text
stringlengths 0
5.27k
| target
stringclasses 26
values | Word Count
int64 100
500
|
---|---|---|
chandigarh former chief minister leader opposition bhupinder singh hooda wednesday trained guns towards manohar lal khattar dushyant chautala led bjp jjp government issue inflation unemploymenthooda said haryana topped inflation, along unemployment, corruption crime citing figures released nso, said people state continuously getting crushed mounting inflation hooda said congress tenure, haryana used get cheap petrol diesel comparison neighbouring states vat rates lowest state bjp jjp government doubled vat rates impacted price things, confirmed government figures ever since bjp came power, prices almost every commodity, including flour, milk, ghee, mustard oil, pulses, cooking gas, doubled doubled, income common man continuously decreasing, saidthe former cm said government drastically increased rates electricity past earlier, government increased rates water put additional burden public, government going make education expensive, along everyday needs, pointed government categorically refused give funds universities due this, universities started increasing fees hisar based chaudhary charan singh agricultural university increased fees education become expensive children poor middle class families coming days, said | academic interests | 264 |
amit kumarkarnal vrinda bhatia panipat secured india rank air national eligibility cum entrance test neet medical entrance, result declared yesterday got marks father rajesh bhatia engineer nfl mother veena bhatia working iocl, panipat refinery hr departmentshe said wants get admission aiims delhi preparing last two years vrinda said, happy result studied hard get rankshe said class private school delhi per cent marks elder sister, private job completing bcom | academic interests | 131 |
state examination board wednesday announced teachers aptitude test secondary tat prelims resultsthe results showed lakh candidates taken competitive exam, , qualified scoring marks marks question paper tat conducted candidates want get teacher job secondary schools tat prelims conducted june candidates qualified able take tat mains june state government recently changed rules qualification getting teacher job class grade schools candidates take clear two tests qualify jobearlier, candidates take one test tat two part test, tat prelims tat mains new recruitment henceforth based new structure tat state government started conducting tat tat mains conducted june delayed june nowtat mains conducted ahmedabad, rajkot, surat vadodaraboard data showed , candidates scored marks , total candidates scored marks board data showed , candidates scored marks , candidates scored marks | academic interests | 235 |
kiit deemed university achieved remarkable milestone securing th position prestigious nirf india rankings , released th june annual ranking exercise, conducted ministry education, govt india, evaluates various universities institutions impressive jump kiit parameter last year th rank national level showcases institution dedication academic excellence compassionate outreach kiit also earned place among top research universities country, securing th position expressing happiness achievement, prof achyuta samanta, founder, kiit kiss, said, firmly believe slow steady wins race slowly surely, kiit evolved qualitative institution credited diligent students, dedicated faculty, staff collective efforts attaining recognitiondisclaimer content produced kalinga institute industrial technology | academic interests | 152 |
new delhi union public service commission released upsc epfo admit card today, june candidates successfully applied recruitment enforcement officer eo , accounts officer ao , assistant provident fund commissioner download admit cards official website upsconlinenicinupsc epfo exam scheduled conducted july , candidates follow step step guide shared download upsc epfo e admit card tap link provided directly open login window access resulthow download upsc epfo admit card step visit official website upsconlinenicinstep homepage, click link enforcement officer accounts officer assistant provident fund commissioner, epfo, step new window appear screen, enter login details registration id roll number, submitstep upsc epfo admit card displayed screenstep download hall ticket get printout usedirect link download e admit cardcandidates shall note one required get hard copy upsc admit card carry examination centre day exam mandatory candidate take print important instructions candidate downloading e admit card bring along e admit card permitted enter examination hall, reads official websitefor information, candidates suggested keep check official website | academic interests | 266 |
new delhi national testing agency nta released csir ugc net answer key today, june candidates appeared joint csir ugc net december june examination download provisional answer keys official website csirnetntanicinthe joint central scientific industrial rsearch university grants commission national eligibility test conducted june , , , , exam centres located cities across countrya total , , candidates registered csir ugc net computer based test cbt candidates refer step step process shared download answer key online click direct link provided thathow download csir ugc net answer key step visit official website csirnetntanicinstep click link display provisional answer keys, question paper recorded responses answer key challenge joint csir ugc net december, june examination, homepagestep new pdf file open screen, check important details mentioned itstep come back homepage click link available answer key challengestep log credentials access provisional answer keystep answer key displayed screenstep raise objection , any, linkdirect link answer keythose unsatisfied csir ugc net provisional answer key time raise objections last date submit challenges june pmcandidates required pay non refundable fee rs per objection raised answer key | academic interests | 282 |
aditya wadhawanthe national institute open schooling nios indian medical association ima work strengthening paramedical courses , course jointly introduced invited many , students including several working professionals got jobs working paramedics new mou signed nios ima, additional subjects included paramedical courses new streams course include radiography x ray technician , medical imaging technology, several specialisations medical laboratory technologycurrently, , , accredited vocational institutes avis nios diploma radiography, medical imaging technology, medical laboratory technology respectively pursuing courses, students exposed subjects like artificial limb implantation technology, radiology, optometry, radiotherapy, radiography medical imaging, many subjects recognised ima speaking education times, saroj sharma, chairperson, nios, says, able increase skilled paramedics nios course students passed class xii inthe science stream biology compulsory subject also get enrolled courses part continuous process expand outreach vocational courses also sync objectives nep nios designed several paramedical courses collaboration ima since , new courses several innovative specializations support paramedical industry new six month long courses competency based components curriculum taking inputs doctors, would ignite analytical skills students working professionals, said sharma | academic interests | 265 |
ahmedabad gujarat secondary higher secondary education board gshseb announced schedule supplementary exam class students failed one two subjectsthe exam begin july conclude july basic mathematics exam conducted july standard mathematics exam conducted july exam science subjects scheduled july gujarati july board said students failed standard mathematics able opt basic mathematics supplementary examsthis year, , class students failed one subject , , students failed two subjects included total lakh students eligible take supplementary exams students apply online board official website using seat numbers pay registration fees online, board statement said | academic interests | 159 |
new delhi rajasthan staff selection board announced reet level hindi, sanskrit result today, june candidates taken rajasthan eligibility examination teacher hindi sanskrit download results official website rsmssbrajasthangovinthe reet level hindi examination held total vacancies sanskrit exam conducted vacanciessimple steps download results official website shared article candidates reference along reet hindi result pdf reet sanskrit result pdf linkshow download reet level result step visit official website reet rsmssbrajasthangovinstep homepage, click link given reet level hindi, sanskrit result step new pdf file open screen, check roll number filestep download pdf get hard copy referencedirect link download hindi resultdirect link download sanskrit resultthe rsmssb already announced results sst, science, mathematics, english, sindhi, punjabi, urdu phasesalong reet hindi sanskrit result , board also released category wise cut marks languages candidates whose names mentioned list shortlisted candidates appearing document verification dv round next, details released due coursethe reet level examinations upper primary teachers posts conducted february , , , , march , exams held two shifts first shift held noon second shift held pm pmfor queries details, candidates advised check official website | academic interests | 301 |
new delhi himachal pradesh board school education hpbose released hp tet admit card june exams today, june candidates going appear himachal pradesh teacher eligibility test download hp tet admit card official website hpboseorgthe hp tet june exam set held june , , , july , , two shifts first shift held pm second shift conducted pm pmcandidates follow given step step process download hp tet hall ticket online click direct link shared articlehow download hp tet admit card step visit official website hpboseorgstep homepage, click tet jun tab menustep new webpage appear screen, enter login details application number date birthstep hp tet hall ticket displayed screenstep download take printout usedirect link download admit cardthe eligibility test held shastri, tgt arts , tgt medical , tgt non medical , language teacher, punjabi, urdu himachal pradesh tet qualifying test teachers valid lifetimefor information details, candidates suggested go official website | academic interests | 244 |
doda jammu four earthquakes jolted jammu region wednesday triggered panic among residents, day magnitude quake hit doda district union territorythe fresh earthquakes prompted administration shut educational institutes twin mountainous districts doda kishtwarofficials said reports far loss life damage propertyin kishtwar, magnitude quake recorded epicentre depth five kilometers, according national centre seismology ncs prior that, tremors magnitude recorded doda epicenter depth kilometers, data ncs showedtwo earthquakes recorded early hours day wellat am, magnitude quake recorded doda district depth kilometers, according datathe quake, magnitude , occurred kilometers east katra reasi district am, according ncs epicentre lay depth five kilometresthe four fresh earthquakes hit day high intensity tremors jolted doda districtadditional deputy commissioner adc bhaderwah, dilmir chowdhary told pti district magistrate directed closure schools address parental concerns ensure safety students subsequently shut downthe adc appealed residents panic, could exacerbate situation instead, advised people take precautionary measures prevent untoward incidents view aftershocks, closed schools district nothing panic people live ground floors expect aftershocks big earthquake, doda chief education officer ceo purushottam kumar saidsimilarly, officials kishtwar also shut schools district precautionary measurefour earthquakes including two higher intensity quakes hit region causing cracks dozens buildings since tuesdaythe fresh earthquakes triggered panic among people also brought back fear psychosis , entire region general bhaderwah valley particular exposed series earthquakes continued rock hilly region daystuesday quake damaged several buildings twin mountainous districts doda kishtwar five people, including two schoolchildren, suffered injuries, schools shut precautionary measure administrationthe earthquake widely felt jammu kashmir region neighbouring statesaccording ncs, analysis past five years shows minor earthquakes close vicinity doda region usual seismic activity | academic interests | 444 |
new delhi acharya narendra deva university agriculture technology, kumarganj, ayodhya announced upcatet result candidates appeared uttar pradesh combined agriculture technology entrance test check download results official website upcatetexamnetthe online registration process upcatet conducted march march , admit cards released may upcatet exam conducted may may candidates required enter digit user id registration number password download results onlinehow download upcatet resultstep go official website upcatetexamnetstep homepage, go download result sectionstep new window open screen, enter login credentials submitstep upcatet result displayed screenstep download take printout referencedirect link download resultupcatet counselling candidates score cut marks result appear upcatet counselling process shall noted two rounds counselling sessions first session taken online, followed second round conducted offlinefor additional details information, candidates advised check official website | academic interests | 223 |
ssc mts staff selection commission released examination schedule posts constable, mts candidates registered mentioned posts check download examination schedule official website ssc sscnicinas per schedule, ssc constable executive male female delhi police examination conducted november december , mts civilian delhi police examination held february , ssc exams important datess noname examinationdates constable executive male female delhi police examination november , , , , , , , , december , mts civilian delhi police examination february , , , , , , , check ssc constable, mts examination dates step visit official website sscnicinstep homepage, go latest news step now, click link reads, important notice schedule examinations step pdf schedule displayed screenstep download take printout future reference | academic interests | 195 |
thane bhavana name changed , stays thane streets parents always wanted join privileged children age school dressed neat ironed uniforms gleaming eyes often reflected desire however, little eight year old know soon, would soon merrily hopping one facilities start journey towards better futurebhavana one street kids identified thane district administration brought fold mainstream education state first ever mobile school project flagged thane early year initiative bring privileged destitute street children fold mainstream education brainchild kundan, former principal secretary, state women child development department okayed centre implementation seven districts maharashtracollector ashok shingare inaugurated initiative thane, february said, project involved identifying inducting children specially designed van converted mobile day care play school parked slums identified hotspots around mumbra, bhiwandi help local activists convinced parents nearly children educating them, saidmahendra gaikwad, thane district women child development officer adds part programme, students groomed basics educations play school acclimatised mainstream syllabus around students bhiwandi rest mumbra underwent training accommodated local municipal run facilities starting academic year, saidsocial activist dr swati singh assisted teams drive said initially faced resistance parents eventually managed drive home importance education kidsgaikwad said analysed individual grasping capacity children tied education officials get admitted primary section respective civic schools students admitted english medium schools others vernacular check coping education six months, said gaikwadmeanwhile, students recently received school kits seemed excited new turn lives held potential completely turn around fortunesmlc niranjan davkhare said would raise issue house demand policy bring privileged children fold education ishwar suryavanshi, secretary thane legal aid services authority also promised extend possible support initiativeofficials said would soon embark identifying pockets privileged children conservative official tally says children thane need brought fold initiative, officials said | academic interests | 465 |
new delhi delhi university wednesday launched admission registration portal du admission portal called common seat allocation system csas used admission undergraduate ug programmes university academic session total ug programmes colleges du , seats postgraduate courses pg courses , seatsthis year, delhi university starting three btech courses, registration portal open last week june students get admission basis jee main scorein undergraduate courses, maximum number applications received bcom hons cuet du ug academic session set begin august students follow given step step process know apply delhi university ug admissions csas portalhow apply du admission csas portalstep visit official website ugadmissionuodacinstep homepage, click new registration visiting portal first time, use login credentials sign in, already registeredstep fill application form ug programmes upload documents, askedstep verify details filled du application form step download form get hard copy referencedirect link csas portalall students apply postgraduate programmes may note du pg registrations begin last week june tentativelythe name, photograph signature integrated cuet portal cannot changed du admissions done basis normalised score cuet du admission registration feesstudents seeking admission delhi university shall note one time csas ug application fee non refundable registration fee ur obc ews category rs students sc st category, registration fee rs candidates must check dashboard, email, admission website wwwadmissionuodacin communications, updates, schedules related phases csas ug | academic interests | 362 |
new delhi state selection board ssb odisha released cpet admit card candidates registered common pg entrance test download hall tickets official website ssbodishaacinas per schedule, cpet conducted june july three shifts am, pm pm, pm pm candidates check result simply logging roll number date birth direct link odisha cpet hall ticket download cpet admit cardstep visit official website ssbodishaacinstep homepage, click ssb odisha cpet admit card linkstep enter login details click submitstep hall ticket displayed screenstep download take printout future referenceon basis entrance test marks career marks, subject wise state wide provisional rank announced selection applicants done centralized selection process admission fees admission pg courses collected students sams portal | academic interests | 197 |
ap eamcet results jawaharlal nehru technological university anantapur jntua declared ap eamcet results today, june candidates took andhra pradesh engineering agricultural medical common entrance test check download results official website cetsapscheapgovin ap eapcet result announced state education minister press conference access eamcet result, candidates login using registration number hall ticket number official portal jntua conducted ap eamcet behalf andhra pradesh state council higher education apsche may , candidates follow mentioned steps check download result official websiteover lakh students appeared ap eamcet these, lakh candidates registered engineering, remaining lakh agricultureap eamcet result engineering streamregistered lakhappeared lakhpass lakhpass percentage ap eamcet result agriculture streamregistered lakhappeared , pass , pass percentage direct link ap eamcet resultshow check ap eapcet results step visit official website cetsapscheapgovinstep homepage, click link available ap eamcet resultsstep new webpage open, key login details click submitstep ap eamcet result displayed screenstep download take printout scorecard referencelast year, total , , candidates applied admission engineering agriculture courses, , , candidates turned examination overall pass percentage recorded engineering agriculture respectively | academic interests | 295 |
kochi arya rs thamarasserry kozhikode emerged state topper national testing agency tuesday declared results national eligibility cum entrance test undergraduate neet ug admission undergraduate medical education medical institutions indiaarya secured marks percentile score secure rd rank nationally candidate kerala top list secured third position among top female candidates nationallyarya youngest daughter ramesh babu tk, police sub inspector, shaima k, homemaker archana rs, english student, arya sisterarya completed class alphonsa senior secondary school, thamarassery though attempted exam , rank joined online batch brilliant study centre, pala underwent coaching performed well expected good score never thought would state topper hope get admission aiims delhi, arya saidas many candidates kerala registered exams held may candidates appeared, qualified | academic interests | 188 |
hyderabad two students telangana, kanchani geyath raghu ram reddy jagruthi bodeddula among top india rank air neet ug results exams held may last month announced tuesday raghu ram reddy secured rank , jagruthi bodeddula secured rank raghu ram state topper telanganathis year , candidates appeared neet telangana , qualified exams number candidates qualified doubled compared , qualified , wrote exams stateapart two students, gilda prachi secured th rank air made list top female candidates top ews students category, tela varun reddy air rank bagged spot, whereas top sc category candidates, kollabathula pritham siddharth air bagged spot top st category candidates, lavudi madhu balaji air bagged spotspeaking achievements, raghu ram said surprised initial key scoring perfect , second key lost marks nevertheless, extremely happy aim certainly aiims delhi might pick cardiac neuro later on, said raghu ram studied sri chaitanya, hydernagar young boy originally hails tadipatri andhra pradesh parents also practicing doctors apthe second topper telangana jagruthi speaking toi said felt surreal sure bag seat aiims next choice jipmer happy day father flew us six years support exams efforts paid off, said jagruthi resides kphb used put hours study daily sri chaitanya hydernagar first doctor family | academic interests | 346 |
dehradun bhupinder gill , prominent educationist dehradun, died hotel fire pahalgam, kashmir, monday afternoon gill gone visit kashmir family friends, reached pahalgam day gill teacher one city renowned schools years joining another school principal retired school last year bilal ahmed, assistant director, jammu kashmir tourism department, pahalgam, confirming incident, told toi gill checked private hotel near golf course daughter, two grandchildren two family friends monday afternoon family friends managed escape time, due old age, said ahmed, adding, preliminary probe suggests fire caused due short circuit | academic interests | 139 |
new delhi jawaharlal nehru technological university anantapur jntua announced ap eamcet results today, june candidates appeared andhra pradesh engineering agricultural medical common entrance test result check download results official website cetsapscheapgovinthe andhra pradesh eamcet exam conducted may may , students passed state level entrance examination next appear eamcet counselling process, get admission participating colleges institutesa step step guide shared students follow download ap eamcet results online direct link also provided directly go login windowdirect link ap eamcet result download ap eamcet results step go official website cetsapscheapgovinstep click link available andhra pradesh eamcet resultsstep new webpage open, key login details, submitstep ap eamcet results displayed screenstep download scorecard get printout referencethe eamcet result downloaded form rank listap eapcet scorecard carries details candidate name, category, gender, father name, hall ticket number, stream, registration number, combined score, qualifying status, weightage, secured marks, group total, maximum scores, intermediate percentage, rankfor updates information, candidates advised keep checking official website regular intervals | academic interests | 248 |
physiology branch science focuses understanding human body functions different systems work together maintain health perform various activities explores mechanisms, processes, interactions occur within body support life let explore physiology simple termsbody systemsthe human body made several interconnected systems, nervous system, cardiovascular system, respiratory system, digestive system, musculoskeletal system physiology investigates systems work individually collaboratively ensure body proper functioning example, respiratory system, consisting lungs airways, responsible exchange oxygen carbon dioxide, enabling body obtain oxygen remove waste gasescell functionphysiology delves functions individual cells, building blocks body explores cells carry specialized tasks, communicate other, maintain homeostasis stable internal environment example neurons, cells nervous system, transmit electrical signals communicate information throughout bodyorgan functionphysiology examines functions organs, composed different types tissues working together investigates organs perform specific tasks contribute overall bodily functions example heart, organ cardiovascular system, pumps blood throughout body, delivering oxygen nutrients tissues removing waste productshomeostasishomeostasis refers body ability maintain stable internal environment despite external changes physiology explores mechanisms feedback loops regulate variables body temperature, blood pressure, ph balance, hormone levels example, body temperature rises, body responds sweating, helps cool maintain stable temperatureexercise adaptationphysiology investigates body responds adapts different stimuli, including exercise, stress, environmental factors explores changes occur body meet increased demands cope challenges example, regular exercise lead adaptations cardiovascular system, increased heart strength efficiency, support greater physical activityhealth diseasephysiology plays crucial role understanding normal functioning body identifying disruptions lead disease helps diagnosing treating medical conditions uncovering underlying physiological abnormalities example, diabetes disease characterized impaired insulin function, affects body ability regulate blood sugar levelsin summary, physiology study human body works explores functions interactions body systems, cells, organs, well maintenance homeostasis understanding physiology, scientists healthcare professionals gain insights normal bodily functions, disease processes, strategies promoting health well content generated assistance artificial intelligence | academic interests | 459 |
bhubaneswar swayam shakti tripathy, student sai international school secured th position national eligibility cum entrance test neet , results declared tuesday swayam scored percentile state topper describe words feeling expect would among top ten, teachers confident would among top scorers, swayam told toi surya prakash mishra abhipsa chowdhury school secured air neet securing national entrance test admission medical colleges across country father, doctor, always inspired doctor wish study mbbs aiims delhi, said mishra students said thorough study ncert books helped scoring high marks neet exam abhipsa chowdhury ranked th position among top female candidatesthree students state topped pwbd persons benchmark disability category rudra narayan sahu, tilak agrawal ranked th th among male candidates pwbd category india gitikrishna swain bagged th position among successful female students category many students registered neet odisha year total , students appeared neet examination , qualified test last year students appeared qualified admission | academic interests | 265 |
kaustav bauri national eligibility cum entrance test undergraduate neet ug results declared june , , national testing agency nta nta released list top candidates neet ug , list neet ug female toppers, list state wise category wise toppers details pdf neet ug air rank shared two candidates prabanjan j tamil nadu bora varun chakravarthi andhra pradesh candidates secured perfect score percentile score title four candidates tamil nadu neet ug top rankings year, neet ug exam conducted may sunday pm pm ist centres cities across country, well as, cities outside india total , , candidates registered neet ug , , , candidates present examination conducted languages assamese, bengali, english, gujarati, hindi, kannada, malayalam, marathi, odia, punjabi, tamil, telugu, urdu neet ug top candidates list check belowcandidate namemarks percentile score neet ai rankstateprabanjan j tamil nadubora varun chakravarthi andhra pradeshkaustav bauri tamil nadupranjalaggarwal punjabdhruv advani karnatakasurya siddharth n tamil nadushrinikethravi maharashtraswayamshaktitripathy odishavarun tamil naduparth khandelwal rajasthanneet ug toppers pdf list | academic interests | 230 |
neet ug results declared tuesday, june , students appeared neet ug exam advised visit official website exam direct link check download neet ug exam result provided reference candidates check neet ug results pdf herecandidates follow steps provided check download score card link activated official websitedirect link neet ug resulthow check neet ug resultto check neet ug results, follow steps visit official website go official website national testing agency nta official neet ug websitefind result link look neet ug result neet ug result link website homepage usually prominently displayed, may also find latest news important announcements sectionclick result link find result link, click proceed result checking pageprovide login credentials result checking page, asked provide login credentials enter neet ug roll number required details per instructions providedsubmit details entering login credentials, double check ensure entered correct information then, click submit check result buttonview result submitting required details, neet ug result displayed screen able see overall score, percentile, relevant informationdownload print wish keep physical copy result, download pdf format take printout directly website serve official record neet ug results | academic interests | 306 |
seems lockdowns pandemic period inflicted learning loss students, gujarat secondary higher secondary education board gshseb also suffered learning loss recently issued circular class syllabus, gshseb forgotten mention languages urdu, persian, arabic, sindhi circular mentioned sanskrit language persian sanskrit classical languages, urdu sindhi scheduled languages spokenafter school management reminder, board tuesday made changes old circular new syllabus class included languages omitted old circularschool administrators baffled omission written board seeking clarification languages letter school management association said languages taught schools class exams also conductedthe letter said confused languages omitted circular mistake teaching languages discontinued letter asked director board clarify mistake made correct issuing revised circularthe school administrators said academic year already started, schools started teaching subjects circular created lot confusion adversely affect students learningclearing confusion, board reissued circular sanskrit, persian, arabic, sindhi, prakrit languages optional subjects school management association written board seeking clarification omitted languages board made clarification confusion new circular, said mubin kazi, principal ankur school ahmedabad asked board mentioned urdu old reissued circular, kazi said board never mentioned urdu past circulars, language taught, exams conducted year, students taken urdu optional subject class , kazi said | academic interests | 344 |
gujarat tat prelims state examination board, gujarat declared tat prelims result today, june , candidates appeared tecaher aptitude test check download result official website sebexamorgon june , gujarat tat examination conducted, featuring set multiple choice questions mcqs general studies domain subjects exam, penalty marks applied incorrect responsethe candidates shortlisted gujarat tat appointed post teacher secondary level government aided institutionsdirect link gujarat tat result prelims check gujarat tat prelims resultstep visit official website sebexamorgstep homepage, click gujarat tat result linkstep new page open, enter details click submitstep tat prelims result displayed screen step download take printout result future referencecandidates shortlisted gujarat tat prelims eligible appear mains exam schedule tat mains shared board due course candidates advised keep regular check official website sebexamorg | academic interests | 207 |
mangaluru students nitte institute communication nico hosted campaign nourish knowledge order create awareness nutrition mental health among housekeeping staffresource persons delivered talks topic programme held college campus paneer near tuesdaydr prerana hegde, chief dietician, justice ks hegde hospital, spoke commonly eaten breakfast ideal food consumed morning suggested participants combine vegetables grains make balanced diet advised audience mixture least two vegetables curries prepared themthe audience taught difference mental health mental illness agneita aiman pengal, lecturer psychiatric social worker, ks hegde medical academy asked audience consider unwise facing mental health issuesa stress management test conducted order help audience understand stress levels cope interactive session held participants understand betterprof raviraj, head department, nico presided students kashish purohit amritha vk conducted programme witnessed participation housekeeping staff institutecaption students nitte institute communication hosted campaign nourish knowledge order create awareness nutrition mental health among housekeeping staff | academic interests | 239 |
aditya wadhawanthe indian council medical research icmr ayush ministry joined hands conduct extensive research field integrated medicine intent merge modern systems medicine traditional systems medicinethe initiative include high quality joint clinical trials certain diseases combining use promising therapies ayush part joint research initiative, working group created ministry icmr hold quarterly meetings exploring areas collaboration work deliverablesthis benefit students pursuing ug pg medicine ayurveda pursue research part research collaboration, department ayush aiims, institutes national importance inis , jipmer, puducherry upgraded departments integrated medicine speaking education times, dr amit gupta, professor, department surgery, aiims rishikesh, says, health ministry making efforts combine modern traditional medicine streams joint research initiative combine ayurveda modern medicine produce qualitative research outcomes future dr gupta highlights instances several proven successes diabetes regular use ayurvedic herbs research integrated medicine would prove useful solving disease specific issues organ specific diseases, says mbbs students taught lectures related ayush fifth semester part orientation session, students also sent field visit ayush beginning course, adds dr gupta sanjeev sharma, vice chancellor, national institute ayurveda, jaipur, says, current times, essential focus broadening research prospects integrative medicine would qualitatively enhance healthcare practices country integrative medicine would lead convergence modern medicine traditional medicine would enable students broaden knowledge also learn new hands techniquesthese days even completing mbbs bachelor ayurvedic medicine surgery bams , students become fully fit become professional medical practitioners post completing graduation, students either pursue post graduation opt government job getting involved conducting research related integrated medicines, students knowledge level would qualitatively enhanced, would better equipped become medical practitioners enable translation scientific basis ayurveda modern language science help ayurveda fraternity produce evidence data efficacy, explains sharma | academic interests | 423 |
new delhi andhra pradesh board intermediate education bieap declared ap inter supplementary result today, june students appeared ap inter st year, nd year supplementary exams check download results official website resultsbieapgovinthis year, ap inter st year exams conducted march april ap inter nd year exams held march april , , various exam centres across statebie ap declared inter public exam results april , , students could pass class class examinations ipe exams given another chance supplementary exams pass classesa step step process download ap inter supplementary results shared students reference click direct link provided directly open login page access resultshow download ap inter supplementary result step visit official website resultsbieapgovinstep click link given advanced supplementary results intermediate, homepagestep enter login credentials submitstep ap inter supply result displayed screenstep download result get hard copy usedirect link download advanced supplementary resultsupon downloading results, students advised check details mentioned ap inter supplementary marksheet name, roll number, subject code, etcfor additional details information, students advised go official website bieap | academic interests | 257 |
jeecup application form joint entrance examination council, uttar pradesh jeecup extended online application process polytechnic till june , candidates applied entrance examination advised complete registration end deadline online registration schedule joint entrance examination council post diploma industrial safety polytechnic extended till , read notification official website jeecup online application process jeecup began march ended june , now, council decided extend registration deadline till june , direct link jeecup registration apply jeecup step visit official website jeecupnicin step homepage, click apply joint entrance examination polytechnic step now, register fill application form step upload required documents pay application fee step download take printout application form future referenceapplication fee candidates general obc category required pay application fee rs whereas, application fee sc st category rs | academic interests | 198 |
new delhi national institute advanced studies architecture niasa released nata result phase official website candidates check results official website council architecture coa wwwnatain access result, candidates must log using application number password result display candidate name, roll number, marks obtained, percentilethe nata phase exam took place june , , two shifts morning afternoon morning shift commenced concluded pm, afternoon shift began pm ended pmnata national level entrance exam admission undergraduate architecture courses india universities countries also accept nata scores architecture program admissionsthe third phase nata examination conducted coa july , , session results set announced july , direct link check nata phase result steps check nata result phase step visit official website council architecture coa wwwnatainstep click result tabstep enter application number passwordstep click submit buttonstep result displayed screenthe nata result phase available download days declaration date candidates advised download safely keep results scorecard future referencethe nata conducted national institute advanced studies architecture niasa , body council architecture, new delhi, india | academic interests | 279 |
mumbai son maharashtra cm eknath shinde, member parliament eminent orthopedic surgeon, dr shrikanth eknath shinde lauded services anjuman islam, prestigious educational institution celebrating years dr shinde chief guest recent graduation ceremony around students anjuman islam dr ishaq jamkhanawala tibbiya unani medical college haji r kalsekar tibbiya hospital tibbiya college maharashtra university health sciences muhs , nashik college asked distribute degrees graduates must congratulate anjuman president dr zahir kazi colleagues great institution continuing service spirit founders institution, dr kazi guidance last many years, expanded improved much, said dr shinde also lauded fact girls performed extremely well outshone boys especially mentioned ansari laiba gold medal consecutively three yearsvice chairman city congress haji mudassar patel also among spoke occasion praised institution head dynamic leadership dr zahir kazi taken anjuman institutions higher level glad daughters well five doctors unani college toppers university, said patel patel also appreciated dr shinde taking time attending important function anjumandr zahir kazi, presidential address, appreciated dr shinde keen interest time gave function dr kazi said anjuman, last years, set high standards academic excellence professionalism also appreciated unani college principal dr rashid kazi teachers hard work diligence helped students excel university exam dr kazi said anjuman committed charity works commercial organisation education imparted profit also highlighted women empowerment done focus girls education one five toppers final examination conducted university tibbiya college shows empowered girls women institutions college first preference among students seeking admission tibbiya colleges state, observed | academic interests | 396 |
new delhi jharkhand academic council declared jac th result today, june students appeared jharkhand board class exams check download jac class results official website jacresultscomthis year, total , , students passed exams recording overall pass percentage total number , , students enrolled class th exams, which, , , appeared examinationsstudents log official portal help login credentials roll code roll number download jac th scorecard step step guide provided students download jharkhand class xi results online direct link also shared articlehow download jac th result step visit official website jacresultscomstep click link available jharkhand board class results homepagestep new login window appear screen, students enter login details given spacestep jac board th result displayed screenstep download jharkhand class th scorecard take printout future usedirect link download marksheetjac th result district wise pass percentagedistrictpass percentagekodarma hazaribagh bokaro simdega latehar gumla dhanbad ramgarh jamtara khunti last year, jac class results announced board september , , overall pass percentage recorded recommended students thoroughly review information provided jac class marksheet verify details name, roll number, subjects, marks obtained subjectfor information, students must visit official website jharkhand board | academic interests | 292 |
new delhi national testing agency nta released cuet pg admit card june exam candidates going appear common university entrance test postgraduate exam download admit cards official website cuetntanicinthe city intimation slip admit card candidates whose examinations scheduled later dates beyond june , , also released subsequentlycandidates follow mentioned step step process download cuet pg admit card click direct link shared articlehow download cuet pg admit card step visit official website cuetntanicinstep homepage, tap link available cuet pg hall ticketstep new webpage open, enter login details application date birthstep cuet pg admit card displayed screenstep download take printout usedirect link download admit cardcandidates advised go instructions contained admit card carefully well information bulletin candidates scheduled june appear subjects mentioned admit card advised carefully read subject specific instructions instructions mentioned question paper abide samefor details information, candidates advised reach official website | academic interests | 240 |
mppsc answer key madhya pradesh public service commission mppsc released final answer key state service exam sse state forest service exam sfs candidates took examination download final answer key official website mppscmpgovinthe mpsc prelims conducted may , , two shifts first shift noon second shift pm pmhow download mppsc sse sfs final answer key step visit official website mppscmpgovinstep homepage, click state service state forest service preliminary exam final answer keystep mpsc final answer key displayed screenstep download take printout final answer keydirect link mppsc prelims final answer key | academic interests | 141 |
chennai sastra university, education tech enterprise veranda varsity veranda owned chartered accountancy ca coaching enterprise j kshah classes partnering launch bachelor degree programme commerce bcom online mode also train students tech skills make employable financial sector prepare basics ca coursethe curriculum crafted align industry standards, enabling students develop knowledge skills necessary successful career field finance accounting extensive curriculum, taught dynamic professors, help students gain clear understanding industry practices, vaidhyasubramaniam, vice chancellor sastra university, said added job opportunities bcom students rise hiring domestic bfsi sector global financial captives high suresh kalpathi, executive director chairman, veranda learning, believes course win win situation students offers b com course reputed institution like sastra ca coaching jk shah classes course, internships, placement training many benefits, gives option appear professional certification exams reason student fails crack it, falter per statistics, still rock solid plan b top notch b com program part of, added first batch course commences july | academic interests | 253 |
new delhi madhya pradesh state open school education board released mpsos admit card today, june candidates appear mp open school exam download hall tickets official website mpsosnicinstudents enter roll number order download mpsos admit card onlinea step step procedure shared students reference download mpsos hall ticket students also click direct link provided access admit cardshow download mpsos admit card step visit official website mpsosnicinstep homepage, go admit card step click link available open school exam june admit card step new window appear, enter login details roll number, submitstep mpsos admit card displayed screenstep download take printout referencedirect link download admit cardcandidates may please note admit card important document every student needs carry exam centre day examination student fails produce admit card exam centre may allowed appear mpsos examinationmpsos exams conducted twice year ie, june december details information, candidates advised go official website | academic interests | 243 |
new delhi indian navy close application process agniveer ssr mr batch today, june candidates applied recruitment must complete registration end deadline joinindiannavygovinthe online registration indian navy agniveer mr, ssr began may recruitment drive, indian navy aims fill total vacancies, agniveer ssr agniveer mr download indian navy agniveer ssr notificationdownload indian navy agniveer mr notificationselection process selection process agniveer mr, ssr batch include two stages ie shortlisting computer based online examination , written examination, pft recruitment medical examination apply indian navy agniveer registration apply indian navy agniveer ssr, mr step go official website agniveernavycdacin step homepage, click agniveer registration link step now, register fill application form step upload required documents pay examination fee step submit download application form step take printout form future referenceexamination fee candidates pay examination fee rs plus gst online application | academic interests | 211 |
jee advanced indian institute technology, iit guwahati scheduled declare jee advanced result june announced, candidates appeared advanced examination able check download result official website jeeadvacinas per official schedule, jee advanced result final answer key declared june , that, joint seat allocation josaa process begin june , , pmjee advanced conducted june two shifts noon paper pm pm paper total lakh students registered advanced , , girlsimportant datessnoactivitydate online declaration final answer key results jee advanced june , online registration architecture aptitude test aat june , june , tentative start joint seat allocation josaa processjune , architecture aptitude test aat june , declaration results aat june , download jee advanced result step visit official website jeeadvacinstep appeared homepage, click jee advanced result linkstep enter login details submitstep advanced result appear screenstep download take printout future reference | academic interests | 230 |
scert delhi deled admit card state council educational research training scert , new delhi announced entrance examination admission diploma elementary education deled programme, scheduled take place june , candidates appearing computer based test cbt designated centres delhi ncr download admit card starting today ie, tuesday, june , cbt consist questions carrying marks conducted hindi english duration test hours, negative marking incorrect answersadmission deled course year based rank merit obtained entrance examination eligible candidates meeting rank merit criteria fulfilling eligibility requirements considered admissionthe rank candidate based cbt result displayed tentatively june , candidates option edit choices preferences diets institutes correct data errors, needed, june , , july , diploma elementary education deled diploma pre school education dpse delhi offer abundant opportunities learning professional growth seats provisionally allocated based rank obtained applicants respective category sub category cbtthe entrance test syllabus includes subjects like general awareness current affairs , social science, general science, mathematics numerical ability , general mental ability, english hindi, specific number questions allocated subjectdirect link official delhi deled websitehere steps download scert delhi deled admit card visit official website scert delhi go official website state council educational research training scert delhinavigate admit card section look admit card download section website homepageclick deled admit card link find specific link downloading deled admit card click itenter details fill required details registration number, date birth, necessary information promptedverify information double check entered details ensure accuracy proceedingdownload print admit card verified information, click download button save admit card device recommended take printout admit card future referenceremember carry printed copy admit card examination centre day exam important document grants permission appear scert delhi deled entrance examination | academic interests | 441 |
hscap results directorate general education dge kerala published trial allotment result higher secondary centralised admission process hscap plus one admission today, june candidates check result status official websites admissiondgekeralagovin hscapkeralagovinas per official website hscap, trial allotment result merit quota published candidates check selection status logging username password official portaldirect link hscap kerala plus one trial allotment resulthow check kerala plus one result step visit official webiste hscapkeralagovinstep homepage, click candidates login step new login page appear, enter username passwordstep hscap class result displayed screenstep download take printout future referenceapplicants check trial allotment list june , pm corrections required, necessary corrections must entered candidate login final confirmation done june , | academic interests | 178 |
bhubaneswar common application form caf students, want take admission plus iii first year degree colleges state, available student academic management system sams website june pm last date applying online caf july submitting caf online, students validate correct application form sams resource centres june july except holidays provisional allotment seats first round published pm july students pay admission fees july july admission students selected merit list start july continue till july data admitted students updated july july second selection merit list published pm july selected students take admission july august data admitted students updated july august provisional allotment seats third round published pm august students take admission round august august data admitted students updated admission process august august fourth round merit list published pm august selected students take admission institutions august august data admitted students updated admission time provisional allotment fifth round published pm september students take admission september september similarly, sixth round merit list published pm september students selected round take admission september september whole process admission completed september according admission reform, higher education department come phase ii admission process complete process six rounds, said official sources | academic interests | 340 |
panaji emphasising need apprenticeship building career, chief minister pramod sawant monday said state government unveil platform youth seeking complete higher studies workingsix hundred youth joined companies four government offices period one year one half years prime minister apprenticeship programmeduring period apprenticeship, youth get stipend rs , rs , working simultaneously, one continue studies complete graduation post graduation new platform launched week, sawant said, urged youth take advantage opportunitysawant said students complete iti, thstd, graduation undergo apprenticeship, students enrol onlinehe said even itis assisting youth enrolstating goa tourism industry, includes new manohar international airport, huge employment potential, chief minister said minimum lakh jobs would created next five years hospitality industry take opportunity, others grab it, sawant said | academic interests | 187 |
telangana ecet result telangana state council higher education tsche announced ts ecet results today pm candidates appeared telangana engineering common entrance test check download result official website ecettscheacinthe ts ecet exam conducted may , single shift noon , students registered common entrance test access result, students would required key hall ticket number detail official portalthe overall pass percentage recorded ts ecet result per centdirect link ts ecet result announcement result, students follow step step process given check resulthow check ts ecet resultstep visit official website ecettscheacinstep homepage, click ecet result linkstep new login page appear, enter details click submitstep ts ecet result displayed screenstep download take printout result future referencefor updates, candidates advised keep regular check official website tsche ecettscheacin | academic interests | 211 |
ap inter supply results andhra pradesh intermediate education board bieap announce ap inter supply results today, june , , pm students taken supplementary exams access results official website bieap, bieapgovinto check results, students required enter hall ticket number date birth results presented form merit list students successfully clear exams eligible continue studies upcoming academic yearthe ap inter supply exams conducted may june , ap inter st nd annual results announced april , pm lakh students registered exams, lakh students appeared overall pass percentage exams stood important keep hall ticket number necessary details handy ensure smooth hassle free process checking downloading ap inter supply results direct link official websitehere steps check download ap inter supply results visit official website go official website andhra pradesh intermediate education board bieap , bieapgovinfind results section look results examination section homepage usually located main menu prominent area websiteselect ap inter supply results click link tab corresponds ap inter supply results redirect result pageenter details provide hall ticket number date birth specified fields make sure enter correct information retrieve accurate resultssubmit view results entering details, click submit view results button ap inter supply results displayed screendownload save want download save copy result, click download print button allow store result device take printout future reference | academic interests | 360 |
new delhi last date apply india post gds online form extended june , online application process gds recruitment opened june , interested candidates complete application process official website india post, indiapostgdsonlinegovinthe important dates recruitment process follows extended timelines registration submission online applications applying notified vacancies states divisions meghalaya, sikkim, tripura manipur june , last date apply candidates mentioned states divisions june , edit correction window open date june , edit correction window closing date june , eligible gds recruitment , candidates need fulfill certain criteria must citizen india minimum age years maximum age years last date application additionally, passed th standard examination recognized boardcandidates applying gds recruitment need pay application fee fee general obc candidates rs , sc st pwd transwomen candidates exempted paying feeit important interested candidates complete application process within given timeline ensure meet eligibility criteria india post gds recruitment offers promising opportunity individuals looking join postal department contribute nation postal servicesread official notice herehere steps apply online india post gds recruitment visit official website go official website india post gds recruitment indiapostgdsonlinegovinregistration click registration new user button provide required details name, date birth, mobile number, email address create unique username passwordfill application form log using credentials created previous step fill application form personal, educational, required details accuratelyupload documents scan upload necessary documents passport sized photograph, signature, educational certificates, specified documents prescribed formatpay application fee select payment option pay application fee per category rs general obc candidates, fee sc st pwd transwomen keep payment receipt future referencesubmit print application completing steps, review application form errors omissions satisfied, submit application take printout submitted application form records | academic interests | 423 |
jaipur rajasthan recorded lowest ever growth gross enrolment ratio ger higher education , phenomenon baffled experts plunged question ashok gehlot government claims state emerging education hub countryas per government data, latest growth rate lowest last years, enrolment data available , little , students added previous year tally lakh surfaced alarming situation first time, enrolment boys decreased despite state opened new colleges last one yearin absolute numbers, lakh students enrolled levels state , lakh experts say considering rise population state, average rise enrolment every year least around per report available website department higher education, general ews scheduled tribes st recorded negative growth respectively enrolment sc obc remained marginally respectively figures certainly alarming means many students passed class xii enrol obvious reason comes mind higher education institutes may failed attract another possible reason could students state may going states higher education, leaving vacuum state, said dev swaroop, former vc rajasthan university dr bhimrao ambedkar law university, jaipurswaroop point corroborated recently released national institutional ranking framework nirf report stating single state run university college rajasthan featured top countryhowever, one saving grace since , girls continue supersede boys terms enrolment state , lakh girls enrolled lakh boysan analysis growth figures last five years makes fall enrolment growth hard understand , growth rate following years , , government immediately call inquiry zero growth rate enrolments growth rate largely due upheaval caused covid pandemic situations favourable last year high growth rate, considering hope students dropped would join colleges, said kb kothari, former policy planner unicef new yorkthe number girls far ahead boys humanities slightly behind science commerce difference remains wide law stream , girls , boys | academic interests | 492 |
abvmu cpet admit card atal bihari vajpayee medical university abvmu , uttar pradesh, announced release paramedical admit card official website wwwabvmuupeduinto access admit card, candidates required log account using application number password logged in, easily download admit card clicking designated admit card linkthe abvmu paramedical entrance test cpet scheduled take place june , exam conducted two shifts, namely morning afternoon sessions, morning shift commencing afternoon shift pm computer based test cbt consists multiple choice questions, question carrying one mark total duration examination set minutesit important note cpet serves qualifying exam, determining eligibility candidates admission various paramedical courses offered university admit card holds crucial details candidate name, roll number, date birth, exam centre, reporting time candidates required carry admit card exam centre day examinationaspiring candidates advised promptly download admit cards make necessary preparations upcoming abvmu cpet results examination expected announced july , information updates, candidates encouraged visit official website atal bihari vajpayee medical university wwwabvmuupeduindirect link download abvmu cpet admit card download abvmu cpet admit card step visit official website atal bihari vajpayee medical university abvmu , uttar pradeshstep look admit card download admit card section homepagestep click link access admit card download pagestep log account using application number passwordstep logged in, locate admit card link click itstep abvmu cpet admit card displayed screen download save future referencenote make sure verify details mentioned admit card, including name, roll number, date birth, exam centre, reporting time case discrepancies, contact abvmu authorities necessary corrections examination date | academic interests | 400 |
pharmacology field science studies drugs interact living organisms, including humans focuses understanding effects, mechanisms, uses drugs, therapeutic harmful, order improve healthcare promote safe effective use medications let explore pharmacology simple termsdrugs effectspharmacology examines effects drugs body drugs substances used prevent, diagnose, treat, manage diseases, disorders, conditions produce various effects body, ranging relieving symptoms altering physiological processes example, painkillers, ibuprofen, reduce pain inflammation blocking certain chemicals bodydrug actions mechanismspharmacology investigates drugs work molecular, cellular, systemic levels explores mechanisms drugs interact specific targets body, receptors, enzymes, signaling pathways, produce effects example, antidepressants work increasing levels certain chemicals, serotonin, brain, help alleviate symptoms depressiontherapeutic uses applicationspharmacology studies therapeutic uses drugs applications treating various diseases conditions aims identify drugs effectively target specific disorders improve patient outcomes example antibiotics drugs used treat bacterial infections inhibiting growth killing bacteriadrug safety side effectspharmacology examines safety profiles drugs, including potential side effects adverse reactions seeks understand factors influence drug response individual variations drug metabolism efficacy example, common side effects antihistamines, used treat allergies, include drowsiness, dry mouth, blurred visionpharmacokinetics pharmacodynamicspharmacology investigates pharmacokinetics pharmacodynamics drugs pharmacokinetics deals drugs absorbed, distributed, metabolized, eliminated body pharmacodynamics explores drugs interact targets produce physiological response example, pharmacokinetics involves understanding body processes eliminates painkiller ingested pharmacodynamics focuses painkiller interacts specific receptors reduce paindrug development clinical trialspharmacology plays crucial role drug development involves designing conducting preclinical studies clinical trials assess safety efficacy new drugs approved use patients example, clinical trials conducted evaluate effectiveness safety new cancer medication treating patients specific types tumorsin summary, pharmacology science explores drugs interact living organisms encompasses effects, mechanisms, therapeutic uses, safety, development drugs pharmacologists contribute improving healthcare studying effects drugs, developing new medications, promoting safe effective use treatment diseases conditions content generated assistance artificial intelligence | academic interests | 470 |
new delhi since july last year nearly lakh adolescent girls age group years identified school scheme adolescent girls sag brought school system nationwide campaign kanya shiksha pravesh utsav launched ministry women child development ministry education march according official sources crore girls covered sag focused school girls per education ministry data number dropped lakh move verify school girls thereafter wcd ministry saw states reporting back fewer numbers dwindled lakh lakh final count number stood lakhwhile one level numbers reduced years many list mainstreamed, also points towards worrisome fact list probably ghost beneficiaries wrong entries made years inflating database review sought correct ensure benefits reach genuine beneficiaries, sources said ensure beneficiary verified database foolproof, government revamped scheme adolescent girls applicable years made aadhaar seeding mandatory inclusion beneficiaries seeded lakh lakh adolescent girls registered scheme covering girls across aspirational districts northeast, sources said revamped scheme covers school girls eligible adolescent girls nutrition requirements address problem intergenerational malnutritionthe government revised sag scheme shifted focus age group found scheme getting less less traction mainly success education system bringing girls age group mostly classes formal school system extend benefits compulsory education right education actthe scheme besides taking care nutritional needs girl monitoring weight height also ensure girl school explore possible linkages skiling | academic interests | 382 |
new delhi rethink proposed semester system multiple board exams making inclusion indian languages mandatory classes xi xii top agenda national steering committee meets bengaluru june finalise national curriculum framework ncf rss affiliated organisations raised concern non inclusion indian languages classes xi xii well leaving scope learning them, school boards expressed concern feasibility semester system modular approach multiple board exam proposals classes ix xii final document likely announced centre later monththe national steering committee expected specifically mention indian languages categories r r , instead keeping open ended like draft ncf, said students learn least three languages school years r , r , r r often commonly used local language, r could language, including english r language r r , saidmoreover, per draft ncf, students classes ix xii need complete two essential courses eight curricular areas curriculum design classes xi xii student must complete choice based courses complete grade eight curricular areas include humanities, social science, science, mathematics computing, arts, vocational education, sports, inter disciplinary areas however, languages clubbed literature philosophy curricular areas humanities senior official, part ncf exercise, said number organisations affiliated rss expressed discontent document silent indian languages operative parts moreover, languages put curricular areas humanities, easily skipped choosing essential courses national steering committee likely take call recommending make learning indian languages classes xi xii mandatory committee, headed former isro chief k kasturirangan, would also deliberate suggestions received experts, states school education boards regarding multiple board exams semester system higher classes draft ncf proposed semester structure, possible, classes ix x, classes xi xii, said phase secondary stage would divided semesters choice based course would semester draft also stated modular board examinations offered opposed single examination end year final certification based cumulative result examinations key areas teachers, schools, experts even education boards suggested rethinking, said official according senior cbse official, external annual exam still requirement cbse semester experiment success internal assessment atmosphere yet conducive india | academic interests | 492 |
india post gds recruitment india post scheduled reopen online application process recruitment candidates post gramin dak sevak north east division june interested candidates check eligibility details official website indiapostgdsonlinegovinthe extended timelines india post gds registration submission online applications available states divisions meghalaya, sikkim, tripura manipur application process regions states carried may june , recruitment drive, india post aims fill total vacancies post gramin dak sevakhow apply india post gds recruitment step go official website indiapostgdsonlinegovin step now, register generate login credentialsstep login using details fill application form step upload required documents pay application feestep download take hard copy future referenceapplication fee applicants must submit payment rs application fee however, certain exceptions fee requirement female applicants, sc st applicants, pwd applicants, transwomen applicants exempted paying fee | academic interests | 213 |
cg th, th compartmental exam chhattisgarh board secondary education cgbse released cgbse th, th supplementary exam date sheet candidates clear cg board exams , applied compartmental exams check download date sheet official website cgbsenicinthe cgbse th supplementary examination conducted july , th supplementary exam held july , chhattisgarh cgbse th supplementary examination datessubjectsjuly , first language hindi, hindi standard, hindi specialjuly , second language english standard, english specialjuly , mathematicsjuly , sciencejuly , vocational courses organised retailing, information technology, automobile service technician, health care, agriculture, media entertainment, telecommunication, banking financial services insurance bfsi , beauty wellness, electronics hardwarejuly , social sciencejuly , third language sanskrit, marathi, urdu, punjabi, sindhi, bengali, gujarati, telugu, tamil, malayalam, kannada, odiajuly , music blind students drawing painting mute deaf students chhattisgarh cgbse th supplementary examination datesname subjectsjuly , hindijuly , sanskritjuly , history, business studies, element maths science agriculture, drawing painting, food nutritionjuly , geography physicsjuly , political science, chemistry, accountancy, crop production horticulture, still life designing, physiology first aidjuly , sociologyjuly , second language englishjuly , maths, computer application arts commerce , indian music, drawing designing, dance art, stenotyping, agriculture arts , home science arts , anatomy, physiology hygiene, commercial mathematics, industrialisationjuly , biology, economics, elements animal husbandry poultry farming, history india art, elements sciencejuly , marathi, urdu, punjabi, sindhi, bengali, gujarati, telugu, tamil, malayalam, kannada, oriyajuly , psychology | academic interests | 283 |
indore mahatma gandhi memorial medical college authorities decided restore year old building king edward medical kem school library medical studentsthe kem school located campus medical college proposal restore hanging balance many yearsbut medical college authorities prepared detailed project report restoration building turning library authorities decided spend around rs cr workthe kem school established mgm came existence , around century later kem school example french gothic style architecture, even famous hogwarts among city youth kem school building symbol heritage development medical education indore one oldest medical schools country would soon restore bring mystique, mgm dean dr sanjay dixit said planned start library may also use part building museum main aim maintain preserve building, dr dixit said dpr prepared, medical college would spend rupees one crore it, dr dixit addedthe proposal develop kem school made past restore structure including one developing caf single proposal sees light dayfurther, medical college also develops sports facilities students also prepared plan develop tracks, badminton courts, sports facilities students ground behind kem school, dr dixit added | academic interests | 282 |
rpsc senior teacher answer key rajasthan public service commission rpsc released answer key grade ii gk exam candidates took examination check download answer keys official website rpscrajasthangovinthe recruitment exams senior teacher group c conducted january , rpsc senior teacher grade ii gk group c answer keys available official portal pdf format also, candidates satisfied provisional answer key may raise objections june , upon payment rs per question challengeddirect link answer key sr teacher gr ii exam group c gk direct link answer key sr teacher gr ii exam group gk check rpsc senior teacher grade answer keystep visit official website ssorajasthangovinstep homepage, click news events sectionstep new page open, click link reads, model answer key sr teacher gr ii comp exam group c gk step pdf answer key displayed screenstep download take printout future reference | academic interests | 216 |
secondary school dropout rate , official data revealed secondary school dropout rate several states exceeded national average per cent gujarat, bihar, karnataka, assam, punjab among seven states dropout rate secondary level higher findings collated project approval board pab meetings held ministry education discuss implementation samagra shiksha program , took place march may yearthe government considers dropout rates hindrance achieving objectives outlined national education policy, particularly aim attaining per cent gross enrolment rate ger school level detailed minutes pab meetings indicate specific dropout rates different states instance, bihar dropout rate per cent, gujarat per cent, assam per cent, andhra pradesh per cent, punjab per cent, meghalaya per cent, karnataka per cent secondary level west bengal demonstrated improvement dropout rates elementary level , noted continuous efforts needed reduce dropout rate improve retention secondary level one documents highlighted presence numerous school children delhi, emphasizing need upload details mainstreamed school children prabandh portalin madhya pradesh, data indicated decline secondary level dropout rate per cent per cent state special enrollment drive focused household survey, conducted help mobile app, contributed positive change similarly, maharashtra witnessed decrease annual average dropout rate secondary level per cent per cent however, certain districts state still reported dropout rates per cent abovethe collated data revealed uttar pradesh faced high annual average dropout rate several districts, including basti per cent , budaun per cent , etawah per cent , ghazipur per cent , etah per cent , mahoba per cent , hardoi per cent , azamgarh per cent rajasthan, overall dropout rate decreasing, dropout rate among scheduled tribes nine per cent muslim children per cent secondary level remained significantly high, noted documentsthese statistics align survey conducted united nations children fund unicef previous year, found per cent girls india drop school due domestic work additionally, observed many children leave school end working labourers families engaging household cleaning tasks addressing dropout challenges vital ensure inclusive quality education children country inputs pti | academic interests | 493 |
tjee tripura board joint entrance examination declared tjee result today, june pm candidates appeared examination check download result official website tbjeenicintripura tjee conducted april , three shifts pm physics chemistry , pm pm biology pm pm mathematics counselling process tentatively scheduled conducted june july tjee check result tbjeenicin tripuragovin tbresultstripuragovindirect link tbjee resulthow download tbjee resultstep visit official website tbjeenicinstep homepage, click tripura tjee result linkstep key registration number date birthstep tjee result displayed screenstep download take hardcopy future referencetbjee counselling documents required admit card madhyamik examination equivalent birth certificate proof age admit card hs stage examination equivalent examination certificate concerned institution proof appearing hs stage examination marksheet hs stage equivalent examination b madhyamik equivalent examination prtc citizenship certificate certificates proof residency applicant father mother appropriate authority, one applicable caste sc st certificate candidate appropriate authority applicable persons disabilities pwd certificate issued district disabilities rehabilitation centres ddrc competent authority approved state government, ward ex serviceman certificate directorate sainik welfare bpl ration card appropriate authority applicable certificate regarding period stay candidate father mother less five years case wards ex serviceman serving defence personnel, issued appropriate authority, necessary certificate showing proof serving defence personnel, issued appropriate authority necessary seat surrendered certificate concerned department, applicable | academic interests | 342 |
new delhi national testing agency, nta expected announce neet ug result june however, official confirmation testing agency regard neet ug conducted may , examination centres located cities throughout country total , , candidates appeared medical entrance examinationnta issued neet ug answer key june candidates satisfied provisional answer key option raise objections same, any, till june now, national testing agency set declare final answer key result examining challenges received studentsafter declaration result, candidates follow mentioned steps check download neet ug result check neet ug result step visit official website neetntanicinstep homepage, click neet ug result linkstep new page appear, enter application number date birthstep neet ug result displayed screenstep download take printout future referenceneet ug result last year performancelast year, total , , candidates registered neet exam, , , appeared examas many , , candidates qualified neet ug , posting pass percentage | academic interests | 248 |
new delhi nest admit card issued today, june pm candidates registered national entrance screening test nest able check download admit card official website nestexaminas per notification official website nest, admit card entrance test released june pm nest examination conducted june , , result announced july , direct link nest admit card announcement hall ticket, candidates follow step step process given download nest hall ticket download nest admit card step visit official website nestexaminstep homepage, click nest admit card linkstep new page open, enter login credentialsstep nest admit card displayed screenstep download take printout future referenceabout nest national entrance screening test nest compulsory test students seeking admission national institute science education research niser , bhubaneswar university mumbai department atomic energy centre excellence basic sciences um dae cebs , mumbai niser um dae cebs set department atomic energy, government india candidates admitted programme niser, cebs, eligible receive annual scholarship rs , disha program department atomic energy, government india addition, scholarship recipients receive grant rs , per annum summer internship | academic interests | 284 |
new delhi central board secondary education cbse released evaluation verification results classes th th today, june , students satisfied marks cbse class , exams check evaluation verification results official cbse websitestudents, applied evaluation verification answer sheets, check results official website cbse, resultscbsenicin evaluation process allows students request review answer sheets ensure accurate marking assessment provides opportunity students challenge potential errors discrepancies initial evaluation verification process, hand, involves confirming totalling marks ensuring answers evaluatedto check evaluation results, students need visit official website cbse navigate relevant section class th class th required enter roll number, school number, centre number, admit card id submitting necessary details, students view evaluation resultscentral board secondary education monday released evaluation verification lot results classes th th official website resultscbsenicin class xii evaluation verification lot result class x evaluation verification lot result cbse results classes announced may , pass percentage class , pass percentage class overall pass percentage classes steps check cbse evaluation verification results step visit official website central board secondary education cbse resultscbsenicin step look evaluation verification results section website homepagestep click link provided access results pagestep select relevant class, whether class th class thstep enter roll number, school number, centre number, admit card id respective fieldsstep entering required details, click submit check result button view cbse evaluation verification results | academic interests | 367 |
ap ecet hall ticket jawaharlal nehru technological university monday released hall tickets ap ecet today official website ap ecet exam scheduled take place june , candidates note hall ticket available official website andhra pradesh state council higher education apsche cetsapscheapgovin download hall tickets, candidates need provide registration number date birth crucial hall ticket serves entry pass examination hall candidates must keep handy throughout exam processap ecet, also known andhra pradesh engineering common entrance test, conducted facilitate admissions second year btech bpharmacy courses offered universities aicte pci approved institutions andhra pradesh exam overseen jntu kakinada behalf apschethe ap ecet computer based test cbt consisting multiple choice questions questions divided three sections mathematics, physics, chemistry, questions exam duration hours, providing candidates ample time complete testsuccessfully passing ap ecet prerequisite diploma holders engineering technology pharmacy bsc graduates aim secure admission lateral entry scheme second year btech bpharmacy courses andhra pradeshas competitive exam, ap ecet admission cutoff varies annually, considering factors seat availability, number test takers, candidate performancedirect link download ap ecet hall ticket steps download ap ecet hall ticket step visit official website andhra pradesh state council higher education apsche cetsapscheapgovin step look ap ecet section homepage click itstep redirected ap ecet page find click download hall ticket similar linkstep new page open, need enter registration number date birth specified fieldsstep double check information entered click submit download buttonstep ap ecet hall ticket displayed screen review details carefully, name, exam centre, timingsstep finally, click download print button save copy hall ticket advisable take printout future reference carry exam centre day examination | academic interests | 429 |
new delhi national testing agency, nta released cuet pg admit card exams conducted june candidates registered central university entrance test cuet post graduate pg programmes download hall ticket official website cuetntanicinthe candidates scheduled appear june download admit card cuet pg using application date birth official portal candidates received admit card dates get subsequent phases candidates could accommodated phase examination due chosen subject combinations, would accommodated later test would rescheduled due course, reads official noticedirect link cuet pg admit card download cuet pg admit cardstep visit official website cuetntanicinstep homepage, click link reads, cuet pg admit card step new page open, key application number date birthstep hall ticket displayed screenstep download take printout admit card future referencecandidates difficulty downloading checking examination city intimation slip admit card cuet pg , write e mail cuet pg ntaacin may contact | academic interests | 242 |
ts edcet results mahatma gandhi university, nalgonda monday released ts edcet results year , official website candidates, took examination, check download results online official website edcettscheacin candidate login initial expectation results announced third week june, authorities advanced date, bringing much excitement among candidates stay updated latest developments, aspiring candidates visit official website, edcettscheacinthe telangana state education common entrance test ts edcet serves state level entrance examination students aspiring pursue bed courses telangana ts edcet examination held may , exam conducted three sessions first session took place am, followed second session pm pm, third session pm pmonce results published, candidates access online entering hall ticket number rank higher scores ts edcet increase likelihood obtaining seat prestigious institutionas clock ticks towards much anticipated result announcement, candidates advised keep close eye official website updates direct link official websitehere steps check download result visit official website go official website ts edcet, edcettscheacin, using web browserlocate result section look results result tab website homepage click proceedenter details find appropriate link ts edcet result enter hall ticket number rank provided fieldssubmit verify entering details, click submit check result button double check information accuracyview result system processes request, result displayed screen take note score rankdownload result download copy result, look download button icon usually located near result display click save result pdf file deviceremember keep printout digital copy result future reference admission purposes required, make sure follow additional instructions provided website regarding result download admission procedures | academic interests | 412 |
union public service commission upsc declared result civil services preliminary examination official website preliminary examination conducted may , , result published pdf file, featuring roll numbers qualified candidates civil services main examination important note candidature candidates provisional, per examination rules, need reapply detailed application form daf civil services main examination commission announce dates provide important instructions filling submitting daf website due coursecandidates advised regularly check commission website updates marks, cut marks, answer keys civil services preliminary examination however, details made available entire process civil services examination complete, including declaration final resultto address queries seek clarification regarding examination result, union public service commission established facilitation counter premises dholpur house, shahjahan road, new delhi candidates visit counter person contact provided telephone numbers working hoursdirect link check download upsc prelims result steps check upsc pre results visit official website go official website upsc entering wwwupscgovin web browsernavigate results section look results examination tab homepage click access results pagefind relevant examination look specific examination notification related result seeking upsc conducts various exams, make sure locate correct oneclick result link find relevant examination, click provided result link usually form pdf filedownload view result result open new window download automatically choose view directly website download offline accesscheck roll number result file, search roll number registration number qualified candidates listed along respective roll numbers | academic interests | 384 |
patna response prevailing heatwave high temperatures posing risks health safety children, district magistrate patna, dr chandra shekhar singh, issued order extend summer vacations private government schools, including pre schools anganwadi centres, patna district class xii june , order, enacted section code criminal procedure, , aims protect well studentseffective today, ie, june , , order comes force remain effect june , dr chandra shekhar singh, capacity district magistrate, issued order june , , signature seal courtthe decision extend summer vacations based genuine concern health lives children patna heatwave soaring temperatures prevailing district present significant risks, prompting district magistrate take preventive measuresby temporarily suspending academic activities, authorities aim mitigate potential dangers posed extreme weather conditions measure prioritizes well safety students, ensuring protection period intense heatparents, guardians, school administrators urged adhere order cooperate authorities ensuring welfare students essential monitor official announcements updates district magistrate office developments changes schedule | academic interests | 247 |
state common entrance test cell, maharashtra monday announced mht cet result pcm pcb groups official website candidates appeared mht cet check results official website mahacet mahacetorg, mhtcet mahacetorg, cetcellmahacetorgthe maharashtra state common entrance test mht cet results pcm pcb groups released official website links check results also activatedcandidates appeared exam check results logging mht cet account using application number date birth results available pdf format contain following details subject wise scoresrankpercentile scorethe mht cet conducted two phases pcm group mht cet took place may may , , pcb group mht cet took place may may , total lakh students registered mht cet direct link view mht cet pcm group score carddirect link view mht cet pcb group score cardthe results released phased manner results pcm group released first, followed results pcb groupthe results groups, biotechnology group, released sooncandidates satisfied scores apply evaluation process evaluation process begin june , mht cet state level entrance exam admission undergraduate engineering pharmacy courses government private colleges maharashtra exam conducted state common entrance test cell, maharashtrathe mht cet result important milestone students aspiring pursue career engineering pharmacy results help students assess performance plan studies accordinglyhere tips students appeared mht cet check results carefully make sure errorsif satisfied results, apply evaluationstart preparing counselling process counselling process start declaration final resultkeep abreast latest updates mht cet counselling process visiting official website mahacet following official social media handles mahacetdirect link check mht cet result steps check mht cet result online step go official website mahacet mahacetorg, mhtcet mahacetorg, cetcellmahacetorgstep click result tabstep enter application number date birthstep click submit buttonstep result displayed screenstep download print result future reference | academic interests | 477 |
telangana schools commenced reopening today, monday, june , , per original schedule academic calendars shared parents clearly indicated reopening date schools hyderabad regions statehowever, amidst reopening buzz, misleading circular circulating social media platforms like whatsapp circular falsely claims telangana government extended summer vacation due heavy rains unfavourable weather conditions state dated june , , fake circular states summer break extended june , circular evidently fake, significant rainfall events state yet moreover, several schools confirmed following original schedule reopening june upon closer inspection, fonts circular appear manipulated, possibly attempt make appear authentic discrepancies raise doubts credibility circulating circularit crucial parents students rely official communication respective schools authorized government sources accurate information regarding school reopening related updates dissemination false information lead confusion unnecessary disruptions academic routine | academic interests | 204 |
ranchi jharkhand government announced shutting schools three days june wake heat wave conditions prevailing state, official said sunday order issued secretary school education literacy department k ravi kumar, said keeping view extreme heat heat wave conditions state, categories government, non government aided non aided including minority private schools operating state remain closed june june weather department said situation might remain least next five days heat wave alerts issued parts state till june maximum temperature hovering degree celsius across state possibility light rain, mainly eastern parts state but, would hardly help bringing temperature, said ranchi meteorological centre charge abhishek anand | academic interests | 165 |
rajouri simran bala, hailing border town nowshera jammu kashmir, become first girl union territory year crack union public service commission upsc central armed police forces capf examinationshe secured india rank among candidates qualified upsc capf year girl jammu kashmir crack examination year feel proud grateful border area jammu kashmir, seen cross border firing region, motivated join capf serve border area well, simran bala told ani dream fulfilled appointed assistant commandant central armed police forces fulfill duty full zeal family neighbours proud success, addedspeaking journey, bala said, studied till class following went jammu higher secondary education completed graduation gandhinagar last semester started preparing exam cleared it, god grace first attempt parents, teachers many people supported hard work, perseverance consistency helped approach towards exam, saidspeaking unique achievement said, india level examination matter whether border area metropolitan city able crack exam thanks age internet aspirants, message was, got you, able crack need hard work, honest approach good health union public service commission announced capf final result june total candidates cleared examination | academic interests | 321 |
biochemistry branch science focuses chemical processes substances occur within living organisms combines principles biology chemistry understand chemical reactions molecules involved various biological systems let explore biochemistry simple termslife chemical building blocksbiochemistry studies molecules make living organisms, including proteins, carbohydrates, lipids fats , nucleic acids dna, rna , biomolecules molecules play essential roles structure, function, regulation cells organisms example proteins crucial biomolecules serve enzymes, transporters, antibodies, structural components cells tissuesmetabolism energybiochemistry investigates chemical reactions involved metabolism, process organisms obtain energy food use sustain life explores molecules transformed, broken down, synthesized produce energy build complex substances example cellular respiration biochemically mediated process converts glucose sugar energy form atp adenosine triphosphate enzymes catalysisenzymes proteins act catalysts, accelerating chemical reactions living organisms biochemistry examines structure, function, regulation enzymes, facilitate regulate biological reactions example digestive enzymes, amylase, protease, lipase, break food smaller molecules digestiondna genetic informationbiochemistry explores structure function nucleic acids, particularly dna deoxyribonucleic acid rna ribonucleic acid investigates genetic information stored, replicated, expressed, providing basis inheritance synthesis proteins example dna carries genetic code determines organism traits, eye color, height, susceptibility certain diseasesbiotechnology medical applicationsbiochemistry plays crucial role biotechnology, utilized produce valuable substances, develop new drugs, understand diseases molecular level contributes advancements medicine, genetic engineering, development diagnostics therapies example insulin, hormone used manage diabetes, produced recombinant dna technology, biochemically driven processin summary, biochemistry explores chemical processes molecules underlie life examines building blocks living organisms, metabolism energy production, enzymes, genetic information, applications biotechnology medicine understanding biochemistry, scientists gain insights intricate chemical workings life apply knowledge various fields improve human health understand natural world content generated assistance artificial intelligence | academic interests | 407 |
tamil nadu schools reopen tamil nadu schools commenced reopening today summer break per revised schedule, classes th th resumed, classes st th reopen june , decision delay reopening date based chief minister mk stalin directive protect students hot weather prevailing various parts state minister school education, anbil mahesh poyyamozhi, emphasized importance ensuring student safetyoriginally, schools slated reopen june , however, concerns high temperatures weather conditions prompted school education department revise schedule initially, classes vi xii supposed start june , classes v resuming june following recent announcement, chief educational officers districts, including chennai chengalpattu, issued circulars instructing schools, whether government, aided, private, adhere specified reopening dates strict measures put place ensure compliance, district level officials monitoring situation taking necessary actionsin chengalpattu district, schools explicitly instructed conduct special classes senior school students prior official reopening dates, violations would met departmental consequencesas schools reopen tamil nadu, government remains committed prioritizing student welfare maintaining safe learning environment amidst challenging weather conditions | academic interests | 230 |
state government andhra pradesh announced schools conducting half day classes june , period, schools operate am, according academic calendar released state school education departmentto mark beginning academic year june , , government made arrangements distribute jagan anna vidya devena kits students attending government schools reopening day however, decision resume classes faced opposition parents, student associations, political parties, state commission protection children scpc concerns raised regarding prevailing heatwave conditions across state various groups requested government postpone reopening schools end june nara lokesh, general secretary tdp party, emphasized early reopening may increase risk heat strokes among children, urging government reconsider reopen schools third week junedespite concerns, schools serving ragi malt mid day meals students half day classes worth noting summer vacation commenced may , additionally, government decided introduce byju content intermediate schools byju s, online education platform offering video tutorials educational resources, aims enhance quality education intermediate levelthe government acknowledged concerns hot weather june stated closely monitor weather conditions make decision regarding possible extension summer vacation necessary | academic interests | 265 |
vijayawada schools across state set reopen monday, education department asked parents cautious choosing school children education authorities said proper recognition mandatory school function, urged parents inform schools running illegally, without recognitionthe department issues recognition schools inspecting campus ensuring faculty infrastructure schools help children get quality education students unrecognised schools considered private candidates board examinationsdespite strict enforcement, schools functioning without proper recognitionthese schools trying attract parents offering huge concessions fees promising iit neet foundation classes education department told parents fall prey campaigns conducted unrecognised schools school function without recognition every school strictly follow state cbse curriculum per recognition parents cautious enrolling children schools initiate stringent action register cases schools functioning without proper recognition, said ntr district education officer renuka | academic interests | 187 |
vadodara scramble admissions medical institutions abroad within country begin neet results outbut, meantime, perceptible shift among gujarati students towards georgia preferred choice medical education countries, including china philippines owing stringent foreign medical graduate licentiate regulations fmglr set national medical commission nmc also problems china ukrainegeorgia made efforts invite indian students various events organized different parts countryto eligible practice india, nmc laid stringent criteria medical graduates foreign institutes key conditions include duration course months, internship minimum months institute also instruction english mediumthe fmglr states graduates first eligible practice country graduated, eligible practice india counsellors also said georgia, also countries like russia, belarus others emerged alternativesmed colleges georgia comply nmc rules however, preference georgia higher medical colleges accreditations affiliations like world federation medical education wfme institutes also comply nmc guidelines regarding practice india students become eligible take test get registered medical practitioner indiatalking shift choice, consultants pointed besides ukraine war covid china, new regulations played important role decision making institutes philippines offered course shorter duration graduates courses could even practice philippines said prominent medical education abroad counsellor achal shah vadodarahe added china mandates test mbbs graduates mandarin language eligibility practice china gujarati students found extremely difficultahmedabad based consultant paresh vaghela said cost medical education abroad much lower private medical colleges india graduate georgia appear usmle exam, unlike countries colleges georgia also try make foreign students comfortable georgian language education english, students need learn local language communicate patients, vaghela explainedkunjal pathak, parent vadodara, already interacted consultants exploring possibility medical education georgia daughter decide neet results study abroad, prefer georgia advantages too, like indian students already well availability indian food, etc, said | academic interests | 465 |
rajasthan high court announced final result recruitment junior judicial assistant, junior assistant, clerk posts result available official website court, hcrajnicin hcraj total vacancies advertised posts written examination conducted march , merit prepared considering total aggregate marks obtained candidates written test typewriting test computer speed efficiency test selected candidates advised appear personally verification documents document verification conducted office registrar examination , rajasthan high court, new building, dangiyawas bypass, jodhpur rajasthan june , , july , candidates selected must submit online institute wise district judgeship wise preferences appointment june , june , pm link preferences available official website court may noted that, failing institution district judgeship appointment shall allotted high courtthe statement marks candidates shall uploaded official website court, separatelydirect link check download rajasthan hc ldc result check download rajasthan high court ldc result online official website, follow steps step go official website rajasthan high court hcrajnicin hcraj step click recruitment tabstep recruitment , click ldc result linkstep new page open result click download button step result displayed screenstep download result clicking download button | academic interests | 292 |
bihar stet commerce result bihar school examination board bseb released secondary teacher eligibility test stet commerce result official website, secondarybiharboardonlinecom candidates check results logging user id passwordthe stet commerce exam conducted march , , candidates want teach commerce subjects government schools bihar exam conducted two parts, paper paper ii paper th th grades, paper ii th th gradesthe result stet commerce exam available bseb website pdf format check result, need enter user id password logged in, able see overall score, well scores paperthe stet commerce exam qualifying exam, candidates pass exam eligible apply teaching jobs government schools bihar results exam valid period three yearsthe following steps check bihar stet commerce result step go bseb website, secondarybiharboardonlinecomstep click result tabstep click stet commerce result linkstep enter user id passwordstep click submit buttonstep result displayed screen | academic interests | 238 |
new delhi university school law legal studies uslls guru gobind singh indraprastha university ggsipu organized two day moot court competition school students competition first kind organized indian universitythe competition held uslls campus dwarka, delhi open students class xi xii schools delhi national capital region ncr total teams participated competitionthe moot court competition organized criminal justice research cell cjrc uslls collaboration university pretoria, south africa, kathmandu school law, global campus human rights cjrc research teaching unit uslls focuses criminal justice issuesthe moot court competition based hypothetical case involving issue horizontal domicile reservation education institutions students required prepare written submissions memorials present oral arguments front panel judgesthe judges moot court competition eminent jurists, including judges delhi high court sessions district court competition also attended vice chancellor ggsipu, padma shri prof dr mahesh verma, dean uslls, prof queeny pradhan, dignitariesthe team nk bagrodia school, rohini emerged winner, team prabhu dayal, shalimar bagh runner event concluded distribution several awards accolades best speaker, best researcher, best memorial, best mentor, best teamthe moot court competition great success provided platform school students learn legal system develop critical thinking, research, advocacy skills competition also helped bridge gap school students law studentsthe organizers competition expressed gratitude participants, judges, dignitaries support also thanked cjrc hard work organizing eventthe moot court competition significant event history uslls landmark event remembered years come | academic interests | 365 |
research centre imarat rci , premier laboratory defence research development organisation drdo , invited applications engagement apprentices graduate, diploma iti period one yearthe application fee rs graduate apprentices, rs diploma apprentices, rs iti trade apprentices application form submitted online till june , following eligibility criteria various categories apprenticeships graduate apprentice candidates bachelor degree discipline recognized universitydiploma apprentice candidates diploma discipline recognized polytechniciti trade apprentice candidates national trade certificate ntc national vocational certificate nvc trade recognized industrial training institute iti selection process based written test interviewthe following benefits apprentice rci stipend apprentices receive monthly stipend rs , graduate apprentices, rs , diploma apprentices, rs , iti trade apprenticesaccommodation rci provide accommodation apprentices campusmedical facilities rci provide medical facilities apprentices health centrestransport rci provide transport apprentices place workto apply apprenticeship rci, candidates visit rci website wwwrcilabin download application form application form submitted online postthe following documents need submitted along application form photo id proofeducational certificatesexperience certificates caste certificate applicable physically challenged certificate applicable steps apply online research centre imarat rci apprenticeship step visit rci website wwwrcilabinstep click careers tabstep click apprenticeship linkstep click apply online buttonstep create account sign already accountstep fill application formstep upload required documentsstep pay application feestep click submit buttondirect link apply onlinedirect link download drdo rci apprenticeship advertisement | academic interests | 355 |
indo tibetan border police itbp released notification recruitment head constable midwife posts online application process open close july , unreserved category largest, vacancies obc category vacancies, followed sc category vacancies, st category vacancies, ews category vacanciesinterested eligible candidates apply online official website itbpolicenicin eligible itbp head constable midwife recruitment, candidates must years old, passed th standard science stream, meet itbp physical standards experience requiredthe itbp head constable midwife selection process consist written test, physical test, medical test, interview candidates shortlisted based performance stagesthe final selection based candidate performance stages selection processthe itbp head constable midwife salary rs , , per month job profile includes providing medical care itbp personnel families conducting health education programsto apply itbp head constable midwife recruitment, candidates visit itbp website fill online application form application fee rs general category candidates rs sc st pwd candidatesthe itbp head constable midwife great opportunity healthcare professionals looking challenging rewarding career indian security forceshere benefits working itbp head constable midwife competitive salary benefitsstable secure jobopportunities career growth developmentchance serve countryread official notification herehow apply itbp head constable midwife online official websitestep go itbp website itbpolicenicin step click recruitment tabstep click itbp head constable midwife linkstep read eligibility criteria carefullystep click apply online buttonstep fill application form submit | academic interests | 340 |
new delhi iiser aptitude test admit card released official website institute candidates download admit cards official website indian institutes science education research iiser iiseradmissionin admit card mandatory appearing examthe iiser aptitude test conducted june , exam conducted two shifts, morning afternoon morning shift start afternoon shift start pmthe exam pen paper based exam question paper consist objective type questions question carry marks total marks exam candidates advised carefully check admit card errors errors found, contact iiser immediatelythe following details would mentioned iiser admit card name candidateregistration numberdate birthexam centrereporting timeinstructions appearing examthe admit card important document candidates must carry admit card along exam centre without admit card, candidates allowed appear examhere important things keep mind appearing iiser aptitude test arrive exam centre least minutes start examcarry admit card valid photo iddo bring electronic devices, cell phones, calculators, laptops, exam hallfollow instructions invigilatorsdirect link download iiser admit card aptitude test download admit card, follow steps step go official website iiserstep click iiser aptitude test admit card linkstep enter registration number date birthstep click submit buttonstep admit card displayed screenstep download print admit card future referencestep admit card contains following information | academic interests | 338 |
new delhi last date apply india post gds online form today, june , application process online completed official website india postto apply india post gds online form , need create account fill application form also need upload scanned copies educational certificates required documentsthe application fee india post gds online form rs general obc candidates rs sc st, pwd transgender candidatesthe exam india post gds online form conducted august , exam computer based test cbt consist questions duration exam minutesthe results india post gds online form announced september , selected candidates appointed gramin dak sevaks gds various post offices across indiadownload official notification herethe following eligibility criteria india post gds online form candidate citizen indiathe candidate passed th class examination recognized boardthe candidate valid domicile certificate state applyingthe candidate physically fit major disabilitythe candidate criminal recordthe following important dates india post gds online form india post gds online form important datess noeventdate starting date applicationmay , last date applicationjune , date examaugust , tentative date result announcementseptember , tentative india post gds recruitment direct link registrationindia post gds recruitment direct link login windowhow apply india post gds recruitment step visit official website indiapostgdsonlinegovinstep homepage, register generate login detailsstep login using credentials fill application formstep upload required documents pay application formstep download take printout future reference | academic interests | 362 |
new delhi indian institute technology guwahati iitg released jee advanced answer key official website candidates, took joint entrance examination advanced , check download provisional answer key official website jeeadvacinas answer key released, candidates satisfied provisional answer key, raise objections june june , , till pmthe iit guwahati conducted jee advanced examination june , two shifts first shift examination conducted noon second shift exam held pm pmas per schedule, jee advanced final answer key results displayed official website june , , amfor additional information, candidates suggested check official iit jee advanced websitestudents follow steps given download iit jee advanced provisional answer key click direct link provided go page link activated answer keydirect link download jee advanced answer key download jee advanced answer key visit official website go official website jee advanced jeeadvacin log credentials use login credentials jee advanced registration number, date birth, password log accountfind answer key download link look answer kwy download link website displayed prominently homepage also notifications sectionclick answer key download link click answer key download link proceed download itprint save admit card downloading answer key, take printout | academic interests | 309 |
new delhi bihar iti cat admit card released bihar combined entrance competitive examination board bceceb official website candidates download admit cards official website bihar combined entrance competitive examination board bceceb bceceboardbihargovin admit card mandatory appearing examthe admit card contains following information name candidateregistration numberdate birthexam centrereporting timeinstructions appearing examcandidates advised carefully check admit card errors errors found, contact bceceb immediatelythe bihar iti cat conducted june , exam conducted two shifts, morning afternoon morning shift start afternoon shift start pmthe exam pen paper based exam question paper consist objective type questions question carry marks total marks exam admit card important document candidates must carry admit card along exam center without admit card, candidates allowed appear examto download admit card, follow steps step go official website bceceb bceceboardbihargovin step click iti cat admit card linkstep enter registration number date birthstep click submit buttonstep admit card displayed screenstep download print admit card future reference | academic interests | 263 |
visakhapatnam india emerged third largest global start ecosystem third highest number unicorns, said department science technology secretary dr chandrasekhar india developing country less country innovations, technological development, research work, manufacturing, etc, saiddelivering convocation address gitam deemed university chief guest visakhapatnam saturday, dr chandrasekhar said homo sapiens abused planet juncture, need think going make planet sustainable, healthy, affordable covid pandemic origins bats delivers message keep close watch health animals majority recent pandemics passed humans animals ongoing lab studies rapamycin found medication increase human lifespan factors point immediate need making processes green making planet sustainable, said dr chandrasekharthe university bestowed honorary doctorates india light combat aircraft tejas chief designer dr kota harinarayana noted telugu veteran actress vanisridr kota harinarayana asked graduating students afraid failures failing early leaves room learning failures moving next phase, said harinarayanaexplaining nearly five decade journey movie industry, vanisri asked students plant least saplings year make planet green take care educational needs children health people less advantaged backgrounds, said vanisria total , undergraduate postgraduate students research scholars received degrees convocation university also presented gold medals students exemplary performance academicsgitam chancellor dr virander singh chauhan presided convocation gitam vice chancellor prof dayananda siddavattam presented annual report gitam president sribharath, vice president prof gangadhara rao, secretary bharadwaja, registrar dr gunasekaran, pro vice chancellors, deans, research scholars, faculty members participated convocation ceremony | academic interests | 358 |
nashik mumbai police commissioner vivek phansalkar said traffic education relentless process point one breaks traffic rulesphansalkar nashik saturday attend programme organised nashik first organisation children traffic education park mark feat completing training lakh citizensnashik first providing traffic education school students, citizens, others general since , aim motorists knew traffic rules aware repercussions breaking them, road accidents deaths involved would automatically come thousands people die road accidents state every year, mainly adhere traffic rules sole responsibility enforcement agencies make people follow traffic rules also need put across point serious ailment treated overcome, fatal accidents simply give opportunity following traffic rules save lives, said phansalkarhe also said motorists streets attached organisations, police rto tap organisations ask ensure zero tolerance breaking traffic rules employees, could make huge differencevijay patil, add cp, maharashtra anti corruption bureau, also present programme spoke length traffic awareness programmes conducted city tenure | academic interests | 248 |
mangaluru mangaluru city north mla bharath shetty bjp reacted sharply minister it,bt rural development panchayat raj priyank kharge, questioned qualification yuva brigade founder chakravarty sulibele kharge friday questioned inclusion sulibele article school textbook minister, questioning qualification sulibele, sought know whether right wing orator got phd subjectthe bjp mla saturday tweeted twitter handle bharathshetty y, questioning kharge statements also made reference qualification minister priyankkharge, asked astitvam sulibele whether completed phd engineering graduate, resourceful person dedicated service nation phd never prerequisite writer heading bt ministry puc qualification shetty tweeted tweet also evoked response netizens, took minister shetty task prashanth kumar prashantgv replied, dna matters congress ability meanwhile, ar uchila ar uchila wrote show engineering certificate qualification modi irani | academic interests | 188 |
coimbatore man drove , km across states union territories braving rain, bad roads inclement weather, span days hours creating awareness education girl child lakh raised donated coimbatore corporation build classrooms toilets girls government schools coimbatoremeet coimbatore based businessman, cyclist fitness enthusiast g vishnu raam, entered guinness book records becoming fastest indian cover four corners country expedition raise awareness girl child education flagged chennai may k shankar, adgp law order ramya bharati, joint commissioner police, north chennaiafter arduous drive chennai tezu leh koteshwar kanyakumari chennai, expedition concluded june despite rough roads durgapur siliguri, first leg expedition chennai tezu completed hours minutes, drove continuously hours highway chandigarh bhuj, covering , km surpassed previous record , km day, vishnu raam addedafter completing trip, raam met j meghanatha reddy, member secretary, sports development authority tamil nadu, handed guinness record certificate | academic interests | 224 |
inorganic chemistry branch chemistry focuses study non living matter, specifically compounds contain carbon hydrogen c h bonds investigates properties, structure, composition, reactions inorganic compounds, include minerals, metals, nonmetals, respective compounds let explore inorganic chemistry simple termscarbon inorganic chemistryinorganic chemistry primarily deals compounds involve carbon atoms bonded hydrogen atoms c h bonds compounds known inorganic compounds contrast, organic chemistry focuses study compounds contain carbon hydrogen bonds forexample, sodium chloride nacl , commonly known table salt, inorganic compound consists sodium na chlorine cl atoms contain carbon hydrogen bondstypes inorganic compoundsinorganic compounds encompass wide range substances, including minerals, metals, nonmetals, salts, acids, bases, transition metal complexes example iron oxide fe , also known rust, inorganic compound formed reaction iron fe oxygen properties reactionsinorganic compounds exhibit diverse properties undergo various reactions compounds different physical states solid, liquid, gas possess distinct colors, conductivity, solubility, reactivity example hydrochloric acid hcl inorganic compound strong acid highly corrosive reacts certain metals, producing hydrogen gas metal chlorideapplicationsinorganic chemistry finds numerous practical applications various fields, including materials science, medicine, environmental science, energy production, electronics example, silicon si , inorganic element, widely used semiconductor industry produce computer chips electronic devicesin summary, inorganic chemistry study non living matter compounds contain carbon hydrogen bonds explores properties, reactions, applications inorganic compounds, include minerals, metals, nonmetals, respective compounds understanding inorganic chemistry, scientists develop new materials, explore industrial processes, gain insights behavior non living matter content generated assistance artificial intelligence | academic interests | 330 |
new delhi directorate technical education, himachal pradesh released hp pat counselling schedule today, june candidates attend counselling process diploma engineering, lateral entry engineering, diploma pharmacy courses check schedule official website hptechboardcomthe himachal pradesh polytechnic admission test result released june candidates passed hp pat note dates mentioned counselling scheduleas per schedule, candidates submit documents fill choices course college june june , , diploma engineering, june june , , lateral entry diploma engineering, june june , , diploma pharmacyhow check hp pat counselling schedulestep visit official website hptechboardcomstep homepage, click link available hp pat counselling dates step new pdf file open screenstep check counselling dates note downstep download save use hp pat counselling schedule eventsdatesrelease application form filling submission college institute choicesjune , sports certificate verificationjune , communication sports credits cdacjune , round seat allotmentjuly , round reporting certification verificationon july , round vacancy list releasejuly , submission new applications revision choices based vacant seats, availablejuly , round seat allotmentjuly , round reporting certification verificationon july , round vacancy list updation principalsjuly , round display vacant seats second roundjuly , centralized round gov polytechnic sundernagarfor candidates pat score july , eligible candidates based pat score august , candidates th scores august , round vacancy list releaseaugust , release vacancy seats round centralized counsellingaugust , details additional information, candidates advised keep check official website | academic interests | 367 |
new delhi indian institute technology guwahati iitg set release jee advanced answer key tomorrow, june students appeared joint entrance examination advanced able download provisional answer key official website jeeadvacinthe jee advanced provisional answer keys displayed online tomorrow official portalafter release answer key, candidates satisfied provisional answer key given two days time raise objections june june , , till pmstudents follow steps given download iit jee advanced provisional answer key click direct link provided go page link activated answer keyhow download jee advanced answer key step visit official website jeeadvacinstep homepage, click link displayed jee advanced answer keystep new webpage open, enter login details registration number date birthstep jee advanced answer key displayed screenstep download take printout usedirect link download answer keyas per schedule, jee advanced final answer key results displayed official website june , , additional information, candidates suggested check official iit jee advanced website | academic interests | 255 |
pearl dsouzabengaluru compared past year six students, year, four students bengaluru top ranks comed k examination results announced saturday rank one secured nandha gopi krishna sarjapur, student dps bengaluru eastother rank holders city siddarth pamidi banashankari rank , arjun b dikshit sanjaynagar rank , manish h parashar rr nagar rank others top ranks included two haryana kerala, one from, andra pradesh, karnataka mysuru respectivelycomedk announced first rank holders karnatakapercentile score considered announcing ranks many , candidates percentilethe test held centers cities across country , students attempting examination , karnataka , non karnataka , per comedkprovisional answer keys published may candidates challenged answer keys final answer keys june comedk counseling would conducted online candidates must upload scanned copies documents loginrank cards eligible candidates generated available candidates applicant login comedk website wwwcomedkorg | academic interests | 221 |
new delhi delhi university give admission students phd courses common university entrance test phd conducted national testing agency nta upcoming academic year, officials said friday first time delhi university permit admission phd courses common test written tests interviewsthe decision taken executive council meeting, battery resolutions approved, including year llb course phd admission done basis cuet phd based recommendation standing committee academic council, deliberations various matters related admission attendance undergraduate, postgraduate, phd programmes academic session , also accepted executive council ec , statement university saiddu began taking admission ug courses via cuet ug admitting students pg courses via cuet pgthe entrance test cuet phd conducted nta however, individuals employed teaching non teaching posts within university eligible participate interviews directly, confirmed officials teaching non teaching staff may permitted attend classes take examinations without affecting duties assigned office hours rules phd applicable academic session , added addition this, academic session eligibility criteria seat allocation recommendations undergraduate courses mbbs bds medical science courses admission committee mcac approved ec meeting furthermore, admission respiratory therapy program msc also conducted cuet pg inputs pti | academic interests | 282 |
new delhi consortium medical, engineering, dental colleges karnataka announced comedk result today, june candidates appeared graduate entrance test uget check download comedk uget result official website comedkorgthe comedk uget conducted may , , two sessions examination held physics, chemistry, mathematics included multiple choice questions mcqs results announced today comedk uget answer key released may final answer key entrance exam released june , also check check comedk uget result help comedk uget scorecard, students selected admission engineering programmes participating collegescandidates follow step step process given download comedk uget result click direct link shared belowhow download comedk result step visit official website comedkorgstep go candidate login windowstep enter login details application sequence number user id passwordstep comedk uget scorecard displayed screenstep download get printout referencedirect link download scorecardalong comedk results, comedk cut , ranks, counselling dates also announcedfor details, candidates advised check official website | academic interests | 246 |
bhubaneswar iit bhubaneswar planning set centre excellence coe laboratory grown diamonds union education minister dharmendra pradhan said tweet reviewing physical infrastructure, research projects, academic programmes measures faculty development national higher educational institutions friday heartening know iit bhubaneswar intends augment existing experimental facilities establish two pioneering centres, one materials characterization, processing manufacturing coe laboratory grown diamonds, said pradhanhe said facilities expand research development r innovation profile iit bhubaneswar, strengthen innovation research material sciences, boost industry academia linkages, aid development critical technologies, encourage entrepreneurship, boost employment make india self reliant frontier areasofficial sources said institute collaborate iit alumnus grow diamonds laboratory project sanctioned, centre set up, said official iit bhubaneswarhe inaugurated virtual augmented reality coe iit bhubaneswar coe accelerate digital transformation across disciplines, invigorate application driven research well boost entrepreneurshippradhan said augmented reality ar virtual reality vr transform education, healthcare, architecture among others encouraged iit bhubaneswar keep pace changing aspirations new india also localise innovations solutionshe interacted newly recruited faculties encouraged instil social responsibilities young minds also prepare become global citizens line tenets national education policy nep encouraged iit bhubaneswar staff undertake massive plantation drive july year making campus green sustainablehe reviewed progress works, research aspects iit bhubaneswar, iim sambalpur, nit rourkela, central university odisha, koraput iiser berhampur | academic interests | 301 |
new delhi national testing agency nta released cuet pg exam city intimation slip today, june exam city slip issued examination going conducted june around , candidates, appear common university entrance test postgraduate date download slip official website cuetntanicinthe city notification slip nta cuet pg provides information regarding examination date, exam shift, chosen subjects test papers online application form, designated examination citycity intimation slip admit cards candidates whose exams set june , , , , , , , , already issued ntacandidates refer mentioned step step process download exam city intimation sliphow download cuet pg exam city slip step visit official website nta cuet pg cuetntanicinstep click link cuet pg exam city slip displayed homepagestep enter application number, date birth, passwordstep cuet city slip appear screenstep download save usedirect link download exam city slip candidates advised check download examination city intimation slip cuet pg using application date birth go instructions contained therein well information bulletin, reads official notificationfor additional information, candidates advised check official website | academic interests | 260 |
indore khargone district administration suspended accountant posted school education department allegedly withdrawing salary claiming benefits meant government teachers acting inputs state treasury department alleged financial irregularities, launched probe found charge accountant rajesh kumar gupta posted education office kasrawad development block guilty fraudulently claimed around rs crore, khargone collector shivraj singh verma said accountant suspended instruction issued lodge fir per probe, gupta claimed salary guest teachers along hra, salary arrears benefits processing double duplicate bills fraudulent means accountant claimed amount using bank accounts family members acquaintances investigation still going on, also trying recover amount accountant claimed fraudulent means, saidstate treasury commissioner dnyaneshwar b patil said department using indicators random sampling payments districts financial intelligence cell working upon suspected cases approaching local administration concerned agencies analysis data identified suspected payments districts verification saidthe scam came heels crop loss compensation fraud rs crore dewas treasury bill scam rs crore indore | academic interests | 237 |
new delhi dissociating ncert political science textbooks, suhas palshikar yogendra yadav, chief advisers books subject class ix xii, said rationalisation exercise mutilated books beyond recognition never consulted even informed changesasking national council educational research training drop names chief advisers political science textbooks, palshikar yadav friday said feel embarrassed names mentioned chief advisers mutilated academically dysfunctional textbooks rationalisation syllabus initiated ncert response covid disruption changes made part rationalisation exercise notified, controversial deletions mentioned led allegations bid delete portions surreptitiously cou ncil countered omissions possible oversight refused undo deletions, saying based recommendations experts also said textbooks anyway headed revision national curriculum framework kicks however, ncert later said minor changes need notified letter ncert director inesh saklani, palshikar yadav said modifications justified name rationalisation, fail see pedagogic rationale work find text mutilated beyond recognition innumerable irrational cuts large deletions without attempts fill gaps created n ever consulted even informed changes ncert consult experts deciding cuts deletions, explicitly state fully disagree regard text books cannot shaped blatantly partisan manner quell spirit critique questioning among students social sciences thesebooks serve purpose training students political science, letter said | academic interests | 349 |
ph measure acidic basic solution plays crucial role regulating chemical reactions occur body ph scale ranges , considered neutral, values acidic, values basic let explore ph affects chemical reactions body simple termsph acidsacids substances release hydrogen ions h dissolved water ph value less higher concentration hydrogen ions, acidic solution example, stomach acid highly acidic, ph around , aiding digestion foodph basesbases, also known alkaline substances, opposite acids release hydroxide ions oh dissolved water bases ph value greater higher concentration hydroxide ions, basic solution example, baking soda sodium bicarbonate common household base used baking ph around ph enzymesenzymes proteins catalyze chemical reactions body play vital role various biological processes enzymes specific ph ranges work efficiently example, digestive enzymes small intestine function optimally slightly basic ph around ph protein structureproteins, essential many bodily functions, specific structure influenced ph extreme ph levels disrupt protein structure, leading denaturation loss function example, changes ph affect structure enzymes, rendering inactive impairing ability facilitate chemical reactionsph cell functionmaintaining appropriate ph crucial cells function properly cells specific ph requirements processes nutrient uptake, waste removal, energy production example blood tightly regulated ph around significant deviations range disrupt cellular processes lead health issuesph acid base balancethe body mechanisms maintain stable ph balance, known acid base homeostasis buffer systems, involving substances absorb release hydrogen ions, help regulate ph prevent drastic changes example bicarbonate buffer system blood helps maintain ph within narrow range necessary normal physiological functionin summary, ph plays critical role chemical reactions within body affects enzyme activity, protein structure, cellular functions maintaining appropriate ph balance essential optimal bodily functions overall health content generated assistance artificial intelligence | academic interests | 433 |
panaji access audit educational institutions goa office sate commissioner persons disabilities held july onwards school audited teachers staff interviewed understand unique needs, strengths weaknesses making education accessible interventions physical space, learning tools learning aids devices technology, state commissioner persons disabilities, guruprasad pawaskar told toi initiative conduct access audit educational institutions state aims align educational institutes national education policy nep provisions outlined rights persons disability act, changes expected brought following audit accessible pathways, ramps, railings, accessible toilets, tactile paths, braille multilingual tactile signs teacher training programs also recommended audit report sensitize teachers representatives office state commission persons disabilities empanelled agency visit institutions due course time regard, heads educational institutions goa directed extend full cooperation representatives office state commission persons disabilities empanelled agency, circular issued earlier director education, shailesh sinai zindge read | academic interests | 220 |
Subsets and Splits
No community queries yet
The top public SQL queries from the community will appear here once available.