory202201harvardpoliticalscientistsaysuscivilwarunlikelywe dont need civil war troubleaspanp hr div figure div img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg width1350 altquotation mark srcsethttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2300x31jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21024x106jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2768x80jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21536x159jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_qm_test22048x212jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21500x155jpg 1500w height140 div figure div h3in late 1969 asked question think environment think common response environmenth3 div figure div img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202209202209_ql_hayes1350x491jpg width1350 altdenis hayes srcsethttpsnewsharvardeduwpcontentuploads202209202209_ql_hayes1350x491jpg 1350w httpsnewsharvardeduwpcontentuploads202209202209_ql_hayes300x109jpg 300w httpsnewsharvardeduwpcontentuploads202209202209_ql_hayes1024x373jpg 1024w httpsnewsharvardeduwpcontentuploads202209202209_ql_hayes768x280jpg 768w httpsnewsharvardeduwpcontentuploads202209202209_ql_hayes1536x559jpg 1536w httpsnewsharvardeduwpcontentuploads202209202209_ql_hayes2048x745jpg 2048w httpsnewsharvardeduwpcontentuploads202209202209_ql_hayes1500x546jpg 1500w height491 div figure div pspan denis hayes earth day cofounder hrefhttpsnewsharvardedugazettestory202004denishayesoneofearthdaysfounders50yearsagoreflectshow earth day gave birth environmental movementaspanp hr div figure div img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg width1350 altquotation mark srcsethttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2300x31jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21024x106jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2768x80jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21536x159jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_qm_test22048x212jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21500x155jpg 1500w height140 div figure div h3think grey parrot outperforms harvard undergrads thats pretty freaking awesome students concentrating engineering premeds seniors kicked buttsh3 pspan hrag pailian researcher hrefhttpsnewsharvardedugazettestory202007africangreyparrotoutperformschildrenandcollegestudentswhen bird brain tops harvard students testaspanp hr div figure div img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg width1350 altquotation mark srcsethttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2300x31jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21024x106jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2768x80jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21536x159jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_qm_test22048x212jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21500x155jpg 1500w height140 div figure div h3psychologists certain way studying intelligence certain notion intelligence means test kind bull china shop came theory psychologists liked ideas educators found spoke themh3 div figure div img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202209202209_ql_gardner1350x491jpg width1350 althoward gardner srcsethttpsnewsharvardeduwpcontentuploads202209202209_ql_gardner1350x491jpg 1350w httpsnewsharvardeduwpcontentuploads202209202209_ql_gardner300x109jpg 300w httpsnewsharvardeduwpcontentuploads202209202209_ql_gardner1024x373jpg 1024w httpsnewsharvardeduwpcontentuploads202209202209_ql_gardner768x280jpg 768w httpsnewsharvardeduwpcontentuploads202209202209_ql_gardner1536x559jpg 1536w httpsnewsharvardeduwpcontentuploads202209202209_ql_gardner2048x745jpg 2048w httpsnewsharvardeduwpcontentuploads202209202209_ql_gardner1500x546jpg 1500w height491 div figure div pspan howard gardner psychologist hrefhttpsnewsharvardedugazettestory201805harvardscholarhowardgardnerreflectsonhislifeandworkexperienceaspanp hr div figure div img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg width1350 altquotation mark srcsethttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2300x31jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21024x106jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2768x80jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21536x159jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_qm_test22048x212jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21500x155jpg 1500w height140 div figure div h3psychologists humans handle independent variables lost ai coming perfect time potential rescue data overloadh3 div figure div img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202209202209_ql_truog1350x491jpg width1350 altrobert truog srcsethttpsnewsharvardeduwpcontentuploads202209202209_ql_truog1350x491jpg 1350w httpsnewsharvardeduwpcontentuploads202209202209_ql_truog300x109jpg 300w httpsnewsharvardeduwpcontentuploads202209202209_ql_truog1024x373jpg 1024w httpsnewsharvardeduwpcontentuploads202209202209_ql_truog768x280jpg 768w httpsnewsharvardeduwpcontentuploads202209202209_ql_truog1536x559jpg 1536w httpsnewsharvardeduwpcontentuploads202209202209_ql_truog2048x745jpg 2048w httpsnewsharvardeduwpcontentuploads202209202209_ql_truog1500x546jpg 1500w height491 div figure div pspan robert truog bioethicist hrefhttpsnewsharvardedugazettestory202011risksandbenefitsofanairevolutioninmedicineai revolution medicineaspanp hr div figure div img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg width1350 altquotation mark srcsethttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2300x31jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21024x106jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2768x80jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21536x159jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_qm_test22048x212jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21500x155jpg 1500w height140 div figure div h3both politics everyday life worst things death treat unremarkable lossh3 pspan susanna siegel philosopher hrefhttpsnewsharvardedugazettestory202111howdeathshapeslifeaccordingtoaharvardphilosopherhow death shapes lifeaspanp hr div figure div img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg width1350 altquotation mark srcsethttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2300x31jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21024x106jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2768x80jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21536x159jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_qm_test22048x212jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21500x155jpg 1500w height140 div figure div h3that natasha rostov war peace goes vital enchanting unpredictable girl boring conventional women completely ruined motherhood course tolstoyh3 div figure div img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202209202209_ql_jen1350x491jpg width1350 altgish jen srcsethttpsnewsharvardeduwpcontentuploads202209202209_ql_jen1350x491jpg 1350w httpsnewsharvardeduwpcontentuploads202209202209_ql_jen300x109jpg 300w httpsnewsharvardeduwpcontentuploads202209202209_ql_jen1024x373jpg 1024w httpsnewsharvardeduwpcontentuploads202209202209_ql_jen768x280jpg 768w httpsnewsharvardeduwpcontentuploads202209202209_ql_jen1536x559jpg 1536w httpsnewsharvardeduwpcontentuploads202209202209_ql_jen2048x745jpg 2048w httpsnewsharvardeduwpcontentuploads202209202209_ql_jen1500x546jpg 1500w height491 div figure div pspan gish jen novelist hrefhttpsnewsharvardedugazettestory202206whoisyourfavoriteliteraryherovillainwho favorite literary hero villainaspanp hr div figure div img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg width1350 altquotation mark srcsethttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2300x31jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21024x106jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2768x80jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21536x159jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_qm_test22048x212jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21500x155jpg 1500w height140 div figure div h3my reactions hearing music seeing dance theater love irresistible urge leave soon possibleh3 div figure div img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202209202209_ql_anderson1350x491jpg width1350 altlaurie anderson srcsethttpsnewsharvardeduwpcontentuploads202209202209_ql_anderson1350x491jpg 1350w httpsnewsharvardeduwpcontentuploads202209202209_ql_anderson300x109jpg 300w httpsnewsharvardeduwpcontentuploads202209202209_ql_anderson1024x373jpg 1024w httpsnewsharvardeduwpcontentuploads202209202209_ql_anderson768x280jpg 768w httpsnewsharvardeduwpcontentuploads202209202209_ql_anderson1536x559jpg 1536w httpsnewsharvardeduwpcontentuploads202209202209_ql_anderson2048x745jpg 2048w httpsnewsharvardeduwpcontentuploads202209202209_ql_anderson1500x546jpg 1500w height491 div figure div pspan laurie anderson artist hrefhttpsnewsharvardedugazettestory202102laurieandersonbringsheruniquestyletothenortonlectureso superwomanaspanp hr div figure div img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg width1350 altquotation mark srcsethttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2300x31jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21024x106jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2768x80jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21536x159jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_qm_test22048x212jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21500x155jpg 1500w height140 div figure div h3the mere fact started mean entitled ith3 div figure div img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202209202209_ql_cohen1350x491jpg width1350 alti glenn cohen srcsethttpsnewsharvardeduwpcontentuploads202209202209_ql_cohen1350x491jpg 1350w httpsnewsharvardeduwpcontentuploads202209202209_ql_cohen300x109jpg 300w httpsnewsharvardeduwpcontentuploads202209202209_ql_cohen1024x373jpg 1024w httpsnewsharvardeduwpcontentuploads202209202209_ql_cohen768x280jpg 768w httpsnewsharvardeduwpcontentuploads202209202209_ql_cohen1536x559jpg 1536w httpsnewsharvardeduwpcontentuploads202209202209_ql_cohen2048x745jpg 2048w httpsnewsharvardeduwpcontentuploads202209202209_ql_cohen1500x546jpg 1500w height491 div figure div pspan glenn cohen law professor hrefhttpsnewsharvardedugazettestory201907focalpointiglenncohenarguesagainstbaselinebiasone thing change question status quoaspanp hr div figure div img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg width1350 altquotation mark srcsethttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2300x31jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21024x106jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2768x80jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21536x159jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_qm_test22048x212jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21500x155jpg 1500w height140 div figure div h3the real core telling mask fearh3 pspan david h rosmarin psychologist hrefhttpsnewsharvardedugazettestory202008acloserlookatamericaspandemicfueledangersoothing advice mad americaaspanp hr div figure div img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg width1350 altquotation mark srcsethttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2300x31jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21024x106jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2768x80jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21536x159jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_qm_test22048x212jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21500x155jpg 1500w height140 div figure div h3it like direct action like radical feminists invading miss america contest black panthers standing oakland city hall riflesh3 pspan michael bronski author queer history united states hrefhttpsnewsharvardedugazettestory201906harvardscholarsreflectonthehistoryandlegacyofthestonewallriotsstonewall nowaspanp hr div figure div img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg width1350 altquotation mark srcsethttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2300x31jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21024x106jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2768x80jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21536x159jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_qm_test22048x212jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21500x155jpg 1500w height140 div figure div h3in situation dont simply want frantically struggle restore status quo status quo wasnt operating effective level certainly wasnt serving children fairlyh3 div figure div img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202209202209_ql_reville1350x491jpg width1350 altpaul reville srcsethttpsnewsharvardeduwpcontentuploads202209202209_ql_reville1350x491jpg 1350w httpsnewsharvardeduwpcontentuploads202209202209_ql_reville300x109jpg 300w httpsnewsharvardeduwpcontentuploads202209202209_ql_reville1024x373jpg 1024w httpsnewsharvardeduwpcontentuploads202209202209_ql_reville768x280jpg 768w httpsnewsharvardeduwpcontentuploads202209202209_ql_reville1536x559jpg 1536w httpsnewsharvardeduwpcontentuploads202209202209_ql_reville2048x745jpg 2048w httpsnewsharvardeduwpcontentuploads202209202209_ql_reville1500x546jpg 1500w height491 div figure div pspan paul reville massachusetts secretary education hrefhttpsnewsharvardedugazettestory202004thepandemicsimpactoneducationtime fix american education raceforspace resolveaspanp hr div figure div img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg width1350 altquotation mark srcsethttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2300x31jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21024x106jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2768x80jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21536x159jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_qm_test22048x212jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21500x155jpg 1500w height140 div figure div h3there idea america shining city hill example democracy achieved redeemer nation baldwin insisting agree going grow nation confront fantasy confront lieh3 pspan eddie s glaude jr chair department african american studies princeton university hrefhttpsnewsharvardedugazettestory202204howuscanconfrontmythofitsdemocracyaccordingtoeddieglaudeblack progress white angeraspanp hr div figure div img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg width1350 altquotation mark srcsethttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2300x31jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21024x106jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2768x80jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21536x159jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_qm_test22048x212jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21500x155jpg 1500w height140 div figure div h3theres irony fact country predicated reinvention looking future draw greatest strength event happened 80 years pasth3 div figure div img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202209202209_ql_samet1350x491jpg width1350 altelizabeth samet srcsethttpsnewsharvardeduwpcontentuploads202209202209_ql_samet1350x491jpg 1350w httpsnewsharvardeduwpcontentuploads202209202209_ql_samet300x109jpg 300w httpsnewsharvardeduwpcontentuploads202209202209_ql_samet1024x373jpg 1024w httpsnewsharvardeduwpcontentuploads202209202209_ql_samet768x280jpg 768w httpsnewsharvardeduwpcontentuploads202209202209_ql_samet1536x559jpg 1536w httpsnewsharvardeduwpcontentuploads202209202209_ql_samet2048x745jpg 2048w httpsnewsharvardeduwpcontentuploads202209202209_ql_samet1500x546jpg 1500w height491 div figure div pspan elizabeth d samet west point scholar hrefhttpsnewsharvardedugazettestory202201whyworldwariiwasntallthatgoodhow good war wasnt goodaspanp hr div figure div img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg width1350 altquotation mark srcsethttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2300x31jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21024x106jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2768x80jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21536x159jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_qm_test22048x212jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21500x155jpg 1500w height140 div figure div h3for centuries weve demonized curiosity women like eve pandora blaming bringing sin evil world curiosity served women cultural imaginationh3 div figure div img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202209202209_ql_tatar1350x491jpg width1350 altmaria tatar srcsethttpsnewsharvardeduwpcontentuploads202209202209_ql_tatar1350x491jpg 1350w httpsnewsharvardeduwpcontentuploads202209202209_ql_tatar300x109jpg 300w httpsnewsharvardeduwpcontentuploads202209202209_ql_tatar1024x373jpg 1024w httpsnewsharvardeduwpcontentuploads202209202209_ql_tatar768x280jpg 768w httpsnewsharvardeduwpcontentuploads202209202209_ql_tatar1536x559jpg 1536w httpsnewsharvardeduwpcontentuploads202209202209_ql_tatar2048x745jpg 2048w httpsnewsharvardeduwpcontentuploads202209202209_ql_tatar1500x546jpg 1500w height491 div figure div pspan maria tatar john l loeb professor germanic languages literatures hrefhttpsnewsharvardedugazettestory202111harvardscholarcelebratesheroinesgenuine heroinesaspanp hr div figure div img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg width1350 altquotation mark srcsethttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2300x31jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21024x106jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2768x80jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21536x159jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_qm_test22048x212jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21500x155jpg 1500w height140 div figure div h3i kept wondering venus enslaved person imagined future like attending harvard possibleh3 div figure div img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202209202209_ql_omonuk1350x491jpg width1350 altsuzannah omonuk srcsethttpsnewsharvardeduwpcontentuploads202209202209_ql_omonuk1350x491jpg 1350w httpsnewsharvardeduwpcontentuploads202209202209_ql_omonuk300x109jpg 300w httpsnewsharvardeduwpcontentuploads202209202209_ql_omonuk1024x373jpg 1024w httpsnewsharvardeduwpcontentuploads202209202209_ql_omonuk768x280jpg 768w httpsnewsharvardeduwpcontentuploads202209202209_ql_omonuk1536x559jpg 1536w httpsnewsharvardeduwpcontentuploads202209202209_ql_omonuk2048x745jpg 2048w httpsnewsharvardeduwpcontentuploads202209202209_ql_omonuk1500x546jpg 1500w height491 div figure div pspan suzannah omonuk poet hrefhttpsnewsharvardedugazettestory202104studentpoemgivesvoicetoenslavedwomanoncampusin18thcenturya poem venusaspanp hr div figure div img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg width1350 altquotation mark srcsethttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2300x31jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21024x106jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2768x80jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21536x159jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_qm_test22048x212jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21500x155jpg 1500w height140 div figure div h3i archives richest source real life know detail strange twist come open new picture youh3 pspan irina klyagin archivist hrefhttpsnewsharvardedugazettestory202111harvardlibrarianunearthslessoninsovietarchiveprized manuscript valuable lesson unearthed soviet archiveaspanp pp hr div figure div img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg width1350 altquotation mark srcsethttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2300x31jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21024x106jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2768x80jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21536x159jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_qm_test22048x212jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21500x155jpg 1500w height140 div figure div h3everyone called intense bad connotation like wont smile im proud im intense im going apologize thath3 div figure div img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202209202209_ql_straus1350x491jpg width1350 altaurora straus srcsethttpsnewsharvardeduwpcontentuploads202209202209_ql_straus1350x491jpg 1350w httpsnewsharvardeduwpcontentuploads202209202209_ql_straus300x109jpg 300w httpsnewsharvardeduwpcontentuploads202209202209_ql_straus1024x373jpg 1024w httpsnewsharvardeduwpcontentuploads202209202209_ql_straus768x280jpg 768w httpsnewsharvardeduwpcontentuploads202209202209_ql_straus1536x559jpg 1536w httpsnewsharvardeduwpcontentuploads202209202209_ql_straus2048x745jpg 2048w httpsnewsharvardeduwpcontentuploads202209202209_ql_straus1500x546jpg 1500w height491 div figure div pspan aurora straus professional race car driver hrefhttpsnewsharvardedugazettestory201905harvardstudentandracecardriveraurorastrauscompeteswithpurposelife fast laneaspanp hr div figure div img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg width1350 altquotation mark srcsethttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2300x31jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21024x106jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2768x80jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21536x159jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_qm_test22048x212jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21500x155jpg 1500w height140 div figure div h3i went thinking shes oddball greataunt thinking shes geniush3 div figure div img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202209202209_ql_deloria1350x491jpg width1350 altphilip deloria srcsethttpsnewsharvardeduwpcontentuploads202209202209_ql_deloria1350x491jpg 1350w httpsnewsharvardeduwpcontentuploads202209202209_ql_deloria300x109jpg 300w httpsnewsharvardeduwpcontentuploads202209202209_ql_deloria1024x373jpg 1024w httpsnewsharvardeduwpcontentuploads202209202209_ql_deloria768x280jpg 768w httpsnewsharvardeduwpcontentuploads202209202209_ql_deloria1536x559jpg 1536w httpsnewsharvardeduwpcontentuploads202209202209_ql_deloria2048x745jpg 2048w httpsnewsharvardeduwpcontentuploads202209202209_ql_deloria1500x546jpg 1500w height491 div figure div pspan philip deloria historian hrefhttpsnewsharvardedugazettestory201907insiouxauntsworkhistorianfindsartonfringesofmodernismtraditiona colorful figureaspanp hr div figure div img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg width1350 altquotation mark srcsethttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2300x31jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21024x106jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2768x80jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21536x159jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_qm_test22048x212jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21500x155jpg 1500w height140 div figure div h3clarity course important important thing translating prose writing kind music ith3 pspan arthur goldhammer translator hrefhttpsnewsharvardedugazettestory202009arthurgoldhammerontheartoftranslationin translation found raison dtreaspanp hr div figure div img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg width1350 altquotation mark srcsethttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2300x31jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21024x106jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2768x80jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21536x159jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_qm_test22048x212jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21500x155jpg 1500w height140 div figure div h3you outrun bad diet outeat inactive lifestyleh3 div figure div img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202209202209_ql_ilee1350x491jpg width1350 altiminn lee srcsethttpsnewsharvardeduwpcontentuploads202209202209_ql_ilee1350x491jpg 1350w httpsnewsharvardeduwpcontentuploads202209202209_ql_ilee300x109jpg 300w httpsnewsharvardeduwpcontentuploads202209202209_ql_ilee1024x373jpg 1024w httpsnewsharvardeduwpcontentuploads202209202209_ql_ilee768x280jpg 768w httpsnewsharvardeduwpcontentuploads202209202209_ql_ilee1536x559jpg 1536w httpsnewsharvardeduwpcontentuploads202209202209_ql_ilee2048x745jpg 2048w httpsnewsharvardeduwpcontentuploads202209202209_ql_ilee1500x546jpg 1500w height491 div figure div pspan imin lee epidemiologist hrefhttpsnewsharvardedugazettestory202207gorgetodaysweattomorrowthatsnothowitworksgorge today sweat tomorrow thats worksaspanp pp hr div figure div img sizesminwidth 1384px 1224px minwidth 1070px calc100vw 160px minwidth 600px calc100vw 120px calc100vw 50px srchttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg width1350 altquotation mark srcsethttpsnewsharvardeduwpcontentuploads202208202208_qm_test21350x140jpg 1350w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2300x31jpg 300w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21024x106jpg 1024w httpsnewsharvardeduwpcontentuploads202208202208_qm_test2768x80jpg 768w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21536x159jpg 1536w httpsnewsharvardeduwpcontentuploads202208202208_qm_test22048x212jpg 2048w httpsnewsharvardeduwpcontentuploads202208202208_qm_test21500x155jpg 1500w height140 div figure div h3being sea pure form living care basics sleeping eating taking care taking care boat making sure everythings working totally aware weatherh3 pspan jim hammitt professor economics decision sciences hrefhttpsnewsharvardedugazettestory202110chanschoolshammittsailssolotobermudawinsracesailing stars fastaspanp pp
|
632e39d700beacfbb91d083f
|
My Conversation with Byron Auguste
|
phere is a relnoopener hrefhttpsconversationswithtylercomepisodesbyronauguste target_blankthe audio video and transcripta here is my introductionp
blockquote
p dataselectableparagraphstrongtyler cowen strong today i am herewith a relnoopener ugc nofollow hrefhttpsopportunityatworkorgexpertbyronauguste target_blankbyron augustea who is president and cofounder of a relnoopener ugc nofollow hrefhttpsopportunityatworkorggclideaiaiqobchmimvzn7esgivji7ich1dogiaeaayasaaeglgcpd_bwe target_blankopportunityworka a civic enterprise which aims to improve the us labor market byron served for two years in the white house as deputy assistant to the president for economic policy and deputy director to the national economic council until 2013 he was senior partner at mckinsey and worked there for many years he has also been an economist at lmc international oxford university and the a relnoopener ugc nofollow hrefhttpswwwafdborgen target_blankafrican development bankap
p dataselectableparagraphhe is author of a 1995 book called a relnoopener ugc nofollow hrefhttpswwwamazoncomeconomicsinternationalpaymentsunionsclearingdp134925519x target_blankemthe economics of international payments unions and clearing housesema he has a doctorate of philosophy and economics from oxford university an undergraduate econ degree from yale and has been a a relnoopener ugc nofollow hrefhttpswwwmarshallscholarshiporg target_blankmarshall scholara welcomep
blockquote
p dataselectableparagraphhere is one excerptp
blockquote
p dataselectableparagraphstrongcowen strongas you know more and more top universities are moving away from requiring standardized testing for people applying is this good or bad from your point of viewp
p dataselectableparagraphstrongauguste strongi think its really too early to tell because the question is p
p dataselectableparagraphstrongcowen strongbut you want alternative markers not just what kind of family you came from what kind of prep you had if youre just smart why shouldnt we let you standardize testp
p dataselectableparagraphstrongauguste strongi think alternative markers are key this is actually a pretty complicated issue and ive talked to university administrators and admissions people and its interesting the variety of different ways theyre trying to work on thisp
p dataselectableparagraphbut i will say this if you think about something like a relnoopener ugc nofollow hrefhttpswwwpbsorgwgbhpagesfrontlineshowssatswherehistoryhtml target_blankthe sat when it first starteda im talking about in the 1930s essentially it emwasem an alternative route into a college it started with the ivies it was started with a relnoopener ugc nofollow hrefhttpswwwbritannicacombiographyjamesbconant target_blankjames conanta and harvard and the ivies and the seven sisters and the rest and then it gradually moved outp
p dataselectableparagraphthe problem they were trying to solve back in the 30s was that up until that point the way you got into say dartmouth is the headmaster of choate would write to dartmouth and say heres our 15 candidates for dartmouth dartmouth would mostly take them because choate knew what dartmouth wanted then you had a relnoopener ugc nofollow hrefhttpswwwnberorgpapersw6439 target_blankthe high school movementa in the us where between 1909 and 1939 you went from 9 percent of american teenagers going to high school to 79 percent going to high schoolp
p dataselectableparagraphnow suddenly you had high school students applying to college they were at dubuque normal school in iowa how does dartmouth know whether this person was the people from choate didnt start taking the sats but the sat even though it was a pretty terrible test at the time it was better than nothing it was a way that someone who was out there not in the normal feeder schools could distinguish themselvesp
p dataselectableparagraphi think that is a very valuable role to play as you know tyler the sat does to some extent still play that role but also because now that everybody has had to use it it also is something that can be gamed more test prep and all the rest of itp
p dataselectableparagraphstrongcowen strongbut it tracks iq pretty closely and a lot of asian schools emwayem overemphasize standard testing i would say and theyve risen to very high levels of quality very quickly it just seems like a good thing to dop
blockquote
p dataselectableparagraphmost of all we cover jobs trainingretraining and education interesting throughoutp
pthe post a relnofollow hrefhttpmarginalrevolutioncommarginalrevolution202209myconversationwithbyronaugustehtmlmy conversation with byron augustea appeared first on a relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap
|
phere relnoopener hrefhttpsconversationswithtylercomepisodesbyronauguste target_blankthe audio video transcripta introductionp blockquote p dataselectableparagraphstrongtyler cowenstrong today herewith relnoopener ugc nofollow hrefhttpsopportunityatworkorgexpertbyronauguste target_blankbyron augustea president cofounder relnoopener ugc nofollow hrefhttpsopportunityatworkorggclideaiaiqobchmimvzn7esgivji7ich1dogiaeaayasaaeglgcpd_bwe target_blankopportunityworka civic enterprise aims improve labor market byron served years white house deputy assistant president economic policy deputy director national economic council 2013 senior partner mckinsey worked years economist lmc international oxford university thea relnoopener ugc nofollow hrefhttpswwwafdborgen target_blankafrican development bankap p dataselectableparagraphhe author 1995 book calleda relnoopener ugc nofollow hrefhttpswwwamazoncomeconomicsinternationalpaymentsunionsclearingdp134925519x target_blankemthe economics international payments unions clearing housesema doctorate philosophy economics oxford university undergraduate econ degree yale aa relnoopener ugc nofollow hrefhttpswwwmarshallscholarshiporg target_blankmarshall scholara welcomep blockquote p dataselectableparagraphhere excerptp blockquote p dataselectableparagraphstrongcowenstrongas know universities moving away requiring standardized testing people applying good bad point viewp p dataselectableparagraphstrongaugustestrongi think early tell question p p dataselectableparagraphstrongcowenstrongbut want alternative markers kind family came kind prep youre smart shouldnt let standardize testp p dataselectableparagraphstrongaugustestrongi think alternative markers key actually pretty complicated issue ive talked university administrators admissions people interesting variety different ways theyre trying work thisp p dataselectableparagraphbut think likea relnoopener ugc nofollow hrefhttpswwwpbsorgwgbhpagesfrontlineshowssatswherehistoryhtml target_blankthe sat starteda im talking 1930s essentially itemwaseman alternative route college started ivies started witha relnoopener ugc nofollow hrefhttpswwwbritannicacombiographyjamesbconant target_blankjames conantaand harvard ivies seven sisters rest gradually moved outp p dataselectableparagraphthe problem trying solve 30s point way got dartmouth headmaster choate write dartmouth heres 15 candidates dartmouth dartmouth choate knew dartmouth wanted hada relnoopener ugc nofollow hrefhttpswwwnberorgpapersw6439 target_blankthe high school movementain 1909 1939 went 9 percent american teenagers going high school 79 percent going high schoolp p dataselectableparagraphnow suddenly high school students applying college dubuque normal school iowa dartmouth know person people choate didnt start taking sats sat pretty terrible test time better way normal feeder schools distinguish themselvesp p dataselectableparagraphi think valuable role play know tyler sat extent play role everybody use gamed test prep rest itp p dataselectableparagraphstrongcowenstrongbut tracks iq pretty closely lot asian schoolsemwayem overemphasize standard testing theyve risen high levels quality quickly like good thing dop blockquote p dataselectableparagraphmost cover jobs trainingretraining education interesting throughoutp pthe post relnofollow hrefhttpmarginalrevolutioncommarginalrevolution202209myconversationwithbyronaugustehtmlmy conversation byron augustea appeared relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap
|
632e39ed00beacfbb91d0841
|
Is the war in Ukraine at a turning point?
|
pat least for now the tide appears to be turning against russia in its attack on ukraine which has recaptured wide swaths of land in recent weeks the ukrainian successes have spurred discussion in the west about the prospect for negotiations to end the aggression and at what cost this week russian president vladimir putin began calling up 300000 military reservists in the countrys a hrefhttpswwwreuterscomworldeuropeputinsignsdecreemobilisationsayswestwantsdestroyrussia20220921first mobilizationa since world war ii to replenish its badly depleted armed forces putin also said he would defend his country with nuclear weapons if threatened by the westp
pphilip short is a former foreign correspondent in moscow for the bbc the economist and the times of london and author of the new book a hrefhttpswwwnytimescom20220801booksreviewputinphilipshorthtmlputin the man behind the war in ukrainea he gave a virtual talk about putin and ukraine hosted by the belfer centers intelligence project at harvard kennedy school wednesdayp
pshort spoke to the gazette about putins escalations of the war and whether there is growing reason to worry about how he will respond if ukraine continues to make gains interview has been edited for clarity and lengthp
h2qampah2
h3philip shorth3
pspangazette spanhow does russias position look right nowp
pspanshortspan there are a number of elements which one has to bear in mind one and the most important is that the war is not going well for the russians that may seem an obvious thing to say but its the basis for everything that is happeningp
pputin catastrophically miscalculated on several scores he did not expect the ukrainians to resist as strongly as they have done there was never any question that he thought they were going to be welcomed with flowers that was the kind of propaganda myth that was put around but he didnt expect them to rise up as a nation and oppose the russians he didnt expect zelensky to remain in kyiv and lead the resistance and he miscalculated terribly over the capacities of the russian army and how extremely poorly it has performed in military terms so its not going wellp
pis it a disaster not yet one has to be very cautious about evaluating this because it is an ongoing situation but clearly they just dont have enough troops on the ground to do what he wanted to do so hes had to escalate this is a significant escalation but hes doing it pretty cautiously hed much rather avoid any mobilization at all because it risks fomenting discontent among the russian population hed much rather that the war continued or the fighting continued as something far away which wasnt really affecting most russians daily lives but thats no longer possible and now we really are going into uncharted waters because its not at all clear that this partial mobilization will be sufficientp
pif you look back at the last 20 years of putins time in power this is the first time hes taken a major initiative that has gone seriously wrong so theres nothing really to guide us in how in the end hes going to react my instinct is that he will continue to escalate until he reaches a position where hes sure he can present whatever the result is as an acceptable outcome for him but weve never been in this situation with putin or russia before so we dont know how its going to play outp
pspangazette spanshould the us and the west take advantage of this moment as it helps ukraine put maximum pressure on russia to end the war militarily or is that potentially too risky and would it be better to seize this time to stabilize the situation through negotiationsp
pspanshortspan i dont actually see a contradiction between the two the more that the ukrainians can push the russians back the stronger their negotiating position will be eventually all wars end either with complete defeat in other words in a ukrainian flag flying over the kremlin and that is not going to happen or with negotiations in this case were looking at negotiations and it was emmanuel macron the french president who said geography is stubborn well its true ukraine is not going to physically move anywhere and nor is russia they are going to continue to be neighbors and eventually they are going to have to find a way to live together so negotiations yesp
pon this business of pushing russia back one has to be very careful about or very much aware of crimea its possible to push russia back perhaps if the russian army really continues to underperform and the west continues to arm the ukrainians and the ukrainians continue to fight very fiercely its possible to imagine pushing the russians back to where they were before feb 24 i dont believe its possible to push them out of crimea that i think would be a emcasus belliem then kind of all bets would be off about how the russians might react although zelensky says we can push them out completely and thats very understandable in morale terms for the ukrainians it aint going to happen at least not as far as crimea is concernedp
pspangazettespan if putin starts to feel as if he is losing the upper hand in the war or losing face at home are people right to worry how he might reactp
pspanshortspan hes not reckless hes normally very cautious in what he does and i think this partial mobilization rather than a fullscale mobilization is an example of that caution a kind of an incremental approach hes not going to lash out totally unpredictably that is something i dont think is going to happen the problem is he is being pushed into a corner and if that continues its very difficult to say he wont do this or he wont do that because if he feels that his own position is threatened which is not the case at the moment or if he feels that russia as a nation russia as a whole is at a very serious disadvantage then i dont think you can completely rule out anything when i say anything i dont see this leading to world war iii but the use of battlefield nuclear weapons if it gets to a really difficult state for the russians i dont think you can rule that out it could happenp
pspangazettespan what indicators will you be watching for to gauge what russias game plan may be as winter approachesp
pspanshortspan on the western side its a question of how europe manages to survive the winter there are already fault lines you can see in nato and the eu about how to react what the longterm plans should be in ukraine but the fault lines have been very much kept under control for now so thats europe theres the united states whats going to happen in the midterms what is the buildup going to be to the presidential election in 2024 its not that far away all those things on our side are going to be absolutely critical on the russian side i think we are going to need to watch very carefully how public opinion reacts to this partial mobilization and finally what it all in the end depends on is the situation on the battlefieldp
|
pat tide appears turning russia attack ukraine recaptured wide swaths land recent weeks ukrainian successes spurred discussion west prospect negotiations end aggression cost week russian president vladimir putin began calling 300000 military reservists countrys hrefhttpswwwreuterscomworldeuropeputinsignsdecreemobilisationsayswestwantsdestroyrussia20220921first mobilizationa world war ii replenish badly depleted armed forces putin said defend country nuclear weapons threatened westp pphilip short foreign correspondent moscow bbc economist times london author new book hrefhttpswwwnytimescom20220801booksreviewputinphilipshorthtmlputin man war ukrainea gave virtual talk putin ukraine hosted belfer centers intelligence project harvard kennedy school wednesdayp pshort spoke gazette putins escalations war growing reason worry respond ukraine continues gains interview edited clarity lengthp h2qampah2 h3philip shorth3 pspangazette spanhow russias position look right nowp pspanshortspanthere number elements bear mind important war going russians obvious thing basis happeningp pputin catastrophically miscalculated scores expect ukrainians resist strongly question thought going welcomed flowers kind propaganda myth didnt expect rise nation oppose russians didnt expect zelensky remain kyiv lead resistance miscalculated terribly capacities russian army extremely poorly performed military terms going wellp pis disaster cautious evaluating ongoing situation clearly dont troops ground wanted hes escalate significant escalation hes pretty cautiously hed avoid mobilization risks fomenting discontent russian population hed war continued fighting continued far away wasnt affecting russians daily lives thats longer possible going uncharted waters clear partial mobilization sufficientp pif look 20 years putins time power time hes taken major initiative gone seriously wrong theres guide end hes going react instinct continue escalate reaches position hes sure present result acceptable outcome weve situation putin russia dont know going play outp pspangazettespanshould west advantage moment helps ukraine maximum pressure russia end war militarily potentially risky better seize time stabilize situation negotiationsp pspanshortspani dont actually contradiction ukrainians push russians stronger negotiating position eventually wars end complete defeat words ukrainian flag flying kremlin going happen negotiations case looking negotiations emmanuel macron french president said geography stubborn true ukraine going physically russia going continue neighbors eventually going find way live negotiations yesp pon business pushing russia careful aware crimea possible push russia russian army continues underperform west continues arm ukrainians ukrainians continue fight fiercely possible imagine pushing russians feb 24 dont believe possible push crimea think emcasus belliem kind bets russians react zelensky says push completely thats understandable morale terms ukrainians aint going happen far crimea concernedp pspangazettespanif putin starts feel losing upper hand war losing face home people right worry reactp pspanshortspanhes reckless hes normally cautious think partial mobilization fullscale mobilization example caution kind incremental approach hes going lash totally unpredictably dont think going happen problem pushed corner continues difficult wont wont feels position threatened case moment feels russia nation russia disadvantage dont think completely rule dont leading world war iii use battlefield nuclear weapons gets difficult state russians dont think rule happenp pspangazettespanwhat indicators watching gauge russias game plan winter approachesp pspanshortspanon western question europe manages survive winter fault lines nato eu react longterm plans ukraine fault lines kept control thats europe theres united states whats going happen midterms buildup going presidential election 2024 far away things going absolutely critical russian think going need watch carefully public opinion reacts partial mobilization finally end depends situation battlefieldp
|
632e82cd1fb0c8ead436901a
|
Volodymyr Zelensky is a hero of our time
|
pwhen the queen died i was on my way to kyiv my mind focused on the war in ukraine i found myself uncharacteristically lost for words when i was asked to comment i took refuge in the complexities of the journey which involved a delayed flight from rome to lublin a frantic drive to chelm on the polishukrainian border and then an overnight train through western ukraine it was a good excuse the reality was i could think of nothing to say i couldnt have done an interview even if id been trapped in broadcasting housep
pkyiv was as nbcs roving war correspondent richard engel had forewarned me more exuberant than you might expect a capital city at war to be the battle of kyiv was fought and won in the first phase of the war and now the fighting is to the south around kherson and to the east beyond kharkiv central kyiv looks positively cheerful only when you drive northeast to the suburbs of irpin bucha and hostomel do you see the blown bridges destroyed houses and burntout russian armor i am haunted by the simple memorial to the victims of russian war crimes buried next to the church of st andrew and pyervozvannoho all saints in bucha it was only six months ago that they interred the bodies of more than sixty people here many of them civilians executed in cold blood by russian death squads ukrainian soldiers routinely refer to the invaders as the orcs you soon see whyp
pthere had been something thrilling about the train ride to kyiv our group included old friends anne applebaum radek sikorski fareed zakaria eric schmidt and there was a certain giddiness as we trundled eastwards in blackedout sleeping compartments bucha jolted us out of that mood and prepared us for president zelenskys somber message that a winter of discontent was fast approaching not just for ukraine but for all of europe id met zelensky before five months after his improbable election in april 2019 i liked him diminutive but energetic i wrote he radiates ingenuous bonhomie over lunch he confided that he had recently had a very strange phone call with your president the explosive readout of donald trumps july call with zelensky was released ten days later that night by way of afterdinner cabaret he appeared onstage with three other performers in his old comedy show that jejune zelensky has been entirely effaced by the war leader who on february 24 decided to stand and fight i need ammunition not a ride staking his life in what seemed to many a doomed last stand against the russian imperial steamroller in an age when the democratic world has grown accustomed to phony leadership it gives you a jolt to encounter the real thing he is a hero of our time perhaps the herop
pbritish historians are supposed to know about their monarchy having once embarked on a history of the house of saxecoburg and gotha as the royal family was known before 1917 i ought to have been a fount of wisdom but that book was never completed despite many long hours in the royal archives at windsor castle i moved to the united states nearly two decades ago and in 2018 i became a us citizen although we britons are not obliged to relinquish our uk citizenship i recall wincing when required during the naturalization ceremony absolutely and entirely [to] renounce and abjure all allegiance and fidelity to any foreign prince potentate state or sovereignty the queen was in my minds eye as i said those words i consoled myself that this was one of lifes necessary white liesp
div
a hrefhttpsspectatorworldcomsubscribethedcdiaryimg alt srchttpsspectatorworldcomwpcontentuploads202110emailnewslettermobpng classwpimage29949a div
pyet dual citizenship is more disreputable than a white lie it is a hedge when farcical things occur in britain such as the opera buffa premiership of boris johnson i am an american when the united states is being embarrassing as during trumps attempted autogolpe on january 6 i switch the queens death found me out it was not the pageantry of the past ten days magnificent though it was nor even the lone pipers pibroch so much as the recollection of her role in my familys history my grandfather thomas hamilton was a labour man when she ascended the throne his wartime service in the royal air force in burma and india left him with roughly orwells views of the british empire and establishment yet he always made us sit and watch the queens christmas message and stood to attention when god save the queen was played i have maintained that tradition so even his youngest grandchildren grasped the significance of her death to have been part of a nation in mourning must have been uplifting toop
pithis article was originally published in ia hrefhttpswwwspectatorcoukarticlevolodymyrzelenskyisaheroofourtimethe spectatorais uk magazine ia hrefhttpsspectatorworldcomsubscribeisubscribe to the world edition hereiaiip
pthe post a relnofollow hrefhttpsspectatorworldcomtopicvolodymyrzelenskyherotimeniallfergusonvolodymyr zelensky is a hero of our timea appeared first on a relnofollow hrefhttpsspectatorworldcomthe spectator worldap
|
pwhen queen died way kyiv mind focused war ukraine found uncharacteristically lost words asked comment took refuge complexities journey involved delayed flight rome lublin frantic drive chelm polishukrainian border overnight train western ukraine good excuse reality think couldnt interview id trapped broadcasting housep pkyiv nbcs roving war correspondent richard engel forewarned exuberant expect capital city war battle kyiv fought won phase war fighting south kherson east kharkiv central kyiv looks positively cheerful drive northeast suburbs irpin bucha hostomel blown bridges destroyed houses burntout russian armor haunted simple memorial victims russian war crimes buried church st andrew pyervozvannoho saints bucha months ago interred bodies people civilians executed cold blood russian death squads ukrainian soldiers routinely refer invaders orcs soon whyp pthere thrilling train ride kyiv group included old friends anne applebaum radek sikorski fareed zakaria eric schmidt certain giddiness trundled eastwards blackedout sleeping compartments bucha jolted mood prepared president zelenskys somber message winter discontent fast approaching ukraine europe id met zelensky months improbable election april 2019 liked diminutive energetic wrote radiates ingenuous bonhomie lunch confided recently strange phone president explosive readout donald trumps july zelensky released days later night way afterdinner cabaret appeared onstage performers old comedy jejune zelensky entirely effaced war leader february 24 decided stand fight need ammunition ride staking life doomed stand russian imperial steamroller age democratic world grown accustomed phony leadership gives jolt encounter real thing hero time herop pbritish historians supposed know monarchy having embarked history house saxecoburg gotha royal family known 1917 ought fount wisdom book completed despite long hours royal archives windsor castle moved united states nearly decades ago 2018 citizen britons obliged relinquish uk citizenship recall wincing required naturalization ceremony absolutely entirely [to] renounce abjure allegiance fidelity foreign prince potentate state sovereignty queen minds eye said words consoled lifes necessary white liesp div hrefhttpsspectatorworldcomsubscribethedcdiaryimg alt srchttpsspectatorworldcomwpcontentuploads202110emailnewslettermobpng classwpimage29949a div pyet dual citizenship disreputable white lie hedge farcical things occur britain opera buffa premiership boris johnson american united states embarrassing trumps attempted autogolpe january 6 switch queens death found pageantry past days magnificent lone pipers pibroch recollection role familys history grandfather thomas hamilton labour man ascended throne wartime service royal air force burma india left roughly orwells views british empire establishment sit watch queens christmas message stood attention god save queen played maintained tradition youngest grandchildren grasped significance death nation mourning uplifting toop pithis article originally published inia hrefhttpswwwspectatorcoukarticlevolodymyrzelenskyisaheroofourtimethe spectatoraisuk magazineia hrefhttpsspectatorworldcomsubscribeisubscribe world edition hereiaiip pthe post relnofollow hrefhttpsspectatorworldcomtopicvolodymyrzelenskyherotimeniallfergusonvolodymyr zelensky hero timea appeared relnofollow hrefhttpsspectatorworldcomthe spectator worldap
|
632e82f91fb0c8ead4369021
|
Canada Called Itself a Genocide State. Iran Was Listening
|
img altcanada called itself a genocide state iran was listening srchttpss3amazonawscomprodstaticcontentquillettecom202209image1440x560croppedjpgpwhen dictators are called out by the international community for perpetrating humanrights abuses they often attempt to deflect criticism by accusing their western critics of hypocrisy in april for instance china a hrefhttpseconomictimesindiatimescomnewsinternationalworldnewschinasaysushumanrightsreportrevealshypocrisydoublestandardsarticleshow90866110cmsfrommdrdenounceda the us state departments annual a hrefhttpswwwstategovreports2021countryreportsonhumanrightspracticeschinacountry reporta on beijings humanrights practices as a pretense the us government uses to cover up its agenda of seeking hegemony over such nations as afghanistan the us should immediately cease making irresponsible remarks a hrefhttpsenglishnewscn202204148c54f02f78554e859291849c5a35fc7bchtmlsaida chinese foreign ministry spokesperson zhao lijian instead it needs to reflect on itself mend its ways and work earnestly to improve its own humanrights situationppin substance these attempts at moral equivalence lack credibility but they can have the emappearanceem of truth when our adversaries base their propaganda on selfincriminating statements made by the wests own media figures and politiciansppthis week iranian president ebrahim raisi took the rostrum at the united nations general assembly to deliver irans habitual a hrefhttpsnewsunorgenstory2022091127371denunciationsa of western double standards while antihijab a hrefhttpswwwcnncom20220921middleeastiranmahsaaminideathwidespreadprotestsintlhnkindexhtmlprotestsa rocked numerous iranian cities in the wake of 22yearold a hrefhttpswwwbbccomnewsworldmiddleeast62984076mahsa aminis deatha at the hands of tehrans morality police raisi went through a predictable laundry list of complaints accusing israel of creating the worlds largest prison in gaza and denouncing us detention policies at the mexican border but he also threw in an attack on a hrefhttpswwwthewhigcomnewsexplainerwhatignitedtheiranianprotestsandisthisthebeginningofanewzeitgeistcanadasa treatment of indigenous peoples declaring that bodies of hundreds of children were discovered in mass graves in a [former residential] schoolppas a canadian i found this element of raisis performance maddening thanks to canadas own misinformation mill the iranian president didnt have to go to the bother of inventing his own lies my own countrys journalists and leaders did that job for himppthe issue of supposed unmarked indigenous child graves dominated the canadian media in the latter half of 2021 but as i reported a hrefhttpsquillettecom20220722howfakenewsinthenewyorktimesledtoacanadiansocialpanicoverunmarkedgravesin emquilletteemaem emseveral months ago no mass graves were ever found in fact even the indigenous groups that initially reported groundpenetrating radar gpr survey results consistent with the possible presence of unmarked burial sites werent talking about mass graves rather the invented massgraves claim was popularized by a badly botched ema hrefhttpswwwnytimescom20210528worldcanadakamloopsmassgraveresidentialschoolshtmlnew york timesa emmay 28th 2021 story written by reporter ian austen for a definitive debunking see a hrefhttpsnationalpostcomopiniontheyearofthegraveshowtheworldsmediagotitwrongonresidentialschoolgravesterry glavins account in canadas emnational postema ppin the 16 months that have passed since the unmarkedgraves story broke in late may 2021 not a single body has been found nor any human remains and so even the less sensational allegation that 215 a hrefhttpswwwcbccanewscanadabritishcolumbiatkemlc3bapstesecwc3a9pemc215childrenformerkamloopsindianresidentialschool16043778emindividualema unmarked child graves lie buried under the grounds of a former indigenous residential school in kamloops british columbia now seems doubtful nor have bodies or human remains been recovered at any of the other former residentialschool properties where gpr surveys were conducted ppyet that didnt prevent prime minister justin trudeau from lowering flags on canadian public buildings for more than a hrefhttpswwwcbccanewspoliticscanadianflagstoremainathalfmastresidentialschools16170504five monthsa nor from a hrefhttpstwittercomjustintrudeaustatus1412601187296235521s20t1bsxhepqhuihfmryton_wspeakinga publicly as if bodies were already being dug up and aside from theem national postem not a singleem emmajor canadian media outlet has admitted its role in feeding the unmarkedgraves social panic that exploded last year and which often included lurid speculation that the supposed grave sites not only contained the remains of indigenous children but that these children had been a hrefhttpsquillettecom20220413franceswiddowsononthequestionscanadiansarentsupposedtoaskaboutunmarkedgravesmurdereda through methods worthy of a horrormovie plot ppgiven this what can canadian public figures say to raisi now that hes throwing spurious moral equivalences into our faces nothing in making the false claim that bodies of hundreds of children were discovered in mass graves in a [former residential] school the man is merely reading our own officially sourced misinformation back to us ppthis isnt the first time that trudeau has managed to maneuver canada into this kind of mortifying position visvis the worlds tyrants last year when canadian lawmakers voted to denounce chinas treatment of uighurs in western xinjiang as a form of genocide trudeau and his cabinet a hrefhttpsapnewscomarticleraceandethnicitycabinetsjustintrudeauchinaolympicgames5c85eedb0d3c3811ba1fd56eb4ac325dabstaineda the suspected reasons for that move were complex but they included the fact that canada was by its own description morally compromised on the genocide file back in 2019 trudeau had explicitly acceded to the absurd claim that canada too was guilty of genocidethis one against a hrefhttpswwwcbccanewspoliticstrudeaummiwggenocide15161681indigenous womena indeed according to the official a hrefhttpswwwmmiwgffadacafinalreportreporta that precipitated trudeaus emmea culpaem this supposed canadian genocide remains ema hrefhttpswwwhcnorgarticlestribalaffairsthisisgenocidethefinalreportofcanadasinquiryintommiwgongoingaem ppthe leaders of russia belarus iran north korea syria and venezuela know a good propaganda opening when they see one last year these nations collectively a hrefhttpswwwcbccanewspoliticschinacanadauncallsinvestigationcrimesindigenousuyghurs16075025calleda on the un to investigate crimes against canadas indigenous peoplesdoing so cleverly on the same day that western nations were launching a un campaign to demand that china allow international investigators access to xinjiangppwords have consequencesespecially when they comprise the vocabulary of mass slaughter the repetition of ghoulish hyperbole about canada doesnt just gratuitously harm the countrys reputation it also helps the worlds autocrats get away with crimes that are anything but fictional p
|
img altcanada called genocide state iran listening srchttpss3amazonawscomprodstaticcontentquillettecom202209image1440x560croppedjpgpwhen dictators called international community perpetrating humanrights abuses attempt deflect criticism accusing western critics hypocrisy april instance china hrefhttpseconomictimesindiatimescomnewsinternationalworldnewschinasaysushumanrightsreportrevealshypocrisydoublestandardsarticleshow90866110cmsfrommdrdenounceda state departments annual hrefhttpswwwstategovreports2021countryreportsonhumanrightspracticeschinacountry reporta beijings humanrights practices pretense government uses cover agenda seeking hegemony nations afghanistan immediately cease making irresponsible remarks hrefhttpsenglishnewscn202204148c54f02f78554e859291849c5a35fc7bchtmlsaida chinese foreign ministry spokesperson zhao lijian instead needs reflect mend ways work earnestly improve humanrights situationppin substance attempts moral equivalence lack credibility emappearanceem truth adversaries base propaganda selfincriminating statements wests media figures politiciansppthis week iranian president ebrahim raisi took rostrum united nations general assembly deliver irans habitual hrefhttpsnewsunorgenstory2022091127371denunciationsa western double standards antihijab hrefhttpswwwcnncom20220921middleeastiranmahsaaminideathwidespreadprotestsintlhnkindexhtmlprotestsa rocked numerous iranian cities wake 22yearold hrefhttpswwwbbccomnewsworldmiddleeast62984076mahsa aminis deatha hands tehrans morality police raisi went predictable laundry list complaints accusing israel creating worlds largest prison gaza denouncing detention policies mexican border threw attack hrefhttpswwwthewhigcomnewsexplainerwhatignitedtheiranianprotestsandisthisthebeginningofanewzeitgeistcanadasa treatment indigenous peoples declaring bodies hundreds children discovered mass graves [former residential] schoolppas canadian found element raisis performance maddening thanks canadas misinformation mill iranian president didnt bother inventing lies countrys journalists leaders job himppthe issue supposed unmarked indigenous child graves dominated canadian media half 2021 reported hrefhttpsquillettecom20220722howfakenewsinthenewyorktimesledtoacanadiansocialpanicoverunmarkedgravesin emquilletteemaem emseveral months ago mass graves found fact indigenous groups initially reported groundpenetrating radar gpr survey results consistent possible presence unmarked burial sites werent talking mass graves invented massgraves claim popularized badly botched ema hrefhttpswwwnytimescom20210528worldcanadakamloopsmassgraveresidentialschoolshtmlnew york timesa emmay 28th 2021 story written reporter ian austen definitive debunking hrefhttpsnationalpostcomopiniontheyearofthegraveshowtheworldsmediagotitwrongonresidentialschoolgravesterry glavins account canadas emnational postema ppin 16 months passed unmarkedgraves story broke late 2021 single body found human remains sensational allegation 215 hrefhttpswwwcbccanewscanadabritishcolumbiatkemlc3bapstesecwc3a9pemc215childrenformerkamloopsindianresidentialschool16043778emindividualema unmarked child graves lie buried grounds indigenous residential school kamloops british columbia doubtful bodies human remains recovered residentialschool properties gpr surveys conducted ppyet didnt prevent prime minister justin trudeau lowering flags canadian public buildings hrefhttpswwwcbccanewspoliticscanadianflagstoremainathalfmastresidentialschools16170504five monthsa hrefhttpstwittercomjustintrudeaustatus1412601187296235521s20t1bsxhepqhuihfmryton_wspeakinga publicly bodies dug aside theem national postem singleem emmajor canadian media outlet admitted role feeding unmarkedgraves social panic exploded year included lurid speculation supposed grave sites contained remains indigenous children children hrefhttpsquillettecom20220413franceswiddowsononthequestionscanadiansarentsupposedtoaskaboutunmarkedgravesmurdereda methods worthy horrormovie plot ppgiven canadian public figures raisi hes throwing spurious moral equivalences faces making false claim bodies hundreds children discovered mass graves [former residential] school man merely reading officially sourced misinformation ppthis isnt time trudeau managed maneuver canada kind mortifying position visvis worlds tyrants year canadian lawmakers voted denounce chinas treatment uighurs western xinjiang form genocide trudeau cabinet hrefhttpsapnewscomarticleraceandethnicitycabinetsjustintrudeauchinaolympicgames5c85eedb0d3c3811ba1fd56eb4ac325dabstaineda suspected reasons complex included fact canada description morally compromised genocide file 2019 trudeau explicitly acceded absurd claim canada guilty genocidethis hrefhttpswwwcbccanewspoliticstrudeaummiwggenocide15161681indigenous womena according official hrefhttpswwwmmiwgffadacafinalreportreporta precipitated trudeaus emmea culpaem supposed canadian genocide remains ema hrefhttpswwwhcnorgarticlestribalaffairsthisisgenocidethefinalreportofcanadasinquiryintommiwgongoingaem ppthe leaders russia belarus iran north korea syria venezuela know good propaganda opening year nations collectively hrefhttpswwwcbccanewspoliticschinacanadauncallsinvestigationcrimesindigenousuyghurs16075025calleda un investigate crimes canadas indigenous peoplesdoing cleverly day western nations launching un campaign demand china allow international investigators access xinjiangppwords consequencesespecially comprise vocabulary mass slaughter repetition ghoulish hyperbole canada doesnt gratuitously harm countrys reputation helps worlds autocrats away crimes fictional p
|
632f85c706c2d3eb2c632c32
|
Chomsky: The US and Israel Are Standing in the Way of Iran Nuclear Agreement
|
pduring the first few decades of the postwar era the us considered iran one of its closest geostrategic allies especially after the cia overthrew irans democratically elected government in 1953 and restored mohammad reza pahlavi as irans leader however since the 1979 revolution which abolished the monarchy and established an islamic republic the us and iran have been mortal enemies largely due to the role that israel occupies in the region in this context during the last couple of decades the thorniest issue in the usiran relationship has been tehrans nuclear program which iran says is focused on energy not weapons israel has been adamantly opposed to the program even though it is accepted beyond dispute that israel itself is a nuclear power in 2015 iran and several other countries including the united states reached the joint comprehensive plan of action agreement according to which iran was willing to dismantle much of its nuclear program and open its facilities to nuclear inspections in exchange for billions of dollars of relief support however the trump administration withdrew us support from the agreement and israel continued its policy of sabotage and assassination of scientistsp
pcurrent talks between washington and tehrans rulers to restore the 2015 nuclear agreement have been stalled and there is little hope that progress will be made any time soon naturally the us places the blame on tehran however us propaganda grossly distorts the reality of the situation noam chomsky points out in this exclusive interview for emtruthoutem the barriers to diplomacy are none other than israel and the united states says chomskyp
pstrongcj polychroniou noam the us and iran are at odds with each other having difficulty even talking to each other why do they hate each other so much and how much of a role does israels shadow play in this continuous dramastrongp
pstrongnoam chomsky strongat the risk of sounding like a broken record id like to say a few words once again on why i feel that the entire framework in which this issue is discussed is seriously distorted yet another tribute to the enormous power of the us propaganda systemp
pthe us government has been telling us for years that iranian nuclear programs are one of the gravest threats to world peace israeli authorities have made it clear that they will not tolerate this danger the us and israel have acted violently to overcome this grave threat cyberwar and sabotage which the pentagon regards as aggression that merits violence in selfdefense numerous assassinations of iranian scientists constant threats of use of force all options are open in violation of international law and if anyone were to care the us constitutionp
pevidently it is regarded as a most serious issue if so we surely want to see whether there is some way to lay it to rest there is establish a nuclear weaponsfree zone nwfz in the middle east with inspections which we know can work very well even us intelligence agrees that before the us dismantled the joint agreement on nuclear weapons jcpoa international inspections of irans nuclear program were successfulp
pthat would solve the alleged problem of iranian nuclear programs ending the serious threat of war what then is the barrierp
pnot the arab states which have been actively demanding this for decades not iran which supports the measure not the global south g77 134 developing nations most of the world which strongly supports it not europe which has posed no objectionsp
pthe barrier is the usual two outliers the us and israelp
pthere are various pretexts which we may ignore the reasons are known to all the us will not allow the enormous israeli nuclear arsenal the only one in the region to be subject to international inspectionp
pin fact the us does not officially recognize that israel has nuclear weapons though of course it is not in doubt the reason presumably is that to do so would invoke us law which arguably would render the massive us aid flow to israel illegal a door that few want to openp
pall of this is virtually undiscussable in the us outside of arms control circles on rare occasions the major media have come close to bringing up the forbidden topic a year agoem new york timesem editors proposed a hrefhttpswwwnytimescom20210612opinionsundayirannucleardealhtmlone way forward on iran a nuclearweaponsfree persian gulfap
pnote persian gulf not middle east the reason the editors explain is that israels nuclear weapons are unacknowledged and nonnegotiable filling in the gaps they are unacknowledged by the us and are nonnegotiable by us fiatp
pin brief there is a straightforward approach to addressing this grave threat to world peace but it is blocked by the global hegemon whose power is so enormous that the topic can barely even be discussed rather we must adopt the framework imposed by us power and keep to the deliberations over renewing some kind of agreement over iranian nuclear weaponsp
panother matter that must be sidelined though it is so obvious that even the grandest propaganda system cannot entirely efface it is that the current crisis arose when the us unilaterally destroyed the jcpoa over the strenuous objections of all other signers and the un security council which had endorsed it unanimously the us then imposed harsh sanctions on iran to punish it for the us dismantling of the agreement again other signers strenuously objected but they obeyed the threat of us retribution is too awesome as in many other cases notoriously the crushing cuba sanctions opposed by the whole world apart from the two usual outliers but obediently observedp
pagain i apologize for continually reiterating all of this it must however be understood having made that gesture lets accept reality subordinating ourselves to the mighty us propaganda system and keep to the permitted framework of discussionp
pturning finally to the question first israels role is more than shadow play israel is right at the center of the story both in its constant violent attacks on iran and in the unacknowledged nuclear arsenal that blocks to path to diplomatic settlement thanks to its superpower protectorp
pon mutual hate we should remember that we are talking about governments the us and iranian governments were close allies from 1953 when the us overthrew the parliamentary government of iran and reinstalled the shahs dictatorship until 1979 when a popular uprising overthrew the shah and iran switched from favored friend to reviled enemyp
piraq then invaded iran and the incoming reagan administration turned to lavish support for its friend saddam iran suffered huge casualties many from chemical weapons while the reaganites looked away and even tried to shift responsibility to iran for saddams murderous chemical war against iraqi kurds finally direct us intervention swung the war in iraqs favor after the war president bush sr invited iraqi nuclear engineers to the us for advanced training in weapons production a serious threat to iran of course and the us imposed harsh sanctions on iran so the story continuesp
pus charges against iran are too familiar to need reviewingstrong strongp
pstrongunsurprisingly nuclear talks between the us and iran have stalled again and it is unlikely that there will be a deal any time soon if at all to restore their 2015 nuclear deal first what do you see as the stumbling blocks in these talks and didnt iran already make a huge concession when it agreed to the 2015 nuclear agreement without requiring that israel does away with its own arsenal of nuclear weaponsstrongp
pnegotiations through european intermediaries seem to have been put on hold until after the us november elections at least there are outstanding disagreements on a number of issues the most important for now are reported to be iranian footdragging on inspection of traces of uranium that bear on whether iran had an undeclared weapons program before 2003 in contrast israeli nuclear weapons programs are nonnegotiable by us fiat not even subject to inspectionp
pstrongirans relationship with russia has been further strengthened since the start of the ukraine war do such moves on the part of tehrans rulers indicate the possibility of a complete break from the weststrongp
pits hard to see how the break should go much farther irans closer relations with russia are part of a general global realignment its contours unclear involving the major asian states and russiachina linksp
pstronghow likely is it that israel will attack irans nuclear facilitiesstrongp
pisrael has repeatedly attacked these facilities with sabotage and assassination it is likely to proceed with further efforts to prevent iran from gaining the capability to produce nuclear weapons which many countries havep
piranian leaders have consistently claimed that they have no intention of producing nuclear weapons i have no idea what their strategic thinking might be perhaps they are thinking along the lines of us nuclear doctrine that nuclear weapons must always be available at the ready because they cast a shadow over any crisis or conflict emessentials of postcold war deterrenceem stratcom 1995 as daniel ellsberg has emphasized in that respect nuclear weapons are constantly used to enable other aggressive actions with impunityp
pwhatever the motives for iran or any other state these weapons must be eliminated from the earth nwfzs are a step in this direction a more farreaching step is the un treaty on the prohibition of nuclear weapons tpnw now in force though without the participation of the nuclear states iran was active in negotiation of the tpnw and was one of 122 states that voted in favor its adoption though it has not yet signed it these are concerns that should be uppermost in our minds for all states for the security of all of life on earthp
|
pduring decades postwar era considered iran closest geostrategic allies especially cia overthrew irans democratically elected government 1953 restored mohammad reza pahlavi irans leader 1979 revolution abolished monarchy established islamic republic iran mortal enemies largely role israel occupies region context couple decades thorniest issue usiran relationship tehrans nuclear program iran says focused energy weapons israel adamantly opposed program accepted dispute israel nuclear power 2015 iran countries including united states reached joint comprehensive plan action agreement according iran willing dismantle nuclear program open facilities nuclear inspections exchange billions dollars relief support trump administration withdrew support agreement israel continued policy sabotage assassination scientistsp pcurrent talks washington tehrans rulers restore 2015 nuclear agreement stalled little hope progress time soon naturally places blame tehran propaganda grossly distorts reality situation noam chomsky points exclusive interview emtruthoutem barriers diplomacy israel united states says chomskyp pstrongcj polychroniou noam iran odds having difficulty talking hate role israels shadow play continuous dramastrongp pstrongnoam chomsky strongat risk sounding like broken record id like words feel entire framework issue discussed seriously distorted tribute enormous power propaganda systemp pthe government telling years iranian nuclear programs gravest threats world peace israeli authorities clear tolerate danger israel acted violently overcome grave threat cyberwar sabotage pentagon regards aggression merits violence selfdefense numerous assassinations iranian scientists constant threats use force options open violation international law care constitutionp pevidently regarded issue surely want way lay rest establish nuclear weaponsfree zone nwfz middle east inspections know work intelligence agrees dismantled joint agreement nuclear weapons jcpoa international inspections irans nuclear program successfulp pthat solve alleged problem iranian nuclear programs ending threat war barrierp pnot arab states actively demanding decades iran supports measure global south g77 134 developing nations world strongly supports europe posed objectionsp pthe barrier usual outliers israelp pthere pretexts ignore reasons known allow enormous israeli nuclear arsenal region subject international inspectionp pin fact officially recognize israel nuclear weapons course doubt reason presumably invoke law arguably render massive aid flow israel illegal door want openp pall virtually undiscussable outside arms control circles rare occasions major media come close bringing forbidden topic year agoem new york timesem editors proposed hrefhttpswwwnytimescom20210612opinionsundayirannucleardealhtmlone way forward iran nuclearweaponsfree persian gulfap pnote persian gulf middle east reason editors explain israels nuclear weapons unacknowledged nonnegotiable filling gaps unacknowledged nonnegotiable fiatp pin brief straightforward approach addressing grave threat world peace blocked global hegemon power enormous topic barely discussed adopt framework imposed power deliberations renewing kind agreement iranian nuclear weaponsp panother matter sidelined obvious grandest propaganda system entirely efface current crisis arose unilaterally destroyed jcpoa strenuous objections signers un security council endorsed unanimously imposed harsh sanctions iran punish dismantling agreement signers strenuously objected obeyed threat retribution awesome cases notoriously crushing cuba sanctions opposed world apart usual outliers obediently observedp pagain apologize continually reiterating understood having gesture lets accept reality subordinating mighty propaganda system permitted framework discussionp pturning finally question israels role shadow play israel right center story constant violent attacks iran unacknowledged nuclear arsenal blocks path diplomatic settlement thanks superpower protectorp pon mutual hate remember talking governments iranian governments close allies 1953 overthrew parliamentary government iran reinstalled shahs dictatorship 1979 popular uprising overthrew shah iran switched favored friend reviled enemyp piraq invaded iran incoming reagan administration turned lavish support friend saddam iran suffered huge casualties chemical weapons reaganites looked away tried shift responsibility iran saddams murderous chemical war iraqi kurds finally direct intervention swung war iraqs favor war president bush sr invited iraqi nuclear engineers advanced training weapons production threat iran course imposed harsh sanctions iran story continuesp pus charges iran familiar need reviewingstrong strongp pstrongunsurprisingly nuclear talks iran stalled unlikely deal time soon restore 2015 nuclear deal stumbling blocks talks didnt iran huge concession agreed 2015 nuclear agreement requiring israel away arsenal nuclear weaponsstrongp pnegotiations european intermediaries hold november elections outstanding disagreements number issues important reported iranian footdragging inspection traces uranium bear iran undeclared weapons program 2003 contrast israeli nuclear weapons programs nonnegotiable fiat subject inspectionp pstrongirans relationship russia strengthened start ukraine war moves tehrans rulers indicate possibility complete break weststrongp pits hard break farther irans closer relations russia general global realignment contours unclear involving major asian states russiachina linksp pstronghow likely israel attack irans nuclear facilitiesstrongp pisrael repeatedly attacked facilities sabotage assassination likely proceed efforts prevent iran gaining capability produce nuclear weapons countries havep piranian leaders consistently claimed intention producing nuclear weapons idea strategic thinking thinking lines nuclear doctrine nuclear weapons available ready cast shadow crisis conflict emessentials postcold war deterrenceem stratcom 1995 daniel ellsberg emphasized respect nuclear weapons constantly enable aggressive actions impunityp pwhatever motives iran state weapons eliminated earth nwfzs step direction farreaching step un treaty prohibition nuclear weapons tpnw force participation nuclear states iran active negotiation tpnw 122 states voted favor adoption signed concerns uppermost minds states security life earthp
|
632f863206c2d3eb2c632c46
|
A White Supremacist Under Every Bed
|
blockquotepa hrefhttpsalphahistorycomcoldwarredsunderthebedalphahistorya the red scare 194757 was a decadelong period of intense anticommunist paranoia in the united states during this period millions of ordinary americans were paralysed by an irrational fear of reds under the bed the belief that thousands of communist agents and sympathisers were secretly living amongst them plotting or waiting to overthrow the governmentpblockquote
pimg sizesmaxwidth 263px 100vw 263px srchttpmarginalrevolutioncomwpcontentuploads202209800pxseven_society_maury_hall263x300jpg alt width263 srcsethttpmarginalrevolutioncomwpcontentuploads202209800pxseven_society_maury_hall263x300jpg 263w httpmarginalrevolutioncomwpcontentuploads202209800pxseven_society_maury_hall768x875jpg 768w httpmarginalrevolutioncomwpcontentuploads202209800pxseven_society_maury_halljpg 800w classwpimage84362 height300today we live under the white supremacist scare the irrational fear that there is a white supremacist under every bed an email sent to the parents of university of virginia students for example warns that events have occurred on grounds that have been cause for concern and the nature and timing of these events have caused some to speculate that they are linked or part of a larger pattern of racially motivated crimes here is one such eventp
blockquoteplast weekend several community members reported that a flag bearing a symbol that looked either like a crown or an owl depending on how the flag is held was left on the grass near the memorial to enslaved laborers that same person also left a check for 88888 that was ultimately delivered as a surprise to a students room and the check had the same symbol that was on the flag as rumors swirled around this bizarre set of events some speculated that the flag represented a white supremacist organization and that the check was somehow a targeted act of intimidation against a student of colorpblockquote
pa crown an owl a check for 88888 heil hitler it seems odd that giving a check to someone is targeting a person of color but no matter logic isnt important here what else could this mean but white supremacy bear in mind that this is a university where a hrefhttpsuvamagazineorgarticlesstreak_showstreaking the lawna is a tradition and there are a hrefhttpsenwikipediaorgwikisecret_societies_at_the_university_of_virginiaweird numbers signs and sigils all over campusap
pthe uva police and the fbiyes the fbiwere called in to investigate nb there isnt even a hint of any crime and they got the culprit of course what they discovered was entirely banal does it even matterp
blockquotepwe discovered that he is part of an organization focusing on microphilanthropy that occasionally engages in random acts of kindness to current studentspblockquote
pmoreover the uva administration is advertising their investigation as if how seriously they took this potential threat is a credit to the organization instead of an embarrassment of poor judgment and fevered imaginationp
pthe post a relnofollow hrefhttpmarginalrevolutioncommarginalrevolution202209awhitesupremacistundereverbedhtmla white supremacist under every beda appeared first on a relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap
|
blockquotepa hrefhttpsalphahistorycomcoldwarredsunderthebedalphahistorya red scare 194757 decadelong period intense anticommunist paranoia united states period millions ordinary americans paralysed irrational fear reds bed belief thousands communist agents sympathisers secretly living plotting waiting overthrow governmentpblockquote pimg sizesmaxwidth 263px 100vw 263px srchttpmarginalrevolutioncomwpcontentuploads202209800pxseven_society_maury_hall263x300jpg alt width263 srcsethttpmarginalrevolutioncomwpcontentuploads202209800pxseven_society_maury_hall263x300jpg 263w httpmarginalrevolutioncomwpcontentuploads202209800pxseven_society_maury_hall768x875jpg 768w httpmarginalrevolutioncomwpcontentuploads202209800pxseven_society_maury_halljpg 800w classwpimage84362 height300today live white supremacist scare irrational fear white supremacist bed email sent parents university virginia students example warns events occurred grounds cause concern nature timing events caused speculate linked larger pattern racially motivated crimes eventp blockquoteplast weekend community members reported flag bearing symbol looked like crown owl depending flag held left grass near memorial enslaved laborers person left check 88888 ultimately delivered surprise students room check symbol flag rumors swirled bizarre set events speculated flag represented white supremacist organization check targeted act intimidation student colorpblockquote pa crown owl check 88888 heil hitler odd giving check targeting person color matter logic isnt important mean white supremacy bear mind university hrefhttpsuvamagazineorgarticlesstreak_showstreaking lawna tradition hrefhttpsenwikipediaorgwikisecret_societies_at_the_university_of_virginiaweird numbers signs sigils campusap pthe uva police fbiyes fbiwere called investigate nb isnt hint crime got culprit course discovered entirely banal matterp blockquotepwe discovered organization focusing microphilanthropy occasionally engages random acts kindness current studentspblockquote pmoreover uva administration advertising investigation seriously took potential threat credit organization instead embarrassment poor judgment fevered imaginationp pthe post relnofollow hrefhttpmarginalrevolutioncommarginalrevolution202209awhitesupremacistundereverbedhtmla white supremacist beda appeared relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap
|
632f868d06c2d3eb2c632c4e
|
The Truss economic plan
|
blockquote
p datatypeparagraphon friday [as indeed it happened] ms truss government is expected to announce a series of tax cuts including cutting taxes for new home purchases as well as reversing planned hikes in the corporate tax and cutting a recent increase in payroll taxes it will also abolish limits on bonuses for bankers and allow fracking for shale gas across the ukp
blockquote
div
blockquote
p datatypeparagraphthe measures come in addition to a big government spending plan to a relnoopener noreferer hrefhttpswwwwsjcomarticlesukgovernmenttocaphouseholdenergypricesfortwoyears11662634632modarticle_inline datatypelink target_blankcap household and corporate energy billsa this winter that could cost the uk government roughly 100 billion equivalent to about 113 billion over the next two yearsp
p datatypeparagraphthe goal is to spur growth in an economy facing weak growth and high inflation partly brought on by an energy price shock from higher a relnoopener noreferer hrefhttpswwwwsjcomarticlesukenergybillssettojumpascountryawaitsnewleader11661532660modarticle_inline datatypelink target_blanknaturalgas pricesa from the war in ukraine as well as a usstyle labor shortage absent the government bailouts economists warned that many britons would be unable to pay their energy bills this coming winter and thousands of companies would go brokep
p datatypeparagraphthe government is also planning a deregulation drive in particular in the finance sector to try to bolster londons role as a business hubp
p datatypeparagraphtaken together the truss plan is a bold but risky gamble that the payoff from higher growth will more than offset the risks from a big expansion in the governments deficit and debt at a time of high inflation and a relnoopener noreferer hrefhttpswwwwsjcomarticlesbankofenglandraisesratesforseventhsuccessivetimetofightinflation11663844759modarticle_inline datatypelink target_blankrising interest ratesa which will increase the cost of servicing the debt and could shake investors confidence in the uk economy and its currencyp
blockquote
p datatypeparagraphhere is a relnoopener hrefhttpswwwwsjcomarticlesukleaderliztrussplantocuttaxesandboostspendingtakesapagefromreaganomics11663864595modworld_major_5_pos1 target_blankmore from the wsja a relnoopener hrefhttpsryanbournesubstackcompbritainssupplysideturnr5rnyutm_mediumiosutm_campaignpost target_blankelsewherea ryan bourne covers the tax changes in more detailp
ul
li
ul
lithe recent 125 percent employer and employee national insurance tax rises have been reversedli
lithe basic rate of income tax would be cut from 20 percent to 19 percentli
lithe highest 45 percent marginal income tax rate would be abolished entirely making 40 percent the top official marginal rate bandli
listamp duty the property transactions tax on all transactions up to home values of 250000 and 425000 for firsttime buyers has been scrappedli
lithe planned increase in the corporate profits tax has been abandoned so maintaining it at 19 percentli
lifull and immediate expensing in the corporate tax code for the first 1 million invested in plant and machinery would be made permanentli
linew investment zones would be introduced in which there would be a 100 percent first year enhanced capital allowance relief for plant and machinery and building and structures relief of 20 percent per yearli
ul
li
ul
pand on regulationp
ul
linew investment zones would encompass streamlining existing planning applications and these are potentially big zones if the councils and authorities in discussions are any guide the greater london authority for exampleli
lienvironmental reviews would be shortened and reformedli
lichildcare deregulation proposals probably on staffing and occupational licensing are forthcomingli
linew planning reforms for housing are forthcomingli
lithe onshore wind generator ban will be liftedli
lithe fracking moratorium has been liftedli
lithe cap on bankers bonuses will be abandonedli
liagricultural regulation will be reformedli
lithe sugar tax and lots of other antiobesity regulations will be abandonedli
lithe arduous tax rules on contractors known as ir35 will be scrappedli
liall future tax policy will be reviewed through this prism of simplificationli
li
p datatypeparagraphthere will be an expansion of the number of welfare claimants who must submit to more intensive work coaching with the aim of increasing their hoursp
li
ul
pthe ft a relnoopener hrefhttpswwwftcomcontente4a95eac71bc4da9b029200764179d0c target_blankdetailsa the negative reaction from uk bond equity and currency markets furman and buiter are a relnoopener hrefhttpstwittercombrucereutersstatus1573392102075297792 target_blankvery negativea summers a relnoopener hrefhttpstwittercomlewis_goodallstatus1573324063266803716 target_blanktooa in my view these are mostly good policies but how will all that borrowing go over and is the bank of england up to doing the appropriate offsets i will cover these policies as they unfoldp
div
pthe post a relnofollow hrefhttpmarginalrevolutioncommarginalrevolution202209thetrusseconomicplanhtmlthe truss economic plana appeared first on a relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap
|
blockquote p datatypeparagraphon friday [as happened] ms truss government expected announce series tax cuts including cutting taxes new home purchases reversing planned hikes corporate tax cutting recent increase payroll taxes abolish limits bonuses bankers allow fracking shale gas ukp blockquote div blockquote p datatypeparagraphthe measures come addition big government spending plan toa relnoopener noreferer hrefhttpswwwwsjcomarticlesukgovernmenttocaphouseholdenergypricesfortwoyears11662634632modarticle_inline datatypelink target_blankcap household corporate energy billsathis winter cost uk government roughly 100 billion equivalent 113 billion yearsp p datatypeparagraphthe goal spur growth economy facing weak growth high inflation partly brought energy price shock highera relnoopener noreferer hrefhttpswwwwsjcomarticlesukenergybillssettojumpascountryawaitsnewleader11661532660modarticle_inline datatypelink target_blanknaturalgas pricesa war ukraine usstyle labor shortage absent government bailouts economists warned britons unable pay energy bills coming winter thousands companies brokep p datatypeparagraphthe government planning deregulation drive particular finance sector try bolster londons role business hubp p datatypeparagraphtaken truss plan bold risky gamble payoff higher growth offset risks big expansion governments deficit debt time high inflation anda relnoopener noreferer hrefhttpswwwwsjcomarticlesbankofenglandraisesratesforseventhsuccessivetimetofightinflation11663844759modarticle_inline datatypelink target_blankrising interest ratesa increase cost servicing debt shake investors confidence uk economy currencyp blockquote p datatypeparagraphhere relnoopener hrefhttpswwwwsjcomarticlesukleaderliztrussplantocuttaxesandboostspendingtakesapagefromreaganomics11663864595modworld_major_5_pos1 target_blankmore wsja relnoopener hrefhttpsryanbournesubstackcompbritainssupplysideturnr5rnyutm_mediumiosutm_campaignpost target_blankelsewherea ryan bourne covers tax changes detailp ul li ul lithe recent 125 percent employer employee national insurance tax rises reversedli lithe basic rate income tax cut 20 percent 19 percentli lithe highest 45 percent marginal income tax rate abolished entirely making 40 percent official marginal rate bandli listamp duty property transactions tax transactions home values 250000 425000 firsttime buyers scrappedli lithe planned increase corporate profits tax abandoned maintaining 19 percentli lifull immediate expensing corporate tax code 1 million invested plant machinery permanentli linew investment zones introduced 100 percent year enhanced capital allowance relief plant machinery building structures relief 20 percent yearli ul li ul pand regulationp ul linew investment zones encompass streamlining existing planning applications potentially big zones councils authorities discussions guide greater london authority exampleli lienvironmental reviews shortened reformedli lichildcare deregulation proposals probably staffing occupational licensing forthcomingli linew planning reforms housing forthcomingli lithe onshore wind generator ban liftedli lithe fracking moratorium liftedli lithe cap bankers bonuses abandonedli liagricultural regulation reformedli lithe sugar tax lots antiobesity regulations abandonedli lithe arduous tax rules contractors known ir35 scrappedli liall future tax policy reviewed prism simplificationli li p datatypeparagraphthere expansion number welfare claimants submit intensive work coaching aim increasing hoursp li ul pthe ft relnoopener hrefhttpswwwftcomcontente4a95eac71bc4da9b029200764179d0c target_blankdetailsa negative reaction uk bond equity currency markets furman buiter relnoopener hrefhttpstwittercombrucereutersstatus1573392102075297792 target_blankvery negativea summers relnoopener hrefhttpstwittercomlewis_goodallstatus1573324063266803716 target_blanktooa view good policies borrowing bank england appropriate offsets cover policies unfoldp div pthe post relnofollow hrefhttpmarginalrevolutioncommarginalrevolution202209thetrusseconomicplanhtmlthe truss economic plana appeared relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap
|
63337aad1f476ee1f05309ef
|
Biden's Student Loan Debt Forgiveness Plan Now Estimated To Cost $400 Billion
|
div
picture
source sizesminwidth 600px 331px 100vw typeimagewebp srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202209bidenstudenloansjpgwebp 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202209bidenstudenloans1200x675jpgwebp 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202209bidenstudenloans800x450jpgwebp 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202209bidenstudenloans600x338jpgwebp 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202209bidenstudenloans331x186jpgwebp 331w
source sizesminwidth 600px 331px 100vw typeimagejpeg srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202209bidenstudenloansjpg 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202209bidenstudenloans1200x675jpg 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202209bidenstudenloans800x450jpg 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202209bidenstudenloans600x338jpg 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202209bidenstudenloans331x186jpg 331w
img width1200 altpresident biden with money background srchttpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202209bidenstudenloans800x450jpg height675
picture
div
pspanpresident joe bidens sweeping student loan forgiveness plan will wipe all the budget savings created by the inflation reduction actand then somespanp
pspanin a a hrefhttpswwwcbogovsystemfiles20220958494studentloanspdflettera published on monday the congressional budget office cbo a nonpartisan federal agency estimated that bidens student loan debt forgiveness plan will increase the cost of student loans by 400 billion thats more than the white house originally projected and it means that the fiscally imprudent debt relief effort will end up swamping the modest budgetary savings achieved by last months passage of the inflation reduction act by more than 150 billionspanp
pspanthespan a hrefhttpswwwcbogovsystemfiles20220958494studentloanspdfspanletterspanaspan notes that this cost is calculated by comparing borrowers quotprojected repayments of student debt before accounting for the cancellation minus the present value of repayments after doing soquot to get the 400 billion estimate the cbo estimated that 95 percent of borrowers would be eligible for loan forgiveness and 90 percent of eligible borrowers would apply for forgiveness spanp
pspanbidens student loan debt forgiveness measures which were spana hrefhttpswwwwhitehousegovbriefingroomstatementsreleases20220824factsheetpresidentbidenannouncesstudentloanreliefforborrowerswhoneeditmostspanannouncedspanaspan last month would forgive up to 10000 for most borrowers making under 125000 annually and married couples making less than 250000 for borrowers who received a pell grant forgiveness is increased to 20000 spanp
pspanif anything the cbos estimates might lowball the true cost thats because its estimates do not include possible effects of bidensspan a hrefhttpswwwbrookingseduopinionsbidensincomedrivenrepaymentplanwouldturnstudentloansintountargetedgrantsspanreconfigurationspanaspan of incomedriven repayment plans which would set eligibility for repayment at 225 percent of the federal poverty level limit payments to just 5 percent of borrowers income and forgive remaining debt after 10 years of payment this is a radical change as most current plans start repayment at 150 percent of the federal poverty level set payments at 10 percent of a borrowers income and forgive loans after 20 years of paymentsspanp
pspanthats likely why the cbos estimate of the cost of bidens student loan forgiveness plan is slightly more conservative than other predictions the penn wharton budget model a fiscal policy think tank housed at the university of pennsylvaniaspan a hrefhttpsbudgetmodelwhartonupenneduissues2022826bidenstudentloanforgivenessspanplacesspanaspan the cost of student loan forgiveness at between 469 billion to 519 billion over 10 years spanp
pspanpenn wharton also notes that depending on the precise details of future incomedriven repayment plans and increased participation rates the new incomedriven repayment plan could add another 450 billion in cost bringing the total cost of bidens plan to over 1 trillion spanp
pspansimilarly the committee for a responsible federal budget spana hrefhttpswwwcrfborgblogsnewstudentdebtchangeswillcosthalftrilliondollarsspanannouncedspanaspan on monday that it now estimates that the cost of bidens planincluding idr changescould total between 500 and 650 billionspanp
pspanif the cbo and penn whartons estimates are correct then bidens student loan debt forgiveness plan will effectively wipe out thespan a hrefhttpswwwcrfborgblogscboscoresira238billiondeficitreductionspanestimatedspanaspan 238 billion reduction in the national deficit made by the inflation reduction act in fact the plan is likely to massively increase the national deficit by over 150 billion student loan forgiveness stands to be a massively expensive projectone that not only erases recent gains in spending reduction but manages to make the problem significantly worse than the status quospanp
pspanquotas cbos estimates help confirm the presidents student debt plan would wipe out the tenyear savings from the inflation reduction act twice over worsen inflationary pressures and deliver benefits to millions of americans with advanced degrees in upperincome householdsspanspanquot spana hrefhttpswwwcrfborgpressreleasesdebtcancellationtoocostlycboconfirmsspanwrotespanaspan maya macguineas the president of the committee for a responsible budget quotspanspanthis might be the most costly executive action in historyquot spanp
pspanhowever biden administration officials argue that cost estimates for student loan forgiveness are too high instead the white housespan a hrefhttpswwwcnncom20220825politicsstudentdebtquestionswhitehouseindexhtmlspanestimatesspanaspan that the program will cost taxpayers 240 billion over the next decadeassuming that only spana hrefhttpswwwusatodaycomstorynewspolitics20220926bidenstudentloancancellationcostover400billion8121634001span75 percentspanaspan of eligible borrowers participate in the program the biden administration is yet to release a detailed explanation of its estimate though according to spanispanusa todayspanispan officials wrote in a memo that quotwe would be thrilled if 90 of eligible middle and lowincome americans applied for this program but unfortunately thats unlikely based on the data from other programsquot notably no other loan forgiveness programs have gained as much media attention as this latest spate of forgiveness making an only 75 percent uptake seem unlikely spanp
pspaneven if the biden administration is somehow correct and the loan forgiveness plan only ends up costing around 240 billion the program would still end up negating projected gains from the inflation reduction act further the plan would still leave nothing in place to actually reduce the rate at which americans are accruing student loan debta fact that might quotnecessitatequot further rounds of debt forgiveness in the futurespanp
pspanthis latest estimate from the cbo is yet another reason to believe that bidens student loan forgiveness plan is going to spell fiscal disaster not only will the program wipe out possible gains from the inflation reduction act but it will also go further and increase the deficit by over 150 billion the real solution to this problem is to create a plan that will actuallyspan a hrefhttpsreasoncom20220708thebidenadministrationsproposedpolicytoreducestudentdebtisonlygoingtomaketheproblemworsespanreducespanaspan the amount that students are borrowing to attend college spanp
pspanrather than taking the harder more effective path the biden administration seems dead set on taking a ridiculously expensive and ultimately ineffective approach to tackle the student debt crisisspanp
pthe post a relnofollow hrefhttpsreasoncom20220927bidensstudentloandebtforgivenessplannowestimatedtocost400billionbidens student loan debt forgiveness plan now estimated to cost 400 billiona appeared first on a relnofollow hrefhttpsreasoncomreasoncomap
|
div picture source sizesminwidth 600px 331px 100vw typeimagewebp srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202209bidenstudenloansjpgwebp 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202209bidenstudenloans1200x675jpgwebp 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202209bidenstudenloans800x450jpgwebp 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202209bidenstudenloans600x338jpgwebp 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202209bidenstudenloans331x186jpgwebp 331w source sizesminwidth 600px 331px 100vw typeimagejpeg srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202209bidenstudenloansjpg 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202209bidenstudenloans1200x675jpg 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202209bidenstudenloans800x450jpg 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202209bidenstudenloans600x338jpg 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202209bidenstudenloans331x186jpg 331w img width1200 altpresident biden money background srchttpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202209bidenstudenloans800x450jpg height675 picture div pspanpresident joe bidens sweeping student loan forgiveness plan wipe budget savings created inflation reduction actand somespanp pspanin aa hrefhttpswwwcbogovsystemfiles20220958494studentloanspdflettera published monday congressional budget office cbo nonpartisan federal agency estimated bidens student loan debt forgiveness plan increase cost student loans 400 billion thats white house originally projected means fiscally imprudent debt relief effort end swamping modest budgetary savings achieved months passage inflation reduction act 150 billionspanp pspanthespan hrefhttpswwwcbogovsystemfiles20220958494studentloanspdfspanletterspanaspan notes cost calculated comparing borrowers quotprojected repayments student debt accounting cancellation minus present value repayments soquot 400 billion estimate cbo estimated 95 percent borrowers eligible loan forgiveness 90 percent eligible borrowers apply forgivenessspanp pspanbidens student loan debt forgiveness measures spana hrefhttpswwwwhitehousegovbriefingroomstatementsreleases20220824factsheetpresidentbidenannouncesstudentloanreliefforborrowerswhoneeditmostspanannouncedspanaspan month forgive 10000 borrowers making 125000 annually married couples making 250000 borrowers received pell grant forgiveness increased 20000spanp pspanif cbos estimates lowball true cost thats estimates include possible effects bidensspan hrefhttpswwwbrookingseduopinionsbidensincomedrivenrepaymentplanwouldturnstudentloansintountargetedgrantsspanreconfigurationspanaspan incomedriven repayment plans set eligibility repayment 225 percent federal poverty level limit payments 5 percent borrowers income forgive remaining debt 10 years payment radical change current plans start repayment 150 percent federal poverty level set payments 10 percent borrowers income forgive loans 20 years paymentsspanp pspanthats likely cbos estimate cost bidens student loan forgiveness plan slightly conservative predictions penn wharton budget model fiscal policy think tank housed university pennsylvaniaspan hrefhttpsbudgetmodelwhartonupenneduissues2022826bidenstudentloanforgivenessspanplacesspanaspan cost student loan forgiveness 469 billion 519 billion 10 yearsspanp pspanpenn wharton notes depending precise details future incomedriven repayment plans increased participation rates new incomedriven repayment plan add 450 billion cost bringing total cost bidens plan 1 trillionspanp pspansimilarly committee responsible federal budget spana hrefhttpswwwcrfborgblogsnewstudentdebtchangeswillcosthalftrilliondollarsspanannouncedspanaspan monday estimates cost bidens planincluding idr changescould total 500 650 billionspanp pspanif cbo penn whartons estimates correct bidens student loan debt forgiveness plan effectively wipe thespan hrefhttpswwwcrfborgblogscboscoresira238billiondeficitreductionspanestimatedspanaspan 238 billion reduction national deficit inflation reduction act fact plan likely massively increase national deficit 150 billion student loan forgiveness stands massively expensive projectone erases recent gains spending reduction manages problem significantly worse status quospanp pspanquotas cbos estimates help confirm presidents student debt plan wipe tenyear savings inflation reduction act twice worsen inflationary pressures deliver benefits millions americans advanced degrees upperincome householdsspanspanquot spana hrefhttpswwwcrfborgpressreleasesdebtcancellationtoocostlycboconfirmsspanwrotespanaspan maya macguineas president committee responsible budget quotspanspanthis costly executive action historyquotspanp pspanhowever biden administration officials argue cost estimates student loan forgiveness high instead white housespan hrefhttpswwwcnncom20220825politicsstudentdebtquestionswhitehouseindexhtmlspanestimatesspanaspan program cost taxpayers 240 billion decadeassuming spana hrefhttpswwwusatodaycomstorynewspolitics20220926bidenstudentloancancellationcostover400billion8121634001span75 percentspanaspan eligible borrowers participate program biden administration release detailed explanation estimate according spanispanusa todayspanispan officials wrote memo quotwe thrilled 90 eligible middle lowincome americans applied program unfortunately thats unlikely based data programsquot notably loan forgiveness programs gained media attention latest spate forgiveness making 75 percent uptake unlikelyspanp pspaneven biden administration correct loan forgiveness plan ends costing 240 billion program end negating projected gains inflation reduction act plan leave place actually reduce rate americans accruing student loan debta fact quotnecessitatequot rounds debt forgiveness futurespanp pspanthis latest estimate cbo reason believe bidens student loan forgiveness plan going spell fiscal disaster program wipe possible gains inflation reduction act increase deficit 150 billion real solution problem create plan actuallyspan hrefhttpsreasoncom20220708thebidenadministrationsproposedpolicytoreducestudentdebtisonlygoingtomaketheproblemworsespanreducespanaspan students borrowing attend collegespanp pspanrather taking harder effective path biden administration dead set taking ridiculously expensive ultimately ineffective approach tackle student debt crisisspanp pthe post relnofollow hrefhttpsreasoncom20220927bidensstudentloandebtforgivenessplannowestimatedtocost400billionbidens student loan debt forgiveness plan estimated cost 400 billiona appeared relnofollow hrefhttpsreasoncomreasoncomap
|
63337ada1f476ee1f05309f5
|
Ronald W. Jones, RIP
|
pthe university of rochester has reported his passing via michael rizzo he was one of the very greatest trade economists here is a relnoopener hrefhttpswwwgooglecomsearchqronjonesrochestersourcehpei0lkzy6xofi615nopisah4aeiflsigajik0e8aaaaayznn4jfepls_kkh6nd10xbe_hm62cmnrved0ahukewilmcfq5lx6ahwoglkfhqrjarwq4dudcakuact5oqronjonesrochestergs_lcpcgdnd3mtd2l6eamybqghekabmguiircgatifcceqoae6bqgaeiaeoggilhcxaxcdatoocc4qgaqqsqmqgweq1ai6cagaeledeimboheilhcabbcxaxcdardhardrazolcc4qgaqqsqmqgwe6cwgueledeimbenqcogsiabcabbcxaxcdatoicaaqgaqqsqm6cwgueledemcbenedogsilhcabbdharcvatolcc4qgaqqsqmq1ai6cagueiaeeledog4ilhcabbcxaxdhardrazoicaaqgaqqyqm6bqgaejidoguilhcabdoicc4qgaqq1ai6bagaeao6bagueao6bggaeb4qflaawjgsyo8taabwahgagaf2iaghc5ibbde3ljkyaqcgaqesclientgwswiz target_blankfurther information on himap
pthe post a relnofollow hrefhttpmarginalrevolutioncommarginalrevolution202209ronaldwjonesriphtmlronald w jones ripa appeared first on a relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap
|
pthe university rochester reported passing michael rizzo greatest trade economists relnoopener hrefhttpswwwgooglecomsearchqronjonesrochestersourcehpei0lkzy6xofi615nopisah4aeiflsigajik0e8aaaaayznn4jfepls_kkh6nd10xbe_hm62cmnrved0ahukewilmcfq5lx6ahwoglkfhqrjarwq4dudcakuact5oqronjonesrochestergs_lcpcgdnd3mtd2l6eamybqghekabmguiircgatifcceqoae6bqgaeiaeoggilhcxaxcdatoocc4qgaqqsqmqgweq1ai6cagaeledeimboheilhcabbcxaxcdardhardrazolcc4qgaqqsqmqgwe6cwgueledeimbenqcogsiabcabbcxaxcdatoicaaqgaqqsqm6cwgueledemcbenedogsilhcabbdharcvatolcc4qgaqqsqmq1ai6cagueiaeeledog4ilhcabbcxaxdhardrazoicaaqgaqqyqm6bqgaejidoguilhcabdoicc4qgaqq1ai6bagaeao6bagueao6bggaeb4qflaawjgsyo8taabwahgagaf2iaghc5ibbde3ljkyaqcgaqesclientgwswiz target_blankfurther information himap pthe post relnofollow hrefhttpmarginalrevolutioncommarginalrevolution202209ronaldwjonesriphtmlronald w jones ripa appeared relnofollow hrefhttpmarginalrevolutioncommarginal revolutionap
|
63337ba51f476ee1f0530a08
|
Subreddit Gets Users To Call Texas Gov. Greg Abbott a 'Little Piss Baby' To Defy Content Moderation Law
|
div
picture
source sizesminwidth 600px 331px 100vw typeimagewebp srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202209abbott2400x1350jpgwebp 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202209abbott1200x675jpgwebp 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202209abbott800x450jpgwebp 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202209abbott600x338jpgwebp 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202209abbott331x186jpgwebp 331w
source sizesminwidth 600px 331px 100vw typeimagejpeg srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202209abbott2400x1350jpg 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202209abbott1200x675jpg 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202209abbott800x450jpg 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202209abbott600x338jpg 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202209abbott331x186jpg 331w
img width1200 alttexas governor greg abbott srchttpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202209abbott800x450jpg height675
picture
div
pas of this week the subreddit a hrefhttpswwwredditcomrpoliticalhumorcommentsxmgy7lwere_messing_with_texasrpoliticalhumora is requiring that all posts include the phrase quotgreg abbott is a little piss babyquot or else users will be banned from the forum a hrefhttpswwwtechdirtcom20220926subredditdiscriminatesagainstanyonewhodoesntcalltexasgovernorgregabbottalittlepissbabytohighlightabsurdityofcontentmoderationlawper reportinga by emtechdirtem moderators have made explicit that they will be discriminating against all users posting viewpoints that go against the pissbaby line in protest of texas new a hrefhttpslegiscancomtxtexthb20id2424328content moderation lawa hb 20 which forces social media platforms to host speech they find objectionablep
pthat law which emreasonems scott shackford has reported on in the past was a hrefhttpss3documentcloudorgdocuments224179245thcircuitnetchoicevpaxtonpdfrecently uphelda by a panel of fifth circuit judges quotin what certainly appears to be a complete violation and abandonment of first amendment protections for private companiesquot a hrefhttpsreasoncom20220919federaljudgesupholdtexaslawregulatingwhatsocialmediaplatformsmaycensorwritesa shackfordp
phb 20 which was first a hrefhttpswwwtexastribuneorg20211201texassocialmedialawblockedsigned into lawa by texas republican gov greg abbott in 2021 disallows usbased platforms with over 50 million monthly users from banning users over their beliefs originally drafted by republican lawmakers alleging viewpoint discrimination against conservatives the bill has percolated through the courts one federal judge a hrefhttpswwwtexastribuneorg20211201texassocialmedialawblockedsummed it up wella as he blocked the law from taking effect back in december of last year quotthis court is convinced that social media platforms or at least those covered by [house bill] 20 curate both users and content to convey a message about the type of community the platform seeks to foster and as such exercise editorial discretion over their platforms contentquotp
pother judges have disagreedmost recently the panel of fifth circuit judges who a hrefhttpss3documentcloudorgdocuments224179245thcircuitnetchoicevpaxtonpdfupheld the lawa claiming that the social media platforms challenging the bill quotoffer a rather odd inversion of the first amendment that amendment of course protects every persons right to the freedom of speech but the platforms argue that buried somewhere in the persons enumerated right to free speech lies a corporations emunenumeratedem right to emmuzzleem speechquot emphasis theirsp
pnow people are hilariously testing how far texas will go in winnowing away at companies abilities to decide which content they host reddit makes a particularly interesting case study due to the unique nature of the sites content moderation practices the subreddits moderators a hrefhttpswwwredditcomrpoliticalhumorcommentsxmgy7lwere_messing_with_texasexplainap
blockquotepquotreddit falls into a weird category with this law the actual employees of the company reddit do maybe one percent of the moderation on the site the rest is handled by deldisgusting janniesdel volunteer moderators who reddit has made quite clear over the years arent agents of reddit mainly so they dont lose millions of dollars every time a mod approves something vaguely related to disney and violates their copyright its unclear whether we count as users or moderators in relation to this law and none of us live in texas anywayquotpblockquote
pcourts elsewhere have quotrightly recognized that the government has no legal authority to interfere with the way a private company decides to curate content that it presents to its customers especially when their interference is politically motivatedquot a hrefhttpsreasonorgcommentarytexassocialmedialawviolatesthefirstamendmentexplaineda spence purnell over at the reason foundation the nonprofit which publishes this website back in 2021p
plaws that attempt to treat social media companies as quotcommon carriersquot like utility providers or telecommunication companies are bad not just from a compelledspeech perspective but also because the quotcommon carrierquot definition probably a hrefhttpswwwcatoorgblogaresocialmediacompaniescommoncarriersshould nota apply to social media providers for a whole host of reasons the cato institutes matthew feeney a hrefhttpswwwcatoorgblogaresocialmediacompaniescommoncarrierstouches on that more hereap
pif pointing out the absurdity of such laws requires somewhat juvenile but possibly truthtelling reddit stunts so be itp
pthe post a relnofollow hrefhttpsreasoncom20220927subredditgetsuserstocalltexasgovgregabbottalittlepissbabytodefycontentmoderationlawsubreddit gets users to call texas gov greg abbott a little piss baby to defy content moderation lawa appeared first on a relnofollow hrefhttpsreasoncomreasoncomap
|
div picture source sizesminwidth 600px 331px 100vw typeimagewebp srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202209abbott2400x1350jpgwebp 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202209abbott1200x675jpgwebp 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202209abbott800x450jpgwebp 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202209abbott600x338jpgwebp 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202209abbott331x186jpgwebp 331w source sizesminwidth 600px 331px 100vw typeimagejpeg srcsethttpsd2eehagpk5cl65cloudfrontnetimgc2400x1350w2400q60uploads202209abbott2400x1350jpg 2400w httpsd2eehagpk5cl65cloudfrontnetimgc1200x675w1200q60uploads202209abbott1200x675jpg 1200w httpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202209abbott800x450jpg 800w httpsd2eehagpk5cl65cloudfrontnetimgc600x338w600q60uploads202209abbott600x338jpg 600w httpsd2eehagpk5cl65cloudfrontnetimgc331x186w331q60uploads202209abbott331x186jpg 331w img width1200 alttexas governor greg abbott srchttpsd2eehagpk5cl65cloudfrontnetimgc800x450w800q60uploads202209abbott800x450jpg height675 picture div pas week subreddit hrefhttpswwwredditcomrpoliticalhumorcommentsxmgy7lwere_messing_with_texasrpoliticalhumora requiring posts include phrase quotgreg abbott little piss babyquot users banned forum hrefhttpswwwtechdirtcom20220926subredditdiscriminatesagainstanyonewhodoesntcalltexasgovernorgregabbottalittlepissbabytohighlightabsurdityofcontentmoderationlawper reportinga emtechdirtem moderators explicit discriminating users posting viewpoints pissbaby line protest texas new hrefhttpslegiscancomtxtexthb20id2424328content moderation lawa hb 20 forces social media platforms host speech find objectionablep pthat law whichemreasonems scott shackford reported past hrefhttpss3documentcloudorgdocuments224179245thcircuitnetchoicevpaxtonpdfrecently uphelda panel fifth circuit judges quotin certainly appears complete violation abandonment amendment protections private companiesquot hrefhttpsreasoncom20220919federaljudgesupholdtexaslawregulatingwhatsocialmediaplatformsmaycensorwritesa shackfordp phb 20 hrefhttpswwwtexastribuneorg20211201texassocialmedialawblockedsigned lawa texas republican gov greg abbott 2021 disallows usbased platforms 50 million monthly users banning users beliefs originally drafted republican lawmakers alleging viewpoint discrimination conservatives bill percolated courts federal judge hrefhttpswwwtexastribuneorg20211201texassocialmedialawblockedsummed wella blocked law taking effect december year quotthis court convinced social media platforms covered [house bill] 20 curate users content convey message type community platform seeks foster exercise editorial discretion platforms contentquotp pother judges disagreedmost recently panel fifth circuit judges hrefhttpss3documentcloudorgdocuments224179245thcircuitnetchoicevpaxtonpdfupheld lawa claiming social media platforms challenging bill quotoffer odd inversion amendment amendment course protects persons right freedom speech platforms argue buried persons enumerated right free speech lies corporations emunenumeratedem right emmuzzleem speechquot emphasis theirsp pnow people hilariously testing far texas winnowing away companies abilities decide content host reddit makes particularly interesting case study unique nature sites content moderation practices subreddits moderators hrefhttpswwwredditcomrpoliticalhumorcommentsxmgy7lwere_messing_with_texasexplainap blockquotepquotreddit falls weird category law actual employees company reddit maybe percent moderation site rest handled bydeldisgusting janniesdel volunteer moderators reddit clear years arent agents reddit mainly dont lose millions dollars time mod approves vaguely related disney violates copyright unclear count users moderators relation law live texas anywayquotpblockquote pcourts quotrightly recognized government legal authority interfere way private company decides curate content presents customers especially interference politically motivatedquot hrefhttpsreasonorgcommentarytexassocialmedialawviolatesthefirstamendmentexplaineda spence purnell reason foundation nonprofit publishes website 2021p plaws attempt treat social media companies quotcommon carriersquot like utility providers telecommunication companies bad compelledspeech perspective quotcommon carrierquot definition probably hrefhttpswwwcatoorgblogaresocialmediacompaniescommoncarriersshould nota apply social media providers host reasons cato institutes matthew feeney hrefhttpswwwcatoorgblogaresocialmediacompaniescommoncarrierstouches hereap pif pointing absurdity laws requires somewhat juvenile possibly truthtelling reddit stunts itp pthe post relnofollow hrefhttpsreasoncom20220927subredditgetsuserstocalltexasgovgregabbottalittlepissbabytodefycontentmoderationlawsubreddit gets users texas gov greg abbott little piss baby defy content moderation lawa appeared relnofollow hrefhttpsreasoncomreasoncomap
|
Subsets and Splits
No community queries yet
The top public SQL queries from the community will appear here once available.