contestId
int64 0
1.01k
| index
stringclasses 57
values | name
stringlengths 2
58
| type
stringclasses 2
values | rating
int64 0
3.5k
| tags
listlengths 0
11
| title
stringclasses 522
values | time-limit
stringclasses 8
values | memory-limit
stringclasses 8
values | problem-description
stringlengths 0
7.15k
| input-specification
stringlengths 0
2.05k
| output-specification
stringlengths 0
1.5k
| demo-input
listlengths 0
7
| demo-output
listlengths 0
7
| note
stringlengths 0
5.24k
| points
float64 0
425k
| test_cases
listlengths 0
402
| creationTimeSeconds
int64 1.37B
1.7B
| relativeTimeSeconds
int64 8
2.15B
| programmingLanguage
stringclasses 3
values | verdict
stringclasses 14
values | testset
stringclasses 12
values | passedTestCount
int64 0
1k
| timeConsumedMillis
int64 0
15k
| memoryConsumedBytes
int64 0
805M
| code
stringlengths 3
65.5k
| prompt
stringlengths 262
8.2k
| response
stringlengths 17
65.5k
| score
float64 -1
3.99
|
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
69 |
A
|
Young Physicist
|
PROGRAMMING
| 1,000 |
[
"implementation",
"math"
] |
A. Young Physicist
|
2
|
256
|
A guy named Vasya attends the final grade of a high school. One day Vasya decided to watch a match of his favorite hockey team. And, as the boy loves hockey very much, even more than physics, he forgot to do the homework. Specifically, he forgot to complete his physics tasks. Next day the teacher got very angry at Vasya and decided to teach him a lesson. He gave the lazy student a seemingly easy task: You are given an idle body in space and the forces that affect it. The body can be considered as a material point with coordinates (0; 0; 0). Vasya had only to answer whether it is in equilibrium. "Piece of cake" — thought Vasya, we need only to check if the sum of all vectors is equal to 0. So, Vasya began to solve the problem. But later it turned out that there can be lots and lots of these forces, and Vasya can not cope without your help. Help him. Write a program that determines whether a body is idle or is moving by the given vectors of forces.
|
The first line contains a positive integer *n* (1<=≤<=*n*<=≤<=100), then follow *n* lines containing three integers each: the *x**i* coordinate, the *y**i* coordinate and the *z**i* coordinate of the force vector, applied to the body (<=-<=100<=≤<=*x**i*,<=*y**i*,<=*z**i*<=≤<=100).
|
Print the word "YES" if the body is in equilibrium, or the word "NO" if it is not.
|
[
"3\n4 1 7\n-2 4 -1\n1 -5 -3\n",
"3\n3 -1 7\n-5 2 -4\n2 -1 -3\n"
] |
[
"NO",
"YES"
] |
none
| 500 |
[
{
"input": "3\n4 1 7\n-2 4 -1\n1 -5 -3",
"output": "NO"
},
{
"input": "3\n3 -1 7\n-5 2 -4\n2 -1 -3",
"output": "YES"
},
{
"input": "10\n21 32 -46\n43 -35 21\n42 2 -50\n22 40 20\n-27 -9 38\n-4 1 1\n-40 6 -31\n-13 -2 34\n-21 34 -12\n-32 -29 41",
"output": "NO"
},
{
"input": "10\n25 -33 43\n-27 -42 28\n-35 -20 19\n41 -42 -1\n49 -39 -4\n-49 -22 7\n-19 29 41\n8 -27 -43\n8 34 9\n-11 -3 33",
"output": "NO"
},
{
"input": "10\n-6 21 18\n20 -11 -8\n37 -11 41\n-5 8 33\n29 23 32\n30 -33 -11\n39 -49 -36\n28 34 -49\n22 29 -34\n-18 -6 7",
"output": "NO"
},
{
"input": "10\n47 -2 -27\n0 26 -14\n5 -12 33\n2 18 3\n45 -30 -49\n4 -18 8\n-46 -44 -41\n-22 -10 -40\n-35 -21 26\n33 20 38",
"output": "NO"
},
{
"input": "13\n-3 -36 -46\n-11 -50 37\n42 -11 -15\n9 42 44\n-29 -12 24\n3 9 -40\n-35 13 50\n14 43 18\n-13 8 24\n-48 -15 10\n50 9 -50\n21 0 -50\n0 0 -6",
"output": "YES"
},
{
"input": "14\n43 23 17\n4 17 44\n5 -5 -16\n-43 -7 -6\n47 -48 12\n50 47 -45\n2 14 43\n37 -30 15\n4 -17 -11\n17 9 -45\n-50 -3 -8\n-50 0 0\n-50 0 0\n-16 0 0",
"output": "YES"
},
{
"input": "13\n29 49 -11\n38 -11 -20\n25 1 -40\n-11 28 11\n23 -19 1\n45 -41 -17\n-3 0 -19\n-13 -33 49\n-30 0 28\n34 17 45\n-50 9 -27\n-50 0 0\n-37 0 0",
"output": "YES"
},
{
"input": "12\n3 28 -35\n-32 -44 -17\n9 -25 -6\n-42 -22 20\n-19 15 38\n-21 38 48\n-1 -37 -28\n-10 -13 -50\n-5 21 29\n34 28 50\n50 11 -49\n34 0 0",
"output": "YES"
},
{
"input": "37\n-64 -79 26\n-22 59 93\n-5 39 -12\n77 -9 76\n55 -86 57\n83 100 -97\n-70 94 84\n-14 46 -94\n26 72 35\n14 78 -62\n17 82 92\n-57 11 91\n23 15 92\n-80 -1 1\n12 39 18\n-23 -99 -75\n-34 50 19\n-39 84 -7\n45 -30 -39\n-60 49 37\n45 -16 -72\n33 -51 -56\n-48 28 5\n97 91 88\n45 -82 -11\n-21 -15 -90\n-53 73 -26\n-74 85 -90\n-40 23 38\n100 -13 49\n32 -100 -100\n0 -100 -70\n0 -100 0\n0 -100 0\n0 -100 0\n0 -100 0\n0 -37 0",
"output": "YES"
},
{
"input": "4\n68 3 100\n68 21 -100\n-100 -24 0\n-36 0 0",
"output": "YES"
},
{
"input": "33\n-1 -46 -12\n45 -16 -21\n-11 45 -21\n-60 -42 -93\n-22 -45 93\n37 96 85\n-76 26 83\n-4 9 55\n7 -52 -9\n66 8 -85\n-100 -54 11\n-29 59 74\n-24 12 2\n-56 81 85\n-92 69 -52\n-26 -97 91\n54 59 -51\n58 21 -57\n7 68 56\n-47 -20 -51\n-59 77 -13\n-85 27 91\n79 60 -56\n66 -80 5\n21 -99 42\n-31 -29 98\n66 93 76\n-49 45 61\n100 -100 -100\n100 -100 -100\n66 -75 -100\n0 0 -100\n0 0 -87",
"output": "YES"
},
{
"input": "3\n1 2 3\n3 2 1\n0 0 0",
"output": "NO"
},
{
"input": "2\n5 -23 12\n0 0 0",
"output": "NO"
},
{
"input": "1\n0 0 0",
"output": "YES"
},
{
"input": "1\n1 -2 0",
"output": "NO"
},
{
"input": "2\n-23 77 -86\n23 -77 86",
"output": "YES"
},
{
"input": "26\n86 7 20\n-57 -64 39\n-45 6 -93\n-44 -21 100\n-11 -49 21\n73 -71 -80\n-2 -89 56\n-65 -2 7\n5 14 84\n57 41 13\n-12 69 54\n40 -25 27\n-17 -59 0\n64 -91 -30\n-53 9 42\n-54 -8 14\n-35 82 27\n-48 -59 -80\n88 70 79\n94 57 97\n44 63 25\n84 -90 -40\n-100 100 -100\n-92 100 -100\n0 10 -100\n0 0 -82",
"output": "YES"
},
{
"input": "42\n11 27 92\n-18 -56 -57\n1 71 81\n33 -92 30\n82 83 49\n-87 -61 -1\n-49 45 49\n73 26 15\n-22 22 -77\n29 -93 87\n-68 44 -90\n-4 -84 20\n85 67 -6\n-39 26 77\n-28 -64 20\n65 -97 24\n-72 -39 51\n35 -75 -91\n39 -44 -8\n-25 -27 -57\n91 8 -46\n-98 -94 56\n94 -60 59\n-9 -95 18\n-53 -37 98\n-8 -94 -84\n-52 55 60\n15 -14 37\n65 -43 -25\n94 12 66\n-8 -19 -83\n29 81 -78\n-58 57 33\n24 86 -84\n-53 32 -88\n-14 7 3\n89 97 -53\n-5 -28 -91\n-100 100 -6\n-84 100 0\n0 100 0\n0 70 0",
"output": "YES"
},
{
"input": "3\n96 49 -12\n2 -66 28\n-98 17 -16",
"output": "YES"
},
{
"input": "5\n70 -46 86\n-100 94 24\n-27 63 -63\n57 -100 -47\n0 -11 0",
"output": "YES"
},
{
"input": "18\n-86 -28 70\n-31 -89 42\n31 -48 -55\n95 -17 -43\n24 -95 -85\n-21 -14 31\n68 -18 81\n13 31 60\n-15 28 99\n-42 15 9\n28 -61 -62\n-16 71 29\n-28 75 -48\n-77 -67 36\n-100 83 89\n100 100 -100\n57 34 -100\n0 0 -53",
"output": "YES"
},
{
"input": "44\n52 -54 -29\n-82 -5 -94\n-54 43 43\n91 16 71\n7 80 -91\n3 15 29\n-99 -6 -77\n-3 -77 -64\n73 67 34\n25 -10 -18\n-29 91 63\n-72 86 -16\n-68 85 -81\n-3 36 44\n-74 -14 -80\n34 -96 -97\n-76 -78 -33\n-24 44 -58\n98 12 77\n95 -63 -6\n-51 3 -90\n-92 -10 72\n7 3 -68\n57 -53 71\n29 57 -48\n35 -60 10\n79 -70 -61\n-20 77 55\n-86 -15 -35\n84 -88 -18\n100 -42 77\n-20 46 8\n-41 -43 -65\n38 -98 -23\n-100 65 45\n-7 -91 -63\n46 88 -85\n48 59 100\n0 0 100\n0 0 100\n0 0 100\n0 0 100\n0 0 100\n0 0 1",
"output": "YES"
},
{
"input": "18\n-14 -64 -91\n-8 -66 -86\n-23 92 -40\n6 -3 -53\n57 41 78\n-79 42 -22\n-88 -17 45\n4 -45 44\n83 -18 -25\n34 86 -92\n75 -30 12\n44 99 11\n-67 -13 72\n22 83 -56\n-37 71 72\n-9 -100 100\n0 -100 31\n0 -58 0",
"output": "YES"
},
{
"input": "23\n-70 37 78\n42 84 6\n28 -94 -24\n-49 76 95\n-67 18 84\n-53 78 -5\n65 -63 -64\n-66 -64 -69\n81 -93 95\n10 52 -79\n-89 -61 -64\n-64 -47 43\n-81 -35 55\n80 82 73\n-60 -81 -18\n49 -10 -19\n-58 70 12\n-24 -15 -93\n98 -93 -54\n-28 -75 11\n100 100 -63\n100 100 0\n56 34 0",
"output": "YES"
},
{
"input": "3\n0 2 -2\n1 -1 3\n-3 0 0",
"output": "NO"
}
] | 1,668,265,434 | 2,147,483,647 |
Python 3
|
WRONG_ANSWER
|
TESTS
| 80 | 92 | 0 |
t = int(input())
a = 0
b = 0
c = 0
for i in range(t):
x = input().split()
a += int(x[0])
b += int(x[1])
c += int(x[2])
if a+b+c == 0:
print("YES")
else :
print("NO")
|
Title: Young Physicist
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
A guy named Vasya attends the final grade of a high school. One day Vasya decided to watch a match of his favorite hockey team. And, as the boy loves hockey very much, even more than physics, he forgot to do the homework. Specifically, he forgot to complete his physics tasks. Next day the teacher got very angry at Vasya and decided to teach him a lesson. He gave the lazy student a seemingly easy task: You are given an idle body in space and the forces that affect it. The body can be considered as a material point with coordinates (0; 0; 0). Vasya had only to answer whether it is in equilibrium. "Piece of cake" — thought Vasya, we need only to check if the sum of all vectors is equal to 0. So, Vasya began to solve the problem. But later it turned out that there can be lots and lots of these forces, and Vasya can not cope without your help. Help him. Write a program that determines whether a body is idle or is moving by the given vectors of forces.
Input Specification:
The first line contains a positive integer *n* (1<=≤<=*n*<=≤<=100), then follow *n* lines containing three integers each: the *x**i* coordinate, the *y**i* coordinate and the *z**i* coordinate of the force vector, applied to the body (<=-<=100<=≤<=*x**i*,<=*y**i*,<=*z**i*<=≤<=100).
Output Specification:
Print the word "YES" if the body is in equilibrium, or the word "NO" if it is not.
Demo Input:
['3\n4 1 7\n-2 4 -1\n1 -5 -3\n', '3\n3 -1 7\n-5 2 -4\n2 -1 -3\n']
Demo Output:
['NO', 'YES']
Note:
none
|
```python
t = int(input())
a = 0
b = 0
c = 0
for i in range(t):
x = input().split()
a += int(x[0])
b += int(x[1])
c += int(x[2])
if a+b+c == 0:
print("YES")
else :
print("NO")
```
| 0 |
828 |
A
|
Restaurant Tables
|
PROGRAMMING
| 1,200 |
[
"implementation"
] | null | null |
In a small restaurant there are *a* tables for one person and *b* tables for two persons.
It it known that *n* groups of people come today, each consisting of one or two people.
If a group consist of one person, it is seated at a vacant one-seater table. If there are none of them, it is seated at a vacant two-seater table. If there are none of them, it is seated at a two-seater table occupied by single person. If there are still none of them, the restaurant denies service to this group.
If a group consist of two people, it is seated at a vacant two-seater table. If there are none of them, the restaurant denies service to this group.
You are given a chronological order of groups coming. You are to determine the total number of people the restaurant denies service to.
|
The first line contains three integers *n*, *a* and *b* (1<=≤<=*n*<=≤<=2·105, 1<=≤<=*a*,<=*b*<=≤<=2·105) — the number of groups coming to the restaurant, the number of one-seater and the number of two-seater tables.
The second line contains a sequence of integers *t*1,<=*t*2,<=...,<=*t**n* (1<=≤<=*t**i*<=≤<=2) — the description of clients in chronological order. If *t**i* is equal to one, then the *i*-th group consists of one person, otherwise the *i*-th group consists of two people.
|
Print the total number of people the restaurant denies service to.
|
[
"4 1 2\n1 2 1 1\n",
"4 1 1\n1 1 2 1\n"
] |
[
"0\n",
"2\n"
] |
In the first example the first group consists of one person, it is seated at a vacant one-seater table. The next group occupies a whole two-seater table. The third group consists of one person, it occupies one place at the remaining two-seater table. The fourth group consists of one person, he is seated at the remaining seat at the two-seater table. Thus, all clients are served.
In the second example the first group consists of one person, it is seated at the vacant one-seater table. The next group consists of one person, it occupies one place at the two-seater table. It's impossible to seat the next group of two people, so the restaurant denies service to them. The fourth group consists of one person, he is seated at the remaining seat at the two-seater table. Thus, the restaurant denies service to 2 clients.
| 500 |
[
{
"input": "4 1 2\n1 2 1 1",
"output": "0"
},
{
"input": "4 1 1\n1 1 2 1",
"output": "2"
},
{
"input": "1 1 1\n1",
"output": "0"
},
{
"input": "2 1 2\n2 2",
"output": "0"
},
{
"input": "5 1 3\n1 2 2 2 1",
"output": "1"
},
{
"input": "7 6 1\n1 1 1 1 1 1 1",
"output": "0"
},
{
"input": "10 2 1\n2 1 2 2 2 2 1 2 1 2",
"output": "13"
},
{
"input": "20 4 3\n2 2 2 2 2 2 2 2 1 2 1 1 2 2 1 2 2 2 1 2",
"output": "25"
},
{
"input": "1 1 1\n1",
"output": "0"
},
{
"input": "1 1 1\n2",
"output": "0"
},
{
"input": "1 200000 200000\n2",
"output": "0"
},
{
"input": "30 10 10\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 2 2 2 2 2 2 2 2 2 2",
"output": "20"
},
{
"input": "4 1 2\n1 1 1 2",
"output": "2"
},
{
"input": "6 2 3\n1 2 1 1 1 2",
"output": "2"
},
{
"input": "6 1 4\n1 1 1 1 1 2",
"output": "2"
},
{
"input": "6 1 3\n1 1 1 1 2 2",
"output": "4"
},
{
"input": "6 1 3\n1 1 1 1 1 2",
"output": "2"
},
{
"input": "6 4 2\n2 1 2 2 1 1",
"output": "2"
},
{
"input": "3 10 1\n2 2 2",
"output": "4"
},
{
"input": "5 1 3\n1 1 1 1 2",
"output": "2"
},
{
"input": "5 2 2\n1 1 1 1 2",
"output": "2"
},
{
"input": "15 5 5\n1 1 1 1 1 1 1 1 1 1 2 2 2 2 2",
"output": "10"
},
{
"input": "5 1 2\n1 1 1 1 1",
"output": "0"
},
{
"input": "3 6 1\n2 2 2",
"output": "4"
},
{
"input": "5 3 3\n2 2 2 2 2",
"output": "4"
},
{
"input": "8 3 3\n1 1 1 1 1 1 2 2",
"output": "4"
},
{
"input": "5 1 2\n1 1 1 2 1",
"output": "2"
},
{
"input": "6 1 4\n1 2 2 1 2 2",
"output": "2"
},
{
"input": "2 1 1\n2 2",
"output": "2"
},
{
"input": "2 2 1\n2 2",
"output": "2"
},
{
"input": "5 8 1\n2 2 2 2 2",
"output": "8"
},
{
"input": "3 1 4\n1 1 2",
"output": "0"
},
{
"input": "7 1 5\n1 1 1 1 1 1 2",
"output": "2"
},
{
"input": "6 1 3\n1 1 1 2 1 1",
"output": "0"
},
{
"input": "6 1 2\n1 1 1 2 2 2",
"output": "6"
},
{
"input": "8 1 4\n2 1 1 1 2 2 2 2",
"output": "6"
},
{
"input": "4 2 3\n2 2 2 2",
"output": "2"
},
{
"input": "3 1 1\n1 1 2",
"output": "2"
},
{
"input": "5 1 1\n2 2 2 2 2",
"output": "8"
},
{
"input": "10 1 5\n1 1 1 1 1 2 2 2 2 2",
"output": "8"
},
{
"input": "5 1 2\n1 1 1 2 2",
"output": "4"
},
{
"input": "4 1 1\n1 1 2 2",
"output": "4"
},
{
"input": "7 1 2\n1 1 1 1 1 1 1",
"output": "2"
},
{
"input": "5 1 4\n2 2 2 2 2",
"output": "2"
},
{
"input": "6 2 3\n1 1 1 1 2 2",
"output": "2"
},
{
"input": "5 2 2\n2 1 2 1 2",
"output": "2"
},
{
"input": "4 6 1\n2 2 2 2",
"output": "6"
},
{
"input": "6 1 4\n1 1 2 1 1 2",
"output": "2"
},
{
"input": "7 1 3\n1 1 1 1 2 2 2",
"output": "6"
},
{
"input": "4 1 2\n1 1 2 2",
"output": "2"
},
{
"input": "3 1 2\n1 1 2",
"output": "0"
},
{
"input": "6 1 3\n1 2 1 1 2 1",
"output": "2"
},
{
"input": "6 1 3\n1 1 1 2 2 2",
"output": "4"
},
{
"input": "10 2 2\n1 1 1 1 2 2 2 2 2 2",
"output": "12"
},
{
"input": "10 1 4\n1 1 1 1 1 2 2 2 2 2",
"output": "10"
},
{
"input": "3 10 2\n2 2 2",
"output": "2"
},
{
"input": "4 3 1\n1 2 2 2",
"output": "4"
},
{
"input": "7 1 4\n1 1 1 1 1 2 2",
"output": "4"
},
{
"input": "3 4 1\n2 2 2",
"output": "4"
},
{
"input": "4 1 2\n2 1 1 2",
"output": "2"
},
{
"input": "10 1 2\n1 1 1 1 1 1 1 1 1 2",
"output": "6"
},
{
"input": "5 1 3\n1 1 2 1 2",
"output": "2"
},
{
"input": "6 1 3\n1 1 1 1 2 1",
"output": "2"
},
{
"input": "6 1 4\n1 1 1 2 2 2",
"output": "2"
},
{
"input": "7 1 2\n1 2 1 1 1 1 1",
"output": "3"
},
{
"input": "6 2 2\n1 1 1 1 1 1",
"output": "0"
},
{
"input": "6 1 2\n1 1 2 1 1 1",
"output": "2"
},
{
"input": "3 3 1\n2 2 1",
"output": "2"
},
{
"input": "8 4 2\n1 1 1 1 1 1 1 2",
"output": "2"
},
{
"input": "9 1 4\n1 1 1 1 1 2 2 2 2",
"output": "8"
},
{
"input": "5 10 1\n2 2 2 2 2",
"output": "8"
},
{
"input": "3 5 1\n2 2 2",
"output": "4"
},
{
"input": "5 100 1\n2 2 2 2 2",
"output": "8"
},
{
"input": "4 1 2\n1 1 1 1",
"output": "0"
},
{
"input": "4 1 1\n1 1 1 1",
"output": "1"
},
{
"input": "7 2 2\n1 1 1 1 1 1 1",
"output": "1"
}
] | 1,597,848,964 | 2,147,483,647 |
Python 3
|
OK
|
TESTS
| 97 | 187 | 4,300,800 |
n, a, b = map(int, input().split())
ls = list(map(int, input().split()))
cnt = 0
ba = 0
for i in ls:
if i == 2:
if b > 0:
b -= 1
else:
cnt += 2
else:
if a > 0:
a -= 1
else:
if b > 0:
b -= 1
ba += 1
elif ba > 0:
ba -= 1
else:
cnt += 1
print(cnt)
|
Title: Restaurant Tables
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
In a small restaurant there are *a* tables for one person and *b* tables for two persons.
It it known that *n* groups of people come today, each consisting of one or two people.
If a group consist of one person, it is seated at a vacant one-seater table. If there are none of them, it is seated at a vacant two-seater table. If there are none of them, it is seated at a two-seater table occupied by single person. If there are still none of them, the restaurant denies service to this group.
If a group consist of two people, it is seated at a vacant two-seater table. If there are none of them, the restaurant denies service to this group.
You are given a chronological order of groups coming. You are to determine the total number of people the restaurant denies service to.
Input Specification:
The first line contains three integers *n*, *a* and *b* (1<=≤<=*n*<=≤<=2·105, 1<=≤<=*a*,<=*b*<=≤<=2·105) — the number of groups coming to the restaurant, the number of one-seater and the number of two-seater tables.
The second line contains a sequence of integers *t*1,<=*t*2,<=...,<=*t**n* (1<=≤<=*t**i*<=≤<=2) — the description of clients in chronological order. If *t**i* is equal to one, then the *i*-th group consists of one person, otherwise the *i*-th group consists of two people.
Output Specification:
Print the total number of people the restaurant denies service to.
Demo Input:
['4 1 2\n1 2 1 1\n', '4 1 1\n1 1 2 1\n']
Demo Output:
['0\n', '2\n']
Note:
In the first example the first group consists of one person, it is seated at a vacant one-seater table. The next group occupies a whole two-seater table. The third group consists of one person, it occupies one place at the remaining two-seater table. The fourth group consists of one person, he is seated at the remaining seat at the two-seater table. Thus, all clients are served.
In the second example the first group consists of one person, it is seated at the vacant one-seater table. The next group consists of one person, it occupies one place at the two-seater table. It's impossible to seat the next group of two people, so the restaurant denies service to them. The fourth group consists of one person, he is seated at the remaining seat at the two-seater table. Thus, the restaurant denies service to 2 clients.
|
```python
n, a, b = map(int, input().split())
ls = list(map(int, input().split()))
cnt = 0
ba = 0
for i in ls:
if i == 2:
if b > 0:
b -= 1
else:
cnt += 2
else:
if a > 0:
a -= 1
else:
if b > 0:
b -= 1
ba += 1
elif ba > 0:
ba -= 1
else:
cnt += 1
print(cnt)
```
| 3 |
|
377 |
A
|
Maze
|
PROGRAMMING
| 1,600 |
[
"dfs and similar"
] | null | null |
Pavel loves grid mazes. A grid maze is an *n*<=×<=*m* rectangle maze where each cell is either empty, or is a wall. You can go from one cell to another only if both cells are empty and have a common side.
Pavel drew a grid maze with all empty cells forming a connected area. That is, you can go from any empty cell to any other one. Pavel doesn't like it when his maze has too little walls. He wants to turn exactly *k* empty cells into walls so that all the remaining cells still formed a connected area. Help him.
|
The first line contains three integers *n*, *m*, *k* (1<=≤<=*n*,<=*m*<=≤<=500, 0<=≤<=*k*<=<<=*s*), where *n* and *m* are the maze's height and width, correspondingly, *k* is the number of walls Pavel wants to add and letter *s* represents the number of empty cells in the original maze.
Each of the next *n* lines contains *m* characters. They describe the original maze. If a character on a line equals ".", then the corresponding cell is empty and if the character equals "#", then the cell is a wall.
|
Print *n* lines containing *m* characters each: the new maze that fits Pavel's requirements. Mark the empty cells that you transformed into walls as "X", the other cells must be left without changes (that is, "." and "#").
It is guaranteed that a solution exists. If there are multiple solutions you can output any of them.
|
[
"3 4 2\n#..#\n..#.\n#...\n",
"5 4 5\n#...\n#.#.\n.#..\n...#\n.#.#\n"
] |
[
"#.X#\nX.#.\n#...\n",
"#XXX\n#X#.\nX#..\n...#\n.#.#\n"
] |
none
| 500 |
[
{
"input": "5 4 5\n#...\n#.#.\n.#..\n...#\n.#.#",
"output": "#XXX\n#X#.\nX#..\n...#\n.#.#"
},
{
"input": "3 3 2\n#.#\n...\n#.#",
"output": "#X#\nX..\n#.#"
},
{
"input": "7 7 18\n#.....#\n..#.#..\n.#...#.\n...#...\n.#...#.\n..#.#..\n#.....#",
"output": "#XXXXX#\nXX#X#X.\nX#XXX#.\nXXX#...\nX#...#.\nX.#.#..\n#.....#"
},
{
"input": "1 1 0\n.",
"output": "."
},
{
"input": "2 3 1\n..#\n#..",
"output": "X.#\n#.."
},
{
"input": "2 3 1\n#..\n..#",
"output": "#.X\n..#"
},
{
"input": "3 3 1\n...\n.#.\n..#",
"output": "...\n.#X\n..#"
},
{
"input": "3 3 1\n...\n.#.\n#..",
"output": "...\nX#.\n#.."
},
{
"input": "5 4 4\n#..#\n....\n.##.\n....\n#..#",
"output": "#XX#\nXX..\n.##.\n....\n#..#"
},
{
"input": "5 5 2\n.#..#\n..#.#\n#....\n##.#.\n###..",
"output": "X#..#\nX.#.#\n#....\n##.#.\n###.."
},
{
"input": "4 6 3\n#.....\n#.#.#.\n.#...#\n...#.#",
"output": "#.....\n#X#.#X\nX#...#\n...#.#"
},
{
"input": "7 5 4\n.....\n.#.#.\n#...#\n.#.#.\n.#...\n..#..\n....#",
"output": "X...X\nX#.#X\n#...#\n.#.#.\n.#...\n..#..\n....#"
},
{
"input": "16 14 19\n##############\n..############\n#.############\n#..###########\n....##########\n..############\n.#############\n.#.###########\n....##########\n###..#########\n##...#########\n###....#######\n###.##.......#\n###..###.#..#.\n###....#......\n#...#...##.###",
"output": "##############\nXX############\n#X############\n#XX###########\nXXXX##########\nXX############\nX#############\nX#.###########\nX...##########\n###..#########\n##...#########\n###....#######\n###.##.......#\n###..###.#..#.\n###...X#......\n#X..#XXX##.###"
},
{
"input": "10 17 32\n######.##########\n####.#.##########\n...#....#########\n.........########\n##.......########\n........#########\n#.....###########\n#################\n#################\n#################",
"output": "######X##########\n####X#X##########\nXXX#XXXX#########\nXXXXXXXXX########\n##XXX.XXX########\nXXXX...X#########\n#XX...###########\n#################\n#################\n#################"
},
{
"input": "16 10 38\n##########\n##########\n##########\n..########\n...#######\n...#######\n...#######\n....######\n.....####.\n......###.\n......##..\n.......#..\n.........#\n.........#\n.........#\n.........#",
"output": "##########\n##########\n##########\nXX########\nXXX#######\nXXX#######\nXXX#######\nXXXX######\nXXXXX####.\nXXXXX.###.\nXXXX..##..\nXXX....#..\nXXX......#\nXX.......#\nX........#\n.........#"
},
{
"input": "15 16 19\n########.....###\n########.....###\n############.###\n############.###\n############.###\n############.###\n############.###\n############.###\n############.###\n############.###\n.....#####.#..##\n................\n.#...........###\n###.########.###\n###.########.###",
"output": "########XXXXX###\n########XXXXX###\n############.###\n############.###\n############.###\n############.###\n############.###\n############.###\n############.###\n############.###\nXXXX.#####.#..##\nXXX.............\nX#...........###\n###.########.###\n###X########.###"
},
{
"input": "12 19 42\n.........##########\n...................\n.##.##############.\n..################.\n..#################\n..#################\n..#################\n..#################\n..#################\n..#################\n..##########.######\n.............######",
"output": "XXXXXXXXX##########\nXXXXXXXXXXXXXXXXXXX\nX##X##############X\nXX################X\nXX#################\nXX#################\nXX#################\nX.#################\nX.#################\n..#################\n..##########.######\n.............######"
},
{
"input": "3 5 1\n#...#\n..#..\n..#..",
"output": "#...#\n..#..\nX.#.."
},
{
"input": "4 5 10\n.....\n.....\n..#..\n..#..",
"output": "XXX..\nXXX..\nXX#..\nXX#.."
},
{
"input": "3 5 3\n.....\n..#..\n..#..",
"output": ".....\nX.#..\nXX#.."
},
{
"input": "3 5 1\n#....\n..#..\n..###",
"output": "#....\n..#.X\n..###"
},
{
"input": "4 5 1\n.....\n.##..\n..#..\n..###",
"output": ".....\n.##..\n..#.X\n..###"
},
{
"input": "3 5 2\n..#..\n..#..\n....#",
"output": "X.#..\nX.#..\n....#"
},
{
"input": "10 10 1\n##########\n##......##\n#..#..#..#\n#..####..#\n#######.##\n#######.##\n#..####..#\n#..#..#..#\n##......##\n##########",
"output": "##########\n##......##\n#..#..#..#\n#X.####..#\n#######.##\n#######.##\n#..####..#\n#..#..#..#\n##......##\n##########"
},
{
"input": "10 10 3\n..........\n.########.\n.########.\n.########.\n.########.\n.########.\n.#######..\n.#######..\n.####..###\n.......###",
"output": "..........\n.########.\n.########.\n.########.\n.########.\n.########.\n.#######X.\n.#######XX\n.####..###\n.......###"
},
{
"input": "5 7 10\n..#....\n..#.#..\n.##.#..\n..#.#..\n....#..",
"output": "XX#....\nXX#.#..\nX##.#..\nXX#.#..\nXXX.#.."
},
{
"input": "5 7 10\n..#....\n..#.##.\n.##.##.\n..#.#..\n....#..",
"output": "XX#....\nXX#.##.\nX##.##.\nXX#.#..\nXXX.#.."
},
{
"input": "10 10 1\n##########\n##..##..##\n#...##...#\n#.######.#\n#..####..#\n#..####..#\n#.######.#\n#........#\n##..##..##\n##########",
"output": "##########\n##.X##..##\n#...##...#\n#.######.#\n#..####..#\n#..####..#\n#.######.#\n#........#\n##..##..##\n##########"
},
{
"input": "4 5 1\n.....\n.###.\n..#..\n..#..",
"output": ".....\n.###.\n..#..\n.X#.."
},
{
"input": "2 5 2\n###..\n###..",
"output": "###X.\n###X."
},
{
"input": "2 5 3\n.....\n..#..",
"output": "X....\nXX#.."
},
{
"input": "12 12 3\n############\n#..........#\n#.########.#\n#.########.#\n#.########.#\n#.########.#\n#.########.#\n#.#######..#\n#.#######..#\n#.####..####\n#.......####\n############",
"output": "############\n#..........#\n#.########.#\n#.########.#\n#.########.#\n#.########.#\n#.########.#\n#.#######X.#\n#.#######XX#\n#.####..####\n#.......####\n############"
},
{
"input": "5 5 1\n.....\n.##..\n..###\n..###\n#####",
"output": ".....\n.##.X\n..###\n..###\n#####"
},
{
"input": "4 4 1\n....\n.#..\n..##\n..##",
"output": "....\n.#.X\n..##\n..##"
},
{
"input": "5 5 1\n....#\n.##..\n.##..\n...##\n...##",
"output": "....#\n.##..\n.##.X\n...##\n...##"
},
{
"input": "5 5 1\n.....\n.##..\n..###\n..###\n..###",
"output": ".....\n.##.X\n..###\n..###\n..###"
},
{
"input": "4 5 1\n#....\n#.#..\n..###\n..###",
"output": "#....\n#.#.X\n..###\n..###"
},
{
"input": "4 4 3\n....\n.#..\n..##\n..##",
"output": "...X\n.#XX\n..##\n..##"
},
{
"input": "4 7 6\n.......\n....#..\n.##.#..\n....#..",
"output": "X......\nX...#..\nX##.#..\nXXX.#.."
},
{
"input": "8 8 7\n........\n.##.....\n.#######\n..######\n..######\n..######\n..######\n..######",
"output": ".....XXX\n.##.XXXX\n.#######\n..######\n..######\n..######\n..######\n..######"
}
] | 1,678,475,457 | 2,147,483,647 |
PyPy 3-64
|
WRONG_ANSWER
|
TESTS
| 4 | 62 | 512,000 |
# Thank God that I'm not you.
import heapq;
import math;
from collections import deque;
import sys;
# input = sys.stdin.readline;
n, m, k = map(int, input().split())
matrix = []
for i in range(n):
matrix.append(list(input()))
inDegree = [[-1 for i in range(m)] for z in range(n)]
def getNeighbours(row, col):
distances = [[1, 0], [-1, 0], [0, 1], [0, -1]]
neighbours = [];
for rowInc, colInc in distances:
newRow, newCol = row + rowInc, col + colInc;
if 0 <= newRow < n and 0 <= newCol < m and matrix[newRow][newCol] == ".":
neighbours.append([newRow, newCol])
return neighbours;
currMin = float('inf');
for row in range(n):
for col in range(m):
if matrix[row][col] == ".":
neighbours = getNeighbours(row, col);
inDegree[row][col] = len(neighbours);
currMin = min(currMin, len(neighbours))
queue = deque();
for row in range(n):
for col in range(m):
if inDegree[row][col] == currMin:
queue.append([row, col]);
while(queue and k):
row, col = queue.popleft();
if matrix[row][col] == "X":
continue;
k -= 1;
matrix[row][col] = "X"
neighbours = getNeighbours(row, col)
for newRow, newCol in neighbours:
inDegree[newRow][newCol] -= 1;
if inDegree[newRow][newCol] in [1, 0]:
queue.append([newRow, newCol]);
for row in matrix:
print(''.join(row))
|
Title: Maze
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Pavel loves grid mazes. A grid maze is an *n*<=×<=*m* rectangle maze where each cell is either empty, or is a wall. You can go from one cell to another only if both cells are empty and have a common side.
Pavel drew a grid maze with all empty cells forming a connected area. That is, you can go from any empty cell to any other one. Pavel doesn't like it when his maze has too little walls. He wants to turn exactly *k* empty cells into walls so that all the remaining cells still formed a connected area. Help him.
Input Specification:
The first line contains three integers *n*, *m*, *k* (1<=≤<=*n*,<=*m*<=≤<=500, 0<=≤<=*k*<=<<=*s*), where *n* and *m* are the maze's height and width, correspondingly, *k* is the number of walls Pavel wants to add and letter *s* represents the number of empty cells in the original maze.
Each of the next *n* lines contains *m* characters. They describe the original maze. If a character on a line equals ".", then the corresponding cell is empty and if the character equals "#", then the cell is a wall.
Output Specification:
Print *n* lines containing *m* characters each: the new maze that fits Pavel's requirements. Mark the empty cells that you transformed into walls as "X", the other cells must be left without changes (that is, "." and "#").
It is guaranteed that a solution exists. If there are multiple solutions you can output any of them.
Demo Input:
['3 4 2\n#..#\n..#.\n#...\n', '5 4 5\n#...\n#.#.\n.#..\n...#\n.#.#\n']
Demo Output:
['#.X#\nX.#.\n#...\n', '#XXX\n#X#.\nX#..\n...#\n.#.#\n']
Note:
none
|
```python
# Thank God that I'm not you.
import heapq;
import math;
from collections import deque;
import sys;
# input = sys.stdin.readline;
n, m, k = map(int, input().split())
matrix = []
for i in range(n):
matrix.append(list(input()))
inDegree = [[-1 for i in range(m)] for z in range(n)]
def getNeighbours(row, col):
distances = [[1, 0], [-1, 0], [0, 1], [0, -1]]
neighbours = [];
for rowInc, colInc in distances:
newRow, newCol = row + rowInc, col + colInc;
if 0 <= newRow < n and 0 <= newCol < m and matrix[newRow][newCol] == ".":
neighbours.append([newRow, newCol])
return neighbours;
currMin = float('inf');
for row in range(n):
for col in range(m):
if matrix[row][col] == ".":
neighbours = getNeighbours(row, col);
inDegree[row][col] = len(neighbours);
currMin = min(currMin, len(neighbours))
queue = deque();
for row in range(n):
for col in range(m):
if inDegree[row][col] == currMin:
queue.append([row, col]);
while(queue and k):
row, col = queue.popleft();
if matrix[row][col] == "X":
continue;
k -= 1;
matrix[row][col] = "X"
neighbours = getNeighbours(row, col)
for newRow, newCol in neighbours:
inDegree[newRow][newCol] -= 1;
if inDegree[newRow][newCol] in [1, 0]:
queue.append([newRow, newCol]);
for row in matrix:
print(''.join(row))
```
| 0 |
|
382 |
A
|
Ksenia and Pan Scales
|
PROGRAMMING
| 1,100 |
[
"greedy",
"implementation"
] | null | null |
Ksenia has ordinary pan scales and several weights of an equal mass. Ksenia has already put some weights on the scales, while other weights are untouched. Ksenia is now wondering whether it is possible to put all the remaining weights on the scales so that the scales were in equilibrium.
The scales is in equilibrium if the total sum of weights on the left pan is equal to the total sum of weights on the right pan.
|
The first line has a non-empty sequence of characters describing the scales. In this sequence, an uppercase English letter indicates a weight, and the symbol "|" indicates the delimiter (the character occurs in the sequence exactly once). All weights that are recorded in the sequence before the delimiter are initially on the left pan of the scale. All weights that are recorded in the sequence after the delimiter are initially on the right pan of the scale.
The second line contains a non-empty sequence containing uppercase English letters. Each letter indicates a weight which is not used yet.
It is guaranteed that all the English letters in the input data are different. It is guaranteed that the input does not contain any extra characters.
|
If you cannot put all the weights on the scales so that the scales were in equilibrium, print string "Impossible". Otherwise, print the description of the resulting scales, copy the format of the input.
If there are multiple answers, print any of them.
|
[
"AC|T\nL\n",
"|ABC\nXYZ\n",
"W|T\nF\n",
"ABC|\nD\n"
] |
[
"AC|TL\n",
"XYZ|ABC\n",
"Impossible\n",
"Impossible\n"
] |
none
| 500 |
[
{
"input": "AC|T\nL",
"output": "AC|TL"
},
{
"input": "|ABC\nXYZ",
"output": "XYZ|ABC"
},
{
"input": "W|T\nF",
"output": "Impossible"
},
{
"input": "ABC|\nD",
"output": "Impossible"
},
{
"input": "A|BC\nDEF",
"output": "ADF|BCE"
},
{
"input": "|\nABC",
"output": "Impossible"
},
{
"input": "|\nZXCVBANMIO",
"output": "XVAMO|ZCBNI"
},
{
"input": "|C\nA",
"output": "A|C"
},
{
"input": "|\nAB",
"output": "B|A"
},
{
"input": "A|XYZ\nUIOPL",
"output": "Impossible"
},
{
"input": "K|B\nY",
"output": "Impossible"
},
{
"input": "EQJWDOHKZRBISPLXUYVCMNFGT|\nA",
"output": "Impossible"
},
{
"input": "|MACKERIGZPVHNDYXJBUFLWSO\nQT",
"output": "Impossible"
},
{
"input": "ERACGIZOVPT|WXUYMDLJNQS\nKB",
"output": "ERACGIZOVPTB|WXUYMDLJNQSK"
},
{
"input": "CKQHRUZMISGE|FBVWPXDLTJYN\nOA",
"output": "CKQHRUZMISGEA|FBVWPXDLTJYNO"
},
{
"input": "V|CMOEUTAXBFWSK\nDLRZJGIYNQHP",
"output": "VDLRZJGIYNQHP|CMOEUTAXBFWSK"
},
{
"input": "QWHNMALDGKTJ|\nPBRYVXZUESCOIF",
"output": "QWHNMALDGKTJF|PBRYVXZUESCOI"
},
{
"input": "|\nFXCVMUEWZAHNDOSITPRLKQJYBG",
"output": "XVUWANOIPLQYG|FCMEZHDSTRKJB"
},
{
"input": "IB|PCGHZ\nFXWTJQNEKAUM",
"output": "Impossible"
},
{
"input": "EC|IWAXQ\nJUHSRKGZTOMYN",
"output": "ECJUHRGTMN|IWAXQSKZOY"
},
{
"input": "VDINYMA|UQKWBCLRHZJ\nXEGOF",
"output": "Impossible"
},
{
"input": "ZLTPSIQUBAR|XFDEMYC\nHNOJWG",
"output": "ZLTPSIQUBARG|XFDEMYCHNOJW"
},
{
"input": "R|FLZOTJNU\nGIYHKVX",
"output": "RGIYHKVX|FLZOTJNU"
},
{
"input": "W|TL\nQROFSADYPKHEJNMXBZVUCIG",
"output": "WQOSDPHJMBVCG|TLRFAYKENXZUI"
},
{
"input": "NRDFQSEKLAYMOT|ZH\nGUXIBJCVPW",
"output": "Impossible"
},
{
"input": "FGRT|\nAC",
"output": "Impossible"
},
{
"input": "|FGRT\nAC",
"output": "Impossible"
},
{
"input": "A|\nB",
"output": "A|B"
},
{
"input": "|A\nB",
"output": "B|A"
},
{
"input": "|\nA",
"output": "Impossible"
},
{
"input": "|\nQWERTYUIOPASDFGHJKLZXCVBNM",
"output": "WRYIPSFHKZCBM|QETUOADGJLXVN"
},
{
"input": "QWERTYUIOPASDFGHJKLZXCVBN|\nM",
"output": "Impossible"
},
{
"input": "QWERTY|VBN\nUIOPASDFGHJKLZXC",
"output": "Impossible"
},
{
"input": "ABC|D\nKSL",
"output": "Impossible"
},
{
"input": "A|BCDEF\nGH",
"output": "Impossible"
},
{
"input": "|ABC\nD",
"output": "Impossible"
},
{
"input": "A|BC\nDE",
"output": "Impossible"
},
{
"input": "|ASD\nX",
"output": "Impossible"
},
{
"input": "AB|CDEF\nXYZRT",
"output": "Impossible"
}
] | 1,683,811,010 | 2,147,483,647 |
Python 3
|
WRONG_ANSWER
|
TESTS
| 4 | 46 | 0 |
r1,r2=input().split("|")
r3=input()
if(len(r1)==len(r2)+len(r3)):
print(r1+"|"+r2+r3)
elif(len(r1)+len(r3)==len(r2)):
print(r1+r3+"|"+r2)
else:
print("Impossible")
|
Title: Ksenia and Pan Scales
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Ksenia has ordinary pan scales and several weights of an equal mass. Ksenia has already put some weights on the scales, while other weights are untouched. Ksenia is now wondering whether it is possible to put all the remaining weights on the scales so that the scales were in equilibrium.
The scales is in equilibrium if the total sum of weights on the left pan is equal to the total sum of weights on the right pan.
Input Specification:
The first line has a non-empty sequence of characters describing the scales. In this sequence, an uppercase English letter indicates a weight, and the symbol "|" indicates the delimiter (the character occurs in the sequence exactly once). All weights that are recorded in the sequence before the delimiter are initially on the left pan of the scale. All weights that are recorded in the sequence after the delimiter are initially on the right pan of the scale.
The second line contains a non-empty sequence containing uppercase English letters. Each letter indicates a weight which is not used yet.
It is guaranteed that all the English letters in the input data are different. It is guaranteed that the input does not contain any extra characters.
Output Specification:
If you cannot put all the weights on the scales so that the scales were in equilibrium, print string "Impossible". Otherwise, print the description of the resulting scales, copy the format of the input.
If there are multiple answers, print any of them.
Demo Input:
['AC|T\nL\n', '|ABC\nXYZ\n', 'W|T\nF\n', 'ABC|\nD\n']
Demo Output:
['AC|TL\n', 'XYZ|ABC\n', 'Impossible\n', 'Impossible\n']
Note:
none
|
```python
r1,r2=input().split("|")
r3=input()
if(len(r1)==len(r2)+len(r3)):
print(r1+"|"+r2+r3)
elif(len(r1)+len(r3)==len(r2)):
print(r1+r3+"|"+r2)
else:
print("Impossible")
```
| 0 |
|
466 |
C
|
Number of Ways
|
PROGRAMMING
| 1,700 |
[
"binary search",
"brute force",
"data structures",
"dp",
"two pointers"
] | null | null |
You've got array *a*[1],<=*a*[2],<=...,<=*a*[*n*], consisting of *n* integers. Count the number of ways to split all the elements of the array into three contiguous parts so that the sum of elements in each part is the same.
More formally, you need to find the number of such pairs of indices *i*,<=*j* (2<=≤<=*i*<=≤<=*j*<=≤<=*n*<=-<=1), that .
|
The first line contains integer *n* (1<=≤<=*n*<=≤<=5·105), showing how many numbers are in the array. The second line contains *n* integers *a*[1], *a*[2], ..., *a*[*n*] (|*a*[*i*]|<=≤<=<=109) — the elements of array *a*.
|
Print a single integer — the number of ways to split the array into three parts with the same sum.
|
[
"5\n1 2 3 0 3\n",
"4\n0 1 -1 0\n",
"2\n4 1\n"
] |
[
"2\n",
"1\n",
"0\n"
] |
none
| 1,500 |
[
{
"input": "5\n1 2 3 0 3",
"output": "2"
},
{
"input": "4\n0 1 -1 0",
"output": "1"
},
{
"input": "2\n4 1",
"output": "0"
},
{
"input": "9\n0 0 0 0 0 0 0 0 0",
"output": "28"
},
{
"input": "10\n2 5 -2 2 -3 -2 3 5 -5 -2",
"output": "0"
},
{
"input": "1\n1",
"output": "0"
},
{
"input": "3\n1 2 3",
"output": "0"
},
{
"input": "100\n1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1",
"output": "2030"
},
{
"input": "6\n1000000000 1000000000 1000000000 1000000000 1000000000 1000000000",
"output": "1"
},
{
"input": "10\n1 0 0 0 1 1 1 0 1 1",
"output": "2"
},
{
"input": "10\n-2 2 -2 0 -2 -1 1 -1 2 0",
"output": "0"
},
{
"input": "4\n0 2 -1 2",
"output": "0"
},
{
"input": "5\n3 3 -3 3 3",
"output": "3"
},
{
"input": "5\n1 1 1 1 1",
"output": "0"
},
{
"input": "8\n-1 -1 -1 -1 -1 -1 -1 -1",
"output": "0"
},
{
"input": "2\n0 0",
"output": "0"
},
{
"input": "4\n1 -1 0 0",
"output": "1"
},
{
"input": "3\n6 -3 6",
"output": "0"
}
] | 1,696,456,764 | 2,147,483,647 |
PyPy 3
|
WRONG_ANSWER
|
TESTS
| 3 | 77 | 0 |
n = int(input())
a = [int(x) for x in input().split()]
total = 0
for i in range(0, n - 2):
for j in range(i + 1, n - 1):
for k in range(j + 1, n):
if sum(a[i:j]) == sum(a[j:k]) == sum(a[k:n]):
total += 1
print(total)
|
Title: Number of Ways
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You've got array *a*[1],<=*a*[2],<=...,<=*a*[*n*], consisting of *n* integers. Count the number of ways to split all the elements of the array into three contiguous parts so that the sum of elements in each part is the same.
More formally, you need to find the number of such pairs of indices *i*,<=*j* (2<=≤<=*i*<=≤<=*j*<=≤<=*n*<=-<=1), that .
Input Specification:
The first line contains integer *n* (1<=≤<=*n*<=≤<=5·105), showing how many numbers are in the array. The second line contains *n* integers *a*[1], *a*[2], ..., *a*[*n*] (|*a*[*i*]|<=≤<=<=109) — the elements of array *a*.
Output Specification:
Print a single integer — the number of ways to split the array into three parts with the same sum.
Demo Input:
['5\n1 2 3 0 3\n', '4\n0 1 -1 0\n', '2\n4 1\n']
Demo Output:
['2\n', '1\n', '0\n']
Note:
none
|
```python
n = int(input())
a = [int(x) for x in input().split()]
total = 0
for i in range(0, n - 2):
for j in range(i + 1, n - 1):
for k in range(j + 1, n):
if sum(a[i:j]) == sum(a[j:k]) == sum(a[k:n]):
total += 1
print(total)
```
| 0 |
|
61 |
A
|
Ultra-Fast Mathematician
|
PROGRAMMING
| 800 |
[
"implementation"
] |
A. Ultra-Fast Mathematician
|
2
|
256
|
Shapur was an extremely gifted student. He was great at everything including Combinatorics, Algebra, Number Theory, Geometry, Calculus, etc. He was not only smart but extraordinarily fast! He could manage to sum 1018 numbers in a single second.
One day in 230 AD Shapur was trying to find out if any one can possibly do calculations faster than him. As a result he made a very great contest and asked every one to come and take part.
In his contest he gave the contestants many different pairs of numbers. Each number is made from digits 0 or 1. The contestants should write a new number corresponding to the given pair of numbers. The rule is simple: The *i*-th digit of the answer is 1 if and only if the *i*-th digit of the two given numbers differ. In the other case the *i*-th digit of the answer is 0.
Shapur made many numbers and first tried his own speed. He saw that he can perform these operations on numbers of length ∞ (length of a number is number of digits in it) in a glance! He always gives correct answers so he expects the contestants to give correct answers, too. He is a good fellow so he won't give anyone very big numbers and he always gives one person numbers of same length.
Now you are going to take part in Shapur's contest. See if you are faster and more accurate.
|
There are two lines in each input. Each of them contains a single number. It is guaranteed that the numbers are made from 0 and 1 only and that their length is same. The numbers may start with 0. The length of each number doesn't exceed 100.
|
Write one line — the corresponding answer. Do not omit the leading 0s.
|
[
"1010100\n0100101\n",
"000\n111\n",
"1110\n1010\n",
"01110\n01100\n"
] |
[
"1110001\n",
"111\n",
"0100\n",
"00010\n"
] |
none
| 500 |
[
{
"input": "1010100\n0100101",
"output": "1110001"
},
{
"input": "000\n111",
"output": "111"
},
{
"input": "1110\n1010",
"output": "0100"
},
{
"input": "01110\n01100",
"output": "00010"
},
{
"input": "011101\n000001",
"output": "011100"
},
{
"input": "10\n01",
"output": "11"
},
{
"input": "00111111\n11011101",
"output": "11100010"
},
{
"input": "011001100\n101001010",
"output": "110000110"
},
{
"input": "1100100001\n0110101100",
"output": "1010001101"
},
{
"input": "00011101010\n10010100101",
"output": "10001001111"
},
{
"input": "100000101101\n111010100011",
"output": "011010001110"
},
{
"input": "1000001111010\n1101100110001",
"output": "0101101001011"
},
{
"input": "01011111010111\n10001110111010",
"output": "11010001101101"
},
{
"input": "110010000111100\n001100101011010",
"output": "111110101100110"
},
{
"input": "0010010111110000\n0000000011010110",
"output": "0010010100100110"
},
{
"input": "00111110111110000\n01111100001100000",
"output": "01000010110010000"
},
{
"input": "101010101111010001\n001001111101111101",
"output": "100011010010101100"
},
{
"input": "0110010101111100000\n0011000101000000110",
"output": "0101010000111100110"
},
{
"input": "11110100011101010111\n00001000011011000000",
"output": "11111100000110010111"
},
{
"input": "101010101111101101001\n111010010010000011111",
"output": "010000111101101110110"
},
{
"input": "0000111111100011000010\n1110110110110000001010",
"output": "1110001001010011001000"
},
{
"input": "10010010101000110111000\n00101110100110111000111",
"output": "10111100001110001111111"
},
{
"input": "010010010010111100000111\n100100111111100011001110",
"output": "110110101101011111001001"
},
{
"input": "0101110100100111011010010\n0101100011010111001010001",
"output": "0000010111110000010000011"
},
{
"input": "10010010100011110111111011\n10000110101100000001000100",
"output": "00010100001111110110111111"
},
{
"input": "000001111000000100001000000\n011100111101111001110110001",
"output": "011101000101111101111110001"
},
{
"input": "0011110010001001011001011100\n0000101101000011101011001010",
"output": "0011011111001010110010010110"
},
{
"input": "11111000000000010011001101111\n11101110011001010100010000000",
"output": "00010110011001000111011101111"
},
{
"input": "011001110000110100001100101100\n001010000011110000001000101001",
"output": "010011110011000100000100000101"
},
{
"input": "1011111010001100011010110101111\n1011001110010000000101100010101",
"output": "0000110100011100011111010111010"
},
{
"input": "10111000100001000001010110000001\n10111000001100101011011001011000",
"output": "00000000101101101010001111011001"
},
{
"input": "000001010000100001000000011011100\n111111111001010100100001100000111",
"output": "111110101001110101100001111011011"
},
{
"input": "1101000000000010011011101100000110\n1110000001100010011010000011011110",
"output": "0011000001100000000001101111011000"
},
{
"input": "01011011000010100001100100011110001\n01011010111000001010010100001110000",
"output": "00000001111010101011110000010000001"
},
{
"input": "000011111000011001000110111100000100\n011011000110000111101011100111000111",
"output": "011000111110011110101101011011000011"
},
{
"input": "1001000010101110001000000011111110010\n0010001011010111000011101001010110000",
"output": "1011001001111001001011101010101000010"
},
{
"input": "00011101011001100101111111000000010101\n10010011011011001011111000000011101011",
"output": "10001110000010101110000111000011111110"
},
{
"input": "111011100110001001101111110010111001010\n111111101101111001110010000101101000100",
"output": "000100001011110000011101110111010001110"
},
{
"input": "1111001001101000001000000010010101001010\n0010111100111110001011000010111110111001",
"output": "1101110101010110000011000000101011110011"
},
{
"input": "00100101111000000101011111110010100011010\n11101110001010010101001000111110101010100",
"output": "11001011110010010000010111001100001001110"
},
{
"input": "101011001110110100101001000111010101101111\n100111100110101011010100111100111111010110",
"output": "001100101000011111111101111011101010111001"
},
{
"input": "1111100001100101000111101001001010011100001\n1000110011000011110010001011001110001000001",
"output": "0111010010100110110101100010000100010100000"
},
{
"input": "01100111011111010101000001101110000001110101\n10011001011111110000000101011001001101101100",
"output": "11111110000000100101000100110111001100011001"
},
{
"input": "110010100111000100100101100000011100000011001\n011001111011100110000110111001110110100111011",
"output": "101011011100100010100011011001101010100100010"
},
{
"input": "0001100111111011010110100100111000000111000110\n1100101011000000000001010010010111001100110001",
"output": "1101001100111011010111110110101111001011110111"
},
{
"input": "00000101110110110001110010100001110100000100000\n10010000110011110001101000111111101010011010001",
"output": "10010101000101000000011010011110011110011110001"
},
{
"input": "110000100101011100100011001111110011111110010001\n101011111001011100110110111101110011010110101100",
"output": "011011011100000000010101110010000000101000111101"
},
{
"input": "0101111101011111010101011101000011101100000000111\n0000101010110110001110101011011110111001010100100",
"output": "0101010111101001011011110110011101010101010100011"
},
{
"input": "11000100010101110011101000011111001010110111111100\n00001111000111001011111110000010101110111001000011",
"output": "11001011010010111000010110011101100100001110111111"
},
{
"input": "101000001101111101101111111000001110110010101101010\n010011100111100001100000010001100101000000111011011",
"output": "111011101010011100001111101001101011110010010110001"
},
{
"input": "0011111110010001010100010110111000110011001101010100\n0111000000100010101010000100101000000100101000111001",
"output": "0100111110110011111110010010010000110111100101101101"
},
{
"input": "11101010000110000011011010000001111101000111011111100\n10110011110001010100010110010010101001010111100100100",
"output": "01011001110111010111001100010011010100010000111011000"
},
{
"input": "011000100001000001101000010110100110011110100111111011\n111011001000001001110011001111011110111110110011011111",
"output": "100011101001001000011011011001111000100000010100100100"
},
{
"input": "0111010110010100000110111011010110100000000111110110000\n1011100100010001101100000100111111101001110010000100110",
"output": "1100110010000101101010111111101001001001110101110010110"
},
{
"input": "10101000100111000111010001011011011011110100110101100011\n11101111000000001100100011111000100100000110011001101110",
"output": "01000111100111001011110010100011111111110010101100001101"
},
{
"input": "000000111001010001000000110001001011100010011101010011011\n110001101000010010000101000100001111101001100100001010010",
"output": "110001010001000011000101110101000100001011111001011001001"
},
{
"input": "0101011100111010000111110010101101111111000000111100011100\n1011111110000010101110111001000011100000100111111111000111",
"output": "1110100010111000101001001011101110011111100111000011011011"
},
{
"input": "11001000001100100111100111100100101011000101001111001001101\n10111110100010000011010100110100100011101001100000001110110",
"output": "01110110101110100100110011010000001000101100101111000111011"
},
{
"input": "010111011011101000000110000110100110001110100001110110111011\n101011110011101011101101011111010100100001100111100100111011",
"output": "111100101000000011101011011001110010101111000110010010000000"
},
{
"input": "1001011110110110000100011001010110000100011010010111010101110\n1101111100001000010111110011010101111010010100000001000010111",
"output": "0100100010111110010011101010000011111110001110010110010111001"
},
{
"input": "10000010101111100111110101111000010100110111101101111111111010\n10110110101100101010011001011010100110111011101100011001100111",
"output": "00110100000011001101101100100010110010001100000001100110011101"
},
{
"input": "011111010011111000001010101001101001000010100010111110010100001\n011111001011000011111001000001111001010110001010111101000010011",
"output": "000000011000111011110011101000010000010100101000000011010110010"
},
{
"input": "1111000000110001011101000100100100001111011100001111001100011111\n1101100110000101100001100000001001011011111011010101000101001010",
"output": "0010100110110100111100100100101101010100100111011010001001010101"
},
{
"input": "01100000101010010011001110100110110010000110010011011001100100011\n10110110010110111100100111000111000110010000000101101110000010111",
"output": "11010110111100101111101001100001110100010110010110110111100110100"
},
{
"input": "001111111010000100001100001010011001111110011110010111110001100111\n110000101001011000100010101100100110000111100000001101001110010111",
"output": "111111010011011100101110100110111111111001111110011010111111110000"
},
{
"input": "1011101011101101011110101101011101011000010011100101010101000100110\n0001000001001111010111100100111101100000000001110001000110000000110",
"output": "1010101010100010001001001001100000111000010010010100010011000100000"
},
{
"input": "01000001011001010011011100010000100100110101111011011011110000001110\n01011110000110011011000000000011000111100001010000000011111001110000",
"output": "00011111011111001000011100010011100011010100101011011000001001111110"
},
{
"input": "110101010100110101000001111110110100010010000100111110010100110011100\n111010010111111011100110101011001011001110110111110100000110110100111",
"output": "001111000011001110100111010101111111011100110011001010010010000111011"
},
{
"input": "1001101011000001011111100110010010000011010001001111011100010100110001\n1111100111110101001111010001010000011001001001010110001111000000100101",
"output": "0110001100110100010000110111000010011010011000011001010011010100010100"
},
{
"input": "00000111110010110001110110001010010101000111011001111111100110011110010\n00010111110100000100110101000010010001100001100011100000001100010100010",
"output": "00010000000110110101000011001000000100100110111010011111101010001010000"
},
{
"input": "100101011100101101000011010001011001101110101110001100010001010111001110\n100001111100101011011111110000001111000111001011111110000010101110111001",
"output": "000100100000000110011100100001010110101001100101110010010011111001110111"
},
{
"input": "1101100001000111001101001011101000111000011110000001001101101001111011010\n0101011101010100011011010110101000010010110010011110101100000110110001000",
"output": "1000111100010011010110011101000000101010101100011111100001101111001010010"
},
{
"input": "01101101010011110101100001110101111011100010000010001101111000011110111111\n00101111001101001100111010000101110000100101101111100111101110010100011011",
"output": "01000010011110111001011011110000001011000111101101101010010110001010100100"
},
{
"input": "101100101100011001101111110110110010100110110010100001110010110011001101011\n000001011010101011110011111101001110000111000010001101000010010000010001101",
"output": "101101110110110010011100001011111100100001110000101100110000100011011100110"
},
{
"input": "0010001011001010001100000010010011110110011000100000000100110000101111001110\n1100110100111000110100001110111001011101001100001010100001010011100110110001",
"output": "1110111111110010111000001100101010101011010100101010100101100011001001111111"
},
{
"input": "00101101010000000101011001101011001100010001100000101011101110000001111001000\n10010110010111000000101101000011101011001010000011011101101011010000000011111",
"output": "10111011000111000101110100101000100111011011100011110110000101010001111010111"
},
{
"input": "111100000100100000101001100001001111001010001000001000000111010000010101101011\n001000100010100101111011111011010110101100001111011000010011011011100010010110",
"output": "110100100110000101010010011010011001100110000111010000010100001011110111111101"
},
{
"input": "0110001101100100001111110101101000100101010010101010011001101001001101110000000\n0111011000000010010111011110010000000001000110001000011001101000000001110100111",
"output": "0001010101100110011000101011111000100100010100100010000000000001001100000100111"
},
{
"input": "10001111111001000101001011110101111010100001011010101100111001010001010010001000\n10000111010010011110111000111010101100000011110001101111001000111010100000000001",
"output": "00001000101011011011110011001111010110100010101011000011110001101011110010001001"
},
{
"input": "100110001110110000100101001110000011110110000110000000100011110100110110011001101\n110001110101110000000100101001101011111100100100001001000110000001111100011110110",
"output": "010111111011000000100001100111101000001010100010001001100101110101001010000111011"
},
{
"input": "0000010100100000010110111100011111111010011101000000100000011001001101101100111010\n0100111110011101010110101011110110010111001111000110101100101110111100101000111111",
"output": "0100101010111101000000010111101001101101010010000110001100110111110001000100000101"
},
{
"input": "11000111001010100001110000001001011010010010110000001110100101000001010101100110111\n11001100100100100001101010110100000111100011101110011010110100001001000011011011010",
"output": "00001011101110000000011010111101011101110001011110010100010001001000010110111101101"
},
{
"input": "010110100010001000100010101001101010011010111110100001000100101000111011100010100001\n110000011111101101010011111000101010111010100001001100001001100101000000111000000000",
"output": "100110111101100101110001010001000000100000011111101101001101001101111011011010100001"
},
{
"input": "0000011110101110010101110110110101100001011001101010101001000010000010000000101001101\n1100111111011100000110000111101110011111100111110001011001000010011111100001001100011",
"output": "1100100001110010010011110001011011111110111110011011110000000000011101100001100101110"
},
{
"input": "10100000101101110001100010010010100101100011010010101000110011100000101010110010000000\n10001110011011010010111011011101101111000111110000111000011010010101001100000001010011",
"output": "00101110110110100011011001001111001010100100100010010000101001110101100110110011010011"
},
{
"input": "001110000011111101101010011111000101010111010100001001100001001100101000000111000000000\n111010000000000000101001110011001000111011001100101010011001000011101001001011110000011",
"output": "110100000011111101000011101100001101101100011000100011111000001111000001001100110000011"
},
{
"input": "1110111100111011010101011011001110001010010010110011110010011111000010011111010101100001\n1001010101011001001010100010101100000110111101011000100010101111111010111100001110010010",
"output": "0111101001100010011111111001100010001100101111101011010000110000111000100011011011110011"
},
{
"input": "11100010001100010011001100001100010011010001101110011110100101110010101101011101000111111\n01110000000110111010110100001010000101011110100101010011000110101110101101110111011110001",
"output": "10010010001010101001111000000110010110001111001011001101100011011100000000101010011001110"
},
{
"input": "001101011001100101101100110000111000101011001001100100000100101000100000110100010111111101\n101001111110000010111101111110001001111001111101111010000110111000100100110010010001011111",
"output": "100100100111100111010001001110110001010010110100011110000010010000000100000110000110100010"
},
{
"input": "1010110110010101000110010010110101011101010100011001101011000110000000100011100100011000000\n0011011111100010001111101101000111001011101110100000110111100100101111010110101111011100011",
"output": "1001101001110111001001111111110010010110111010111001011100100010101111110101001011000100011"
},
{
"input": "10010010000111010111011111110010100101100000001100011100111011100010000010010001011100001100\n00111010100010110010000100010111010001111110100100100011101000101111111111001101101100100100",
"output": "10101000100101100101011011100101110100011110101000111111010011001101111101011100110000101000"
},
{
"input": "010101110001010101100000010111010000000111110011001101100011001000000011001111110000000010100\n010010111011100101010101111110110000000111000100001101101001001000001100101110001010000100001",
"output": "000111001010110000110101101001100000000000110111000000001010000000001111100001111010000110101"
},
{
"input": "1100111110011001000111101001001011000110011010111111100010111111001100111111011101100111101011\n1100000011001000110100110111000001011001010111101000010010100011000001100100111101101000010110",
"output": "0000111101010001110011011110001010011111001101010111110000011100001101011011100000001111111101"
},
{
"input": "00011000100100110111100101100100000000010011110111110010101110110011100001010111010011110100101\n00011011111011111011100101100111100101001110010111000010000111000100100100000001110101111011011",
"output": "00000011011111001100000000000011100101011101100000110000101001110111000101010110100110001111110"
},
{
"input": "000101011001001100000111100010110101111011110101111101000110001101011010111110110011100100000001\n011000101010011111011000111000100000000011011000000001111110001000001111101010110000011100001111",
"output": "011101110011010011011111011010010101111000101101111100111000000101010101010100000011111000001110"
},
{
"input": "1000101001011010000100100100010010011101011001110101111011101111111110010101001101010001010101001\n0110110010011100011111011111110111000000010001110100001010111110101011010011111011111110000110000",
"output": "1110011011000110011011111011100101011101001000000001110001010001010101000110110110101111010011001"
},
{
"input": "01111010010101100111110111111011011010100001011101010000111100101101101110111011001100101011100111\n00001100110110100001111011000010001001001100000010111101000001111011100000010111010010000011000010",
"output": "01110110100011000110001100111001010011101101011111101101111101010110001110101100011110101000100101"
},
{
"input": "111101011101111000001011001101111010110111001101110100100011111011011101001101010101011010111000110\n101111100101101101001100110011000001111010011101110111110110101110011011110011111100001001110101101",
"output": "010010111000010101000111111110111011001101010000000011010101010101000110111110101001010011001101011"
},
{
"input": "1010000011010110011101001101110001110010000111011101110010110110111111001001110100101100010101010001\n0111101000111100101100000101111010100100001000011101010100110011100011010011010101000100101011100011",
"output": "1101101011101010110001001000001011010110001111000000100110000101011100011010100001101000111110110010"
},
{
"input": "0000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000001\n1111111010111111101011111110101111111010111111101011111110101111111010111111101011111110101111111010",
"output": "1111111010111111101011111110101111111010111111101011111110101111111010111111101011111110101111111011"
},
{
"input": "0\n0",
"output": "0"
},
{
"input": "0\n1",
"output": "1"
}
] | 1,658,225,357 | 2,147,483,647 |
Python 3
|
WRONG_ANSWER
|
TESTS
| 0 | 30 | 0 |
n1 = input()
n2 = input()
blnk_str = ''
for i,n1_ele in enumerate(n1):
print(i, n1_ele)
if n1_ele == n2[i]:
blnk_str = blnk_str + '0'
else:
blnk_str = blnk_str + '1'
print(blnk_str)
|
Title: Ultra-Fast Mathematician
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Shapur was an extremely gifted student. He was great at everything including Combinatorics, Algebra, Number Theory, Geometry, Calculus, etc. He was not only smart but extraordinarily fast! He could manage to sum 1018 numbers in a single second.
One day in 230 AD Shapur was trying to find out if any one can possibly do calculations faster than him. As a result he made a very great contest and asked every one to come and take part.
In his contest he gave the contestants many different pairs of numbers. Each number is made from digits 0 or 1. The contestants should write a new number corresponding to the given pair of numbers. The rule is simple: The *i*-th digit of the answer is 1 if and only if the *i*-th digit of the two given numbers differ. In the other case the *i*-th digit of the answer is 0.
Shapur made many numbers and first tried his own speed. He saw that he can perform these operations on numbers of length ∞ (length of a number is number of digits in it) in a glance! He always gives correct answers so he expects the contestants to give correct answers, too. He is a good fellow so he won't give anyone very big numbers and he always gives one person numbers of same length.
Now you are going to take part in Shapur's contest. See if you are faster and more accurate.
Input Specification:
There are two lines in each input. Each of them contains a single number. It is guaranteed that the numbers are made from 0 and 1 only and that their length is same. The numbers may start with 0. The length of each number doesn't exceed 100.
Output Specification:
Write one line — the corresponding answer. Do not omit the leading 0s.
Demo Input:
['1010100\n0100101\n', '000\n111\n', '1110\n1010\n', '01110\n01100\n']
Demo Output:
['1110001\n', '111\n', '0100\n', '00010\n']
Note:
none
|
```python
n1 = input()
n2 = input()
blnk_str = ''
for i,n1_ele in enumerate(n1):
print(i, n1_ele)
if n1_ele == n2[i]:
blnk_str = blnk_str + '0'
else:
blnk_str = blnk_str + '1'
print(blnk_str)
```
| 0 |
17 |
A
|
Noldbach problem
|
PROGRAMMING
| 1,000 |
[
"brute force",
"math",
"number theory"
] |
A. Noldbach problem
|
2
|
64
|
Nick is interested in prime numbers. Once he read about Goldbach problem. It states that every even integer greater than 2 can be expressed as the sum of two primes. That got Nick's attention and he decided to invent a problem of his own and call it Noldbach problem. Since Nick is interested only in prime numbers, Noldbach problem states that at least *k* prime numbers from 2 to *n* inclusively can be expressed as the sum of three integer numbers: two neighboring prime numbers and 1. For example, 19 = 7 + 11 + 1, or 13 = 5 + 7 + 1.
Two prime numbers are called neighboring if there are no other prime numbers between them.
You are to help Nick, and find out if he is right or wrong.
|
The first line of the input contains two integers *n* (2<=≤<=*n*<=≤<=1000) and *k* (0<=≤<=*k*<=≤<=1000).
|
Output YES if at least *k* prime numbers from 2 to *n* inclusively can be expressed as it was described above. Otherwise output NO.
|
[
"27 2\n",
"45 7\n"
] |
[
"YES",
"NO"
] |
In the first sample the answer is YES since at least two numbers can be expressed as it was described (for example, 13 and 19). In the second sample the answer is NO since it is impossible to express 7 prime numbers from 2 to 45 in the desired form.
| 0 |
[
{
"input": "27 2",
"output": "YES"
},
{
"input": "45 7",
"output": "NO"
},
{
"input": "2 0",
"output": "YES"
},
{
"input": "15 1",
"output": "YES"
},
{
"input": "17 1",
"output": "YES"
},
{
"input": "34 5",
"output": "NO"
},
{
"input": "37 4",
"output": "YES"
},
{
"input": "43 5",
"output": "YES"
},
{
"input": "47 7",
"output": "NO"
},
{
"input": "50 5",
"output": "YES"
},
{
"input": "57 6",
"output": "YES"
},
{
"input": "60 8",
"output": "NO"
},
{
"input": "62 7",
"output": "YES"
},
{
"input": "76 9",
"output": "NO"
},
{
"input": "69 7",
"output": "YES"
},
{
"input": "113 10",
"output": "YES"
},
{
"input": "141 11",
"output": "YES"
},
{
"input": "207 16",
"output": "NO"
},
{
"input": "231 18",
"output": "NO"
},
{
"input": "296 19",
"output": "YES"
},
{
"input": "332 20",
"output": "YES"
},
{
"input": "378 24",
"output": "NO"
},
{
"input": "428 23",
"output": "YES"
},
{
"input": "497 27",
"output": "NO"
},
{
"input": "640 32",
"output": "YES"
},
{
"input": "798 35",
"output": "YES"
},
{
"input": "802 35",
"output": "YES"
},
{
"input": "864 40",
"output": "NO"
},
{
"input": "953 44",
"output": "NO"
},
{
"input": "995 44",
"output": "YES"
},
{
"input": "1000 44",
"output": "YES"
},
{
"input": "1000 0",
"output": "YES"
},
{
"input": "1000 1000",
"output": "NO"
},
{
"input": "2 1000",
"output": "NO"
},
{
"input": "2 0",
"output": "YES"
}
] | 1,598,784,755 | 2,147,483,647 |
Python 3
|
WRONG_ANSWER
|
TESTS
| 6 | 218 | 6,963,200 |
def prime(n):
l = []
for i in range(2,n+1):
flag = 0
for j in range(2,i):
if i % j == 0:
flag = 1
break
if flag == 0:
l.append(i)
return l
n,k = map(int,input().split())
res = prime(27)
c = 0
for i in range(len(res)-1):
if res[i]+res[i+1]+1 in res:
c+=1
if c < k:
print("NO")
else:
print("YES")
|
Title: Noldbach problem
Time Limit: 2 seconds
Memory Limit: 64 megabytes
Problem Description:
Nick is interested in prime numbers. Once he read about Goldbach problem. It states that every even integer greater than 2 can be expressed as the sum of two primes. That got Nick's attention and he decided to invent a problem of his own and call it Noldbach problem. Since Nick is interested only in prime numbers, Noldbach problem states that at least *k* prime numbers from 2 to *n* inclusively can be expressed as the sum of three integer numbers: two neighboring prime numbers and 1. For example, 19 = 7 + 11 + 1, or 13 = 5 + 7 + 1.
Two prime numbers are called neighboring if there are no other prime numbers between them.
You are to help Nick, and find out if he is right or wrong.
Input Specification:
The first line of the input contains two integers *n* (2<=≤<=*n*<=≤<=1000) and *k* (0<=≤<=*k*<=≤<=1000).
Output Specification:
Output YES if at least *k* prime numbers from 2 to *n* inclusively can be expressed as it was described above. Otherwise output NO.
Demo Input:
['27 2\n', '45 7\n']
Demo Output:
['YES', 'NO']
Note:
In the first sample the answer is YES since at least two numbers can be expressed as it was described (for example, 13 and 19). In the second sample the answer is NO since it is impossible to express 7 prime numbers from 2 to 45 in the desired form.
|
```python
def prime(n):
l = []
for i in range(2,n+1):
flag = 0
for j in range(2,i):
if i % j == 0:
flag = 1
break
if flag == 0:
l.append(i)
return l
n,k = map(int,input().split())
res = prime(27)
c = 0
for i in range(len(res)-1):
if res[i]+res[i+1]+1 in res:
c+=1
if c < k:
print("NO")
else:
print("YES")
```
| 0 |
186 |
A
|
Comparing Strings
|
PROGRAMMING
| 1,100 |
[
"implementation",
"strings"
] | null | null |
Some dwarves that are finishing the StUDY (State University for Dwarven Youngsters) Bachelor courses, have been told "no genome, no degree". That means that all dwarves should write a thesis on genome. Dwarven genome is far from simple. It is represented by a string that consists of lowercase Latin letters.
Dwarf Misha has already chosen the subject for his thesis: determining by two dwarven genomes, whether they belong to the same race. Two dwarves belong to the same race if we can swap two characters in the first dwarf's genome and get the second dwarf's genome as a result. Help Dwarf Misha and find out whether two gnomes belong to the same race or not.
|
The first line contains the first dwarf's genome: a non-empty string, consisting of lowercase Latin letters.
The second line contains the second dwarf's genome: a non-empty string, consisting of lowercase Latin letters.
The number of letters in each genome doesn't exceed 105. It is guaranteed that the strings that correspond to the genomes are different. The given genomes may have different length.
|
Print "YES", if the dwarves belong to the same race. Otherwise, print "NO".
|
[
"ab\nba\n",
"aa\nab\n"
] |
[
"YES\n",
"NO\n"
] |
- First example: you can simply swap two letters in string "ab". So we get "ba". - Second example: we can't change string "aa" into string "ab", because "aa" does not contain letter "b".
| 500 |
[
{
"input": "ab\nba",
"output": "YES"
},
{
"input": "aa\nab",
"output": "NO"
},
{
"input": "a\nza",
"output": "NO"
},
{
"input": "vvea\nvvae",
"output": "YES"
},
{
"input": "rtfabanpc\natfabrnpc",
"output": "YES"
},
{
"input": "mt\ntm",
"output": "YES"
},
{
"input": "qxolmbkkt\naovlajmlf",
"output": "NO"
},
{
"input": "b\ng",
"output": "NO"
},
{
"input": "ab\naba",
"output": "NO"
},
{
"input": "ba\na",
"output": "NO"
},
{
"input": "a\nab",
"output": "NO"
},
{
"input": "a\naa",
"output": "NO"
},
{
"input": "a\nz",
"output": "NO"
},
{
"input": "aabb\nbbaa",
"output": "NO"
},
{
"input": "ab\nbd",
"output": "NO"
},
{
"input": "bac\ndae",
"output": "NO"
},
{
"input": "abc\nakl",
"output": "NO"
},
{
"input": "cb\naa",
"output": "NO"
},
{
"input": "abaab\naabba",
"output": "NO"
},
{
"input": "aab\naaa",
"output": "NO"
},
{
"input": "abcde\nedcba",
"output": "NO"
},
{
"input": "abab\nbaba",
"output": "NO"
},
{
"input": "ab\nbac",
"output": "NO"
},
{
"input": "abcd\naqcb",
"output": "NO"
},
{
"input": "abc\nbad",
"output": "NO"
},
{
"input": "ab\nca",
"output": "NO"
},
{
"input": "abc\nab",
"output": "NO"
},
{
"input": "ab\nbae",
"output": "NO"
},
{
"input": "aaaabcccca\naaaadccccb",
"output": "NO"
},
{
"input": "acaa\nabca",
"output": "NO"
},
{
"input": "aba\naab",
"output": "YES"
},
{
"input": "ah\nla",
"output": "NO"
},
{
"input": "aab\naa",
"output": "NO"
},
{
"input": "abab\nabcd",
"output": "NO"
},
{
"input": "ed\nab",
"output": "NO"
}
] | 1,651,941,994 | 2,147,483,647 |
Python 3
|
WRONG_ANSWER
|
TESTS
| 15 | 92 | 0 |
print("NYOE S"[sorted(set(input()))==sorted(set(input()))::2])
|
Title: Comparing Strings
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Some dwarves that are finishing the StUDY (State University for Dwarven Youngsters) Bachelor courses, have been told "no genome, no degree". That means that all dwarves should write a thesis on genome. Dwarven genome is far from simple. It is represented by a string that consists of lowercase Latin letters.
Dwarf Misha has already chosen the subject for his thesis: determining by two dwarven genomes, whether they belong to the same race. Two dwarves belong to the same race if we can swap two characters in the first dwarf's genome and get the second dwarf's genome as a result. Help Dwarf Misha and find out whether two gnomes belong to the same race or not.
Input Specification:
The first line contains the first dwarf's genome: a non-empty string, consisting of lowercase Latin letters.
The second line contains the second dwarf's genome: a non-empty string, consisting of lowercase Latin letters.
The number of letters in each genome doesn't exceed 105. It is guaranteed that the strings that correspond to the genomes are different. The given genomes may have different length.
Output Specification:
Print "YES", if the dwarves belong to the same race. Otherwise, print "NO".
Demo Input:
['ab\nba\n', 'aa\nab\n']
Demo Output:
['YES\n', 'NO\n']
Note:
- First example: you can simply swap two letters in string "ab". So we get "ba". - Second example: we can't change string "aa" into string "ab", because "aa" does not contain letter "b".
|
```python
print("NYOE S"[sorted(set(input()))==sorted(set(input()))::2])
```
| 0 |
|
839 |
C
|
Journey
|
PROGRAMMING
| 1,500 |
[
"dfs and similar",
"dp",
"graphs",
"probabilities",
"trees"
] | null | null |
There are *n* cities and *n*<=-<=1 roads in the Seven Kingdoms, each road connects two cities and we can reach any city from any other by the roads.
Theon and Yara Greyjoy are on a horse in the first city, they are starting traveling through the roads. But the weather is foggy, so they can’t see where the horse brings them. When the horse reaches a city (including the first one), it goes to one of the cities connected to the current city. But it is a strange horse, it only goes to cities in which they weren't before. In each such city, the horse goes with equal probabilities and it stops when there are no such cities.
Let the length of each road be 1. The journey starts in the city 1. What is the expected length (expected value of length) of their journey? You can read about expected (average) value by the link [https://en.wikipedia.org/wiki/Expected_value](https://en.wikipedia.org/wiki/Expected_value).
|
The first line contains a single integer *n* (1<=≤<=*n*<=≤<=100000) — number of cities.
Then *n*<=-<=1 lines follow. The *i*-th line of these lines contains two integers *u**i* and *v**i* (1<=≤<=*u**i*,<=*v**i*<=≤<=*n*, *u**i*<=≠<=*v**i*) — the cities connected by the *i*-th road.
It is guaranteed that one can reach any city from any other by the roads.
|
Print a number — the expected length of their journey. The journey starts in the city 1.
Your answer will be considered correct if its absolute or relative error does not exceed 10<=-<=6.
Namely: let's assume that your answer is *a*, and the answer of the jury is *b*. The checker program will consider your answer correct, if .
|
[
"4\n1 2\n1 3\n2 4\n",
"5\n1 2\n1 3\n3 4\n2 5\n"
] |
[
"1.500000000000000\n",
"2.000000000000000\n"
] |
In the first sample, their journey may end in cities 3 or 4 with equal probability. The distance to city 3 is 1 and to city 4 is 2, so the expected length is 1.5.
In the second sample, their journey may end in city 4 or 5. The distance to the both cities is 2, so the expected length is 2.
| 1,500 |
[
{
"input": "4\n1 2\n1 3\n2 4",
"output": "1.500000000000000"
},
{
"input": "5\n1 2\n1 3\n3 4\n2 5",
"output": "2.000000000000000"
},
{
"input": "70\n1 25\n57 1\n18 1\n65 1\n38 1\n1 41\n1 5\n1 69\n1 3\n31 1\n1 8\n1 9\n53 1\n70 1\n45 1\n1 24\n1 42\n1 30\n1 12\n1 37\n64 1\n1 28\n1 58\n1 22\n11 1\n1 4\n1 27\n1 16\n1 21\n54 1\n1 51\n1 43\n29 1\n56 1\n1 39\n32 1\n1 15\n1 17\n1 19\n1 40\n36 1\n48 1\n63 1\n1 7\n1 47\n1 13\n1 46\n60 1\n1 6\n23 1\n20 1\n1 52\n2 1\n26 1\n1 59\n1 66\n10 1\n1 62\n1 68\n1 55\n50 1\n33 1\n44 1\n1 34\n1 35\n1 61\n14 1\n67 1\n49 1",
"output": "1.000000000000000"
},
{
"input": "10\n8 6\n9 10\n8 7\n1 4\n1 8\n9 5\n9 8\n2 5\n3 1",
"output": "1.500000000000000"
},
{
"input": "1",
"output": "0.000000000000000"
}
] | 1,666,884,799 | 2,147,483,647 |
PyPy 3
|
OK
|
TESTS
| 40 | 1,091 | 27,136,000 |
from collections import defaultdict, deque
from typing import List, Dict
'''
DFS optimization:
https://www.python.org/doc/essays/graphs/
'''
n = int(input())
if n == 1:
print(0)
elif n == 2:
u, v = [int(x) for x in input().split()]
print(1)
else:
adj = defaultdict(list)
for edge in range(n - 1):
u, v = [int(x) for x in input().split()]
adj[u].append(v)
adj[v].append(u)
#curr_node, curr_prob, curr_level
bfs, visited, ans = deque([(1, 1, 0)]), set([1]), 0
while bfs:
curr_node, curr_prob, curr_level = bfs.popleft()
num_adj = 0
for nex_node in adj[curr_node]:
if nex_node not in visited: num_adj += 1
for nex_node in adj[curr_node]:
if nex_node not in visited:
visited.add(nex_node)
bfs.append((nex_node, curr_prob / num_adj, curr_level + 1))
if num_adj == 0:
ans += curr_prob * curr_level
print(ans)
|
Title: Journey
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
There are *n* cities and *n*<=-<=1 roads in the Seven Kingdoms, each road connects two cities and we can reach any city from any other by the roads.
Theon and Yara Greyjoy are on a horse in the first city, they are starting traveling through the roads. But the weather is foggy, so they can’t see where the horse brings them. When the horse reaches a city (including the first one), it goes to one of the cities connected to the current city. But it is a strange horse, it only goes to cities in which they weren't before. In each such city, the horse goes with equal probabilities and it stops when there are no such cities.
Let the length of each road be 1. The journey starts in the city 1. What is the expected length (expected value of length) of their journey? You can read about expected (average) value by the link [https://en.wikipedia.org/wiki/Expected_value](https://en.wikipedia.org/wiki/Expected_value).
Input Specification:
The first line contains a single integer *n* (1<=≤<=*n*<=≤<=100000) — number of cities.
Then *n*<=-<=1 lines follow. The *i*-th line of these lines contains two integers *u**i* and *v**i* (1<=≤<=*u**i*,<=*v**i*<=≤<=*n*, *u**i*<=≠<=*v**i*) — the cities connected by the *i*-th road.
It is guaranteed that one can reach any city from any other by the roads.
Output Specification:
Print a number — the expected length of their journey. The journey starts in the city 1.
Your answer will be considered correct if its absolute or relative error does not exceed 10<=-<=6.
Namely: let's assume that your answer is *a*, and the answer of the jury is *b*. The checker program will consider your answer correct, if .
Demo Input:
['4\n1 2\n1 3\n2 4\n', '5\n1 2\n1 3\n3 4\n2 5\n']
Demo Output:
['1.500000000000000\n', '2.000000000000000\n']
Note:
In the first sample, their journey may end in cities 3 or 4 with equal probability. The distance to city 3 is 1 and to city 4 is 2, so the expected length is 1.5.
In the second sample, their journey may end in city 4 or 5. The distance to the both cities is 2, so the expected length is 2.
|
```python
from collections import defaultdict, deque
from typing import List, Dict
'''
DFS optimization:
https://www.python.org/doc/essays/graphs/
'''
n = int(input())
if n == 1:
print(0)
elif n == 2:
u, v = [int(x) for x in input().split()]
print(1)
else:
adj = defaultdict(list)
for edge in range(n - 1):
u, v = [int(x) for x in input().split()]
adj[u].append(v)
adj[v].append(u)
#curr_node, curr_prob, curr_level
bfs, visited, ans = deque([(1, 1, 0)]), set([1]), 0
while bfs:
curr_node, curr_prob, curr_level = bfs.popleft()
num_adj = 0
for nex_node in adj[curr_node]:
if nex_node not in visited: num_adj += 1
for nex_node in adj[curr_node]:
if nex_node not in visited:
visited.add(nex_node)
bfs.append((nex_node, curr_prob / num_adj, curr_level + 1))
if num_adj == 0:
ans += curr_prob * curr_level
print(ans)
```
| 3 |
|
155 |
A
|
I_love_\%username\%
|
PROGRAMMING
| 800 |
[
"brute force"
] | null | null |
Vasya adores sport programming. He can't write programs but he loves to watch the contests' progress. Vasya even has a favorite coder and Vasya pays special attention to him.
One day Vasya decided to collect the results of all contests where his favorite coder participated and track the progress of his coolness. For each contest where this coder participated, he wrote out a single non-negative number — the number of points his favorite coder earned in the contest. Vasya wrote out the points for the contest in the order, in which the contests run (naturally, no two contests ran simultaneously).
Vasya considers a coder's performance in a contest amazing in two situations: he can break either his best or his worst performance record. First, it is amazing if during the contest the coder earns strictly more points that he earned on each past contest. Second, it is amazing if during the contest the coder earns strictly less points that he earned on each past contest. A coder's first contest isn't considered amazing. Now he wants to count the number of amazing performances the coder had throughout his whole history of participating in contests. But the list of earned points turned out long and Vasya can't code... That's why he asks you to help him.
|
The first line contains the single integer *n* (1<=≤<=*n*<=≤<=1000) — the number of contests where the coder participated.
The next line contains *n* space-separated non-negative integer numbers — they are the points which the coder has earned. The points are given in the chronological order. All points do not exceed 10000.
|
Print the single number — the number of amazing performances the coder has had during his whole history of participating in the contests.
|
[
"5\n100 50 200 150 200\n",
"10\n4664 6496 5814 7010 5762 5736 6944 4850 3698 7242\n"
] |
[
"2\n",
"4\n"
] |
In the first sample the performances number 2 and 3 are amazing.
In the second sample the performances number 2, 4, 9 and 10 are amazing.
| 500 |
[
{
"input": "5\n100 50 200 150 200",
"output": "2"
},
{
"input": "10\n4664 6496 5814 7010 5762 5736 6944 4850 3698 7242",
"output": "4"
},
{
"input": "1\n6",
"output": "0"
},
{
"input": "2\n2 1",
"output": "1"
},
{
"input": "5\n100 36 53 7 81",
"output": "2"
},
{
"input": "5\n7 36 53 81 100",
"output": "4"
},
{
"input": "5\n100 81 53 36 7",
"output": "4"
},
{
"input": "10\n8 6 3 4 9 10 7 7 1 3",
"output": "5"
},
{
"input": "10\n1627 1675 1488 1390 1812 1137 1746 1324 1952 1862",
"output": "6"
},
{
"input": "10\n1 3 3 4 6 7 7 8 9 10",
"output": "7"
},
{
"input": "10\n1952 1862 1812 1746 1675 1627 1488 1390 1324 1137",
"output": "9"
},
{
"input": "25\n1448 4549 2310 2725 2091 3509 1565 2475 2232 3989 4231 779 2967 2702 608 3739 721 1552 2767 530 3114 665 1940 48 4198",
"output": "5"
},
{
"input": "33\n1097 1132 1091 1104 1049 1038 1023 1080 1104 1029 1035 1061 1049 1060 1088 1106 1105 1087 1063 1076 1054 1103 1047 1041 1028 1120 1126 1063 1117 1110 1044 1093 1101",
"output": "5"
},
{
"input": "34\n821 5536 2491 6074 7216 9885 764 1603 778 8736 8987 771 617 1587 8943 7922 439 7367 4115 8886 7878 6899 8811 5752 3184 3401 9760 9400 8995 4681 1323 6637 6554 6498",
"output": "7"
},
{
"input": "68\n6764 6877 6950 6768 6839 6755 6726 6778 6699 6805 6777 6985 6821 6801 6791 6805 6940 6761 6677 6999 6911 6699 6959 6933 6903 6843 6972 6717 6997 6756 6789 6668 6735 6852 6735 6880 6723 6834 6810 6694 6780 6679 6698 6857 6826 6896 6979 6968 6957 6988 6960 6700 6919 6892 6984 6685 6813 6678 6715 6857 6976 6902 6780 6686 6777 6686 6842 6679",
"output": "9"
},
{
"input": "60\n9000 9014 9034 9081 9131 9162 9174 9199 9202 9220 9221 9223 9229 9235 9251 9260 9268 9269 9270 9298 9307 9309 9313 9323 9386 9399 9407 9495 9497 9529 9531 9544 9614 9615 9627 9627 9643 9654 9656 9657 9685 9699 9701 9736 9745 9758 9799 9827 9843 9845 9854 9854 9885 9891 9896 9913 9942 9963 9986 9992",
"output": "57"
},
{
"input": "100\n7 61 12 52 41 16 34 99 30 44 48 89 31 54 21 1 48 52 61 15 35 87 21 76 64 92 44 81 16 93 84 92 32 15 68 76 53 39 26 4 11 26 7 4 99 99 61 65 55 85 65 67 47 39 2 74 63 49 98 87 5 94 22 30 25 42 31 84 49 23 89 60 16 26 92 27 9 57 75 61 94 35 83 47 99 100 63 24 91 88 79 10 15 45 22 64 3 11 89 83",
"output": "4"
},
{
"input": "100\n9999 9999 9999 9998 9998 9998 9997 9996 9996 9995 9993 9993 9991 9990 9989 9986 9984 9984 9983 9981 9981 9980 9980 9980 9979 9977 9977 9977 9977 9977 9976 9976 9975 9975 9973 9972 9972 9972 9972 9971 9969 9969 9969 9968 9967 9965 9962 9962 9962 9962 9960 9958 9958 9955 9954 9954 9954 9954 9950 9949 9949 9947 9943 9943 9940 9940 9939 9937 9937 9937 9936 9935 9932 9932 9931 9929 9927 9927 9926 9923 9919 9919 9918 9918 9918 9917 9917 9916 9916 9915 9914 9911 9910 9907 9907 9906 9905 9905 9904 9901",
"output": "57"
},
{
"input": "100\n158 159 157 156 155 154 160 153 161 152 162 163 151 164 150 165 149 148 147 166 146 167 145 144 143 142 168 141 169 170 140 139 138 137 171 136 135 134 172 173 174 133 175 132 177 178 131 179 180 130 129 181 128 127 182 126 183 125 124 184 123 122 121 120 119 118 117 185 186 187 188 189 116 190 115 191 192 193 114 113 112 111 110 109 108 194 195 107 106 105 196 197 104 198 199 103 102 200 101 100",
"output": "99"
},
{
"input": "2\n0 10000",
"output": "1"
},
{
"input": "2\n5 5",
"output": "0"
},
{
"input": "2\n1 1",
"output": "0"
},
{
"input": "2\n10 10",
"output": "0"
},
{
"input": "1\n0",
"output": "0"
}
] | 1,688,843,499 | 2,147,483,647 |
Python 3
|
OK
|
TESTS
| 37 | 92 | 0 |
#https://codeforces.com/problemset/problem/155/A
number_of_contests = int(input())
contest_result = [int(x) for x in input().split(" ")]
max_result, min_result = contest_result[0], contest_result[0]
amazing_results = 0
for result in contest_result:
if(result > max_result):
max_result = result
amazing_results +=1
elif(result < min_result):
min_result = result
amazing_results +=1
print(amazing_results)
|
Title: I_love_\%username\%
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Vasya adores sport programming. He can't write programs but he loves to watch the contests' progress. Vasya even has a favorite coder and Vasya pays special attention to him.
One day Vasya decided to collect the results of all contests where his favorite coder participated and track the progress of his coolness. For each contest where this coder participated, he wrote out a single non-negative number — the number of points his favorite coder earned in the contest. Vasya wrote out the points for the contest in the order, in which the contests run (naturally, no two contests ran simultaneously).
Vasya considers a coder's performance in a contest amazing in two situations: he can break either his best or his worst performance record. First, it is amazing if during the contest the coder earns strictly more points that he earned on each past contest. Second, it is amazing if during the contest the coder earns strictly less points that he earned on each past contest. A coder's first contest isn't considered amazing. Now he wants to count the number of amazing performances the coder had throughout his whole history of participating in contests. But the list of earned points turned out long and Vasya can't code... That's why he asks you to help him.
Input Specification:
The first line contains the single integer *n* (1<=≤<=*n*<=≤<=1000) — the number of contests where the coder participated.
The next line contains *n* space-separated non-negative integer numbers — they are the points which the coder has earned. The points are given in the chronological order. All points do not exceed 10000.
Output Specification:
Print the single number — the number of amazing performances the coder has had during his whole history of participating in the contests.
Demo Input:
['5\n100 50 200 150 200\n', '10\n4664 6496 5814 7010 5762 5736 6944 4850 3698 7242\n']
Demo Output:
['2\n', '4\n']
Note:
In the first sample the performances number 2 and 3 are amazing.
In the second sample the performances number 2, 4, 9 and 10 are amazing.
|
```python
#https://codeforces.com/problemset/problem/155/A
number_of_contests = int(input())
contest_result = [int(x) for x in input().split(" ")]
max_result, min_result = contest_result[0], contest_result[0]
amazing_results = 0
for result in contest_result:
if(result > max_result):
max_result = result
amazing_results +=1
elif(result < min_result):
min_result = result
amazing_results +=1
print(amazing_results)
```
| 3 |
|
462 |
B
|
Appleman and Card Game
|
PROGRAMMING
| 1,300 |
[
"greedy"
] | null | null |
Appleman has *n* cards. Each card has an uppercase letter written on it. Toastman must choose *k* cards from Appleman's cards. Then Appleman should give Toastman some coins depending on the chosen cards. Formally, for each Toastman's card *i* you should calculate how much Toastman's cards have the letter equal to letter on *i*th, then sum up all these quantities, such a number of coins Appleman should give to Toastman.
Given the description of Appleman's cards. What is the maximum number of coins Toastman can get?
|
The first line contains two integers *n* and *k* (1<=≤<=*k*<=≤<=*n*<=≤<=105). The next line contains *n* uppercase letters without spaces — the *i*-th letter describes the *i*-th card of the Appleman.
|
Print a single integer – the answer to the problem.
|
[
"15 10\nDZFDFZDFDDDDDDF\n",
"6 4\nYJSNPI\n"
] |
[
"82\n",
"4\n"
] |
In the first test example Toastman can choose nine cards with letter D and one additional card with any letter. For each card with D he will get 9 coins and for the additional card he will get 1 coin.
| 1,000 |
[
{
"input": "15 10\nDZFDFZDFDDDDDDF",
"output": "82"
},
{
"input": "6 4\nYJSNPI",
"output": "4"
},
{
"input": "5 3\nAOWBY",
"output": "3"
},
{
"input": "1 1\nV",
"output": "1"
},
{
"input": "2 1\nWT",
"output": "1"
},
{
"input": "2 2\nBL",
"output": "2"
},
{
"input": "5 1\nFACJT",
"output": "1"
},
{
"input": "5 5\nMJDIJ",
"output": "7"
},
{
"input": "15 5\nAZBIPTOFTJCJJIK",
"output": "13"
},
{
"input": "100 1\nEVEEVEEEGGECFEHEFVFVFHVHEEEEEFCVEEEEEEVFVEEVEEHEEVEFEVVEFEEEFEVECEHGHEEFGEEVCEECCECEFHEVEEEEEEGEEHVH",
"output": "1"
},
{
"input": "100 15\nKKTFFUTFCKUIKKKKFIFFKTUKUUKUKKIKKKTIFKTKUCFFKKKIIKKKKKKTFKFKKIRKKKFKUUKIKUUUFFKKKKTUZKITUIKKIKUKKTIK",
"output": "225"
},
{
"input": "100 50\nYYIYYAAAIEAAYAYAEAIIIAAEAAYEAEYYYIAEYAYAYYAAAIAYAEAAYAYYIYAAYYAAAAAAIYYYAAYAAEAAYAIEIYIYAYAYAYIIAAEY",
"output": "1972"
},
{
"input": "100 90\nFAFAOOAOOAFAOTFAFAFFATAAAOFAAOAFBAAAFBOAOFFFOAOAFAPFOFAOFAAFOAAAAFAAFOFAAOFPPAAOOAAOOFFOFFFOFAOTOFAF",
"output": "2828"
},
{
"input": "100 99\nBFFBBFBFBQFFFFFQBFFBFFBQFBFQFBBFQFFFBFFFBFQFQFBFFBBFYQFBFFFFFFFBQQFQBFBQBQFFFBQQFFFBQFYFBFBFFFBBBQQY",
"output": "3713"
},
{
"input": "100 100\nMQSBDAJABILIBCUEOWGWCEXMUTEYQKAIWGINXVQEOFDUBSVULROQHQRZZAALVQFEFRAAAYUIMGCAFQGIAEFBETRECGSFQJNXHHDN",
"output": "514"
},
{
"input": "100 50\nBMYIXQSJNHGFVFPJBIOBXIKSFNUFPVODCUBQYSIIQNVNXXCWXWRHKFEUPPIIDDGRDBJLZDCBMNJMYRMWFIHOSTDJJHXHPNRKWNFD",
"output": "328"
},
{
"input": "100 50\nENFNEMLJEMDMFMNNGNIMNINALGLLLAEMENEMNLMMIEIJNAINBJEJMFJLLIMINELGFLAIAMJMHMGNLIEFJIEEFEFGLLLDLMEAEIMM",
"output": "748"
}
] | 1,593,481,655 | 2,147,483,647 |
Python 3
|
OK
|
TESTS
| 41 | 171 | 7,680,000 |
n,k = map(int,input().split())
lst = list(input())
uni = set(lst)
count = []
for i in uni :
x = lst.count(i)
count.append(x)
count.sort()
count.reverse()
##print(count)
ans = []
while k > 0 :
for i in count :
if i <= k :
ans.append(i)
k -= i
count.remove(i)
break
elif i > k :
ans.append(k)
k = 0
break
ans = [i ** 2 for i in ans]
##print(ans)
print(sum(ans))
|
Title: Appleman and Card Game
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Appleman has *n* cards. Each card has an uppercase letter written on it. Toastman must choose *k* cards from Appleman's cards. Then Appleman should give Toastman some coins depending on the chosen cards. Formally, for each Toastman's card *i* you should calculate how much Toastman's cards have the letter equal to letter on *i*th, then sum up all these quantities, such a number of coins Appleman should give to Toastman.
Given the description of Appleman's cards. What is the maximum number of coins Toastman can get?
Input Specification:
The first line contains two integers *n* and *k* (1<=≤<=*k*<=≤<=*n*<=≤<=105). The next line contains *n* uppercase letters without spaces — the *i*-th letter describes the *i*-th card of the Appleman.
Output Specification:
Print a single integer – the answer to the problem.
Demo Input:
['15 10\nDZFDFZDFDDDDDDF\n', '6 4\nYJSNPI\n']
Demo Output:
['82\n', '4\n']
Note:
In the first test example Toastman can choose nine cards with letter D and one additional card with any letter. For each card with D he will get 9 coins and for the additional card he will get 1 coin.
|
```python
n,k = map(int,input().split())
lst = list(input())
uni = set(lst)
count = []
for i in uni :
x = lst.count(i)
count.append(x)
count.sort()
count.reverse()
##print(count)
ans = []
while k > 0 :
for i in count :
if i <= k :
ans.append(i)
k -= i
count.remove(i)
break
elif i > k :
ans.append(k)
k = 0
break
ans = [i ** 2 for i in ans]
##print(ans)
print(sum(ans))
```
| 3 |
|
8 |
C
|
Looking for Order
|
PROGRAMMING
| 2,000 |
[
"bitmasks",
"dp"
] |
C. Looking for Order
|
4
|
512
|
Girl Lena likes it when everything is in order, and looks for order everywhere. Once she was getting ready for the University and noticed that the room was in a mess — all the objects from her handbag were thrown about the room. Of course, she wanted to put them back into her handbag. The problem is that the girl cannot carry more than two objects at a time, and cannot move the handbag. Also, if he has taken an object, she cannot put it anywhere except her handbag — her inherent sense of order does not let her do so.
You are given the coordinates of the handbag and the coordinates of the objects in some Сartesian coordinate system. It is known that the girl covers the distance between any two objects in the time equal to the squared length of the segment between the points of the objects. It is also known that initially the coordinates of the girl and the handbag are the same. You are asked to find such an order of actions, that the girl can put all the objects back into her handbag in a minimum time period.
|
The first line of the input file contains the handbag's coordinates *x**s*,<=*y**s*. The second line contains number *n* (1<=≤<=*n*<=≤<=24) — the amount of objects the girl has. The following *n* lines contain the objects' coordinates. All the coordinates do not exceed 100 in absolute value. All the given positions are different. All the numbers are integer.
|
In the first line output the only number — the minimum time the girl needs to put the objects into her handbag.
In the second line output the possible optimum way for Lena. Each object in the input is described by its index number (from 1 to *n*), the handbag's point is described by number 0. The path should start and end in the handbag's point. If there are several optimal paths, print any of them.
|
[
"0 0\n2\n1 1\n-1 1\n",
"1 1\n3\n4 3\n3 4\n0 0\n"
] |
[
"8\n0 1 2 0 \n",
"32\n0 1 2 0 3 0 \n"
] |
none
| 0 |
[
{
"input": "0 0\n2\n1 1\n-1 1",
"output": "8\n0 1 2 0 "
},
{
"input": "1 1\n3\n4 3\n3 4\n0 0",
"output": "32\n0 1 2 0 3 0 "
},
{
"input": "-3 4\n1\n2 2",
"output": "58\n0 1 0 "
},
{
"input": "7 -7\n2\n3 1\n-3 8",
"output": "490\n0 1 2 0 "
},
{
"input": "3 -9\n3\n0 -9\n-10 -3\n-12 -2",
"output": "502\n0 1 0 2 3 0 "
},
{
"input": "4 -1\n4\n14 -3\n-11 10\n-3 -5\n-8 1",
"output": "922\n0 1 0 2 4 0 3 0 "
},
{
"input": "7 -11\n5\n-1 7\n-7 -11\n12 -4\n8 -6\n-18 -8",
"output": "1764\n0 1 3 0 2 5 0 4 0 "
},
{
"input": "11 3\n6\n-17 -17\n-4 -9\n15 19\n7 4\n13 1\n5 -6",
"output": "2584\n0 1 2 0 3 0 4 6 0 5 0 "
},
{
"input": "-6 4\n7\n-10 -11\n-11 -3\n13 27\n12 -22\n19 -17\n21 -21\n-5 4",
"output": "6178\n0 1 4 0 2 0 3 7 0 5 6 0 "
},
{
"input": "27 -5\n8\n-13 -19\n-20 -8\n11 2\n-23 21\n-28 1\n11 -12\n6 29\n22 -15",
"output": "14062\n0 1 2 0 3 7 0 4 5 0 6 8 0 "
},
{
"input": "31 9\n9\n8 -26\n26 4\n3 2\n24 21\n14 34\n-3 26\n35 -25\n5 20\n-1 8",
"output": "9384\n0 1 7 0 2 0 3 9 0 4 5 0 6 8 0 "
},
{
"input": "-44 47\n24\n96 -18\n-50 86\n84 68\n-25 80\n-11 -15\n-62 0\n-42 50\n-57 11\n-5 27\n-44 67\n-77 -3\n-27 -46\n32 63\n86 13\n-21 -51\n-25 -62\n-14 -2\n-21 86\n-92 -94\n-44 -34\n-74 55\n91 -35\n-10 55\n-34 16",
"output": "191534\n0 1 22 0 2 10 0 3 14 0 4 18 0 5 20 0 6 11 0 7 0 8 24 0 9 17 0 12 15 0 13 23 0 16 19 0 21 0 "
},
{
"input": "5 4\n11\n-26 2\n20 35\n-41 39\n31 -15\n-2 -44\n16 -28\n17 -6\n0 7\n-29 -35\n-17 12\n42 29",
"output": "19400\n0 1 3 0 2 11 0 4 6 0 5 9 0 7 0 8 10 0 "
},
{
"input": "-44 22\n12\n-28 24\n41 -19\n-39 -36\n12 -18\n-31 -24\n-7 29\n45 0\n12 -2\n42 31\n28 -37\n-34 -38\n6 24",
"output": "59712\n0 1 5 0 2 10 0 3 11 0 4 8 0 6 12 0 7 9 0 "
},
{
"input": "40 -36\n13\n3 -31\n28 -43\n45 11\n47 -37\n47 -28\n-30 24\n-46 -33\n-31 46\n-2 -38\n-43 -4\n39 11\n45 -1\n50 38",
"output": "52988\n0 1 9 0 2 0 3 13 0 4 5 0 6 8 0 7 10 0 11 12 0 "
},
{
"input": "-54 2\n14\n-21 -2\n-5 34\n48 -55\n-32 -23\n22 -10\n-33 54\n-16 32\n-53 -17\n10 31\n-47 21\n-52 49\n34 42\n-42 -25\n-32 31",
"output": "55146\n0 1 4 0 2 7 0 3 5 0 6 11 0 8 13 0 9 12 0 10 14 0 "
},
{
"input": "-19 -31\n15\n-31 -59\n60 -34\n-22 -59\n5 44\n26 39\n-39 -23\n-60 -7\n1 2\n-5 -19\n-41 -26\n46 -8\n51 -2\n60 4\n-12 44\n14 49",
"output": "60546\n0 1 3 0 2 11 0 4 14 0 5 15 0 6 0 7 10 0 8 9 0 12 13 0 "
},
{
"input": "-34 19\n16\n-44 24\n30 -42\n46 5\n13 -32\n40 53\n35 49\n-30 7\n-60 -50\n37 46\n-18 -57\n37 -44\n-61 58\n13 -55\n28 22\n-50 -3\n5 52",
"output": "81108\n0 1 12 0 2 11 0 3 14 0 4 13 0 5 9 0 6 16 0 7 15 0 8 10 0 "
},
{
"input": "-64 -6\n17\n-3 -18\n66 -58\n55 34\n-4 -40\n-1 -50\n13 -9\n56 55\n3 42\n-54 -52\n51 -56\n21 -27\n62 -17\n54 -5\n-28 -24\n12 68\n43 -22\n8 -6",
"output": "171198\n0 1 14 0 2 10 0 3 7 0 4 5 0 6 17 0 8 15 0 9 0 11 16 0 12 13 0 "
},
{
"input": "7 -35\n18\n24 -3\n25 -42\n-56 0\n63 -30\n18 -63\n-30 -20\n-53 -47\n-11 -17\n-22 -54\n7 -41\n-32 -3\n-29 15\n-30 -25\n68 15\n-18 70\n-28 19\n-12 69\n44 29",
"output": "70504\n0 1 4 0 2 5 0 3 11 0 6 13 0 7 9 0 8 0 10 0 12 16 0 14 18 0 15 17 0 "
},
{
"input": "-8 47\n19\n47 51\n43 -57\n-76 -26\n-23 51\n19 74\n-36 65\n50 4\n48 8\n14 -67\n23 44\n5 59\n7 -45\n-52 -6\n-2 -33\n34 -72\n-51 -47\n-42 4\n-41 55\n22 9",
"output": "112710\n0 1 10 0 2 15 0 3 16 0 4 0 5 11 0 6 18 0 7 8 0 9 12 0 13 17 0 14 19 0 "
},
{
"input": "44 75\n20\n-19 -33\n-25 -42\n-30 -61\n-21 44\n7 4\n-38 -78\n-14 9\n65 40\n-27 25\n65 -1\n-71 -38\n-52 57\n-41 -50\n-52 40\n40 44\n-19 51\n42 -43\n-79 -69\n26 -69\n-56 44",
"output": "288596\n0 1 19 0 2 13 0 3 6 0 4 16 0 5 7 0 8 15 0 9 14 0 10 17 0 11 18 0 12 20 0 "
},
{
"input": "42 -34\n21\n4 62\n43 73\n29 -26\n68 83\n0 52\n-72 34\n-48 44\n64 41\n83 -12\n-25 52\n42 59\n1 38\n12 -79\n-56 -62\n-8 67\n84 -83\n22 -63\n-11 -56\n71 44\n7 55\n-62 65",
"output": "196482\n0 1 15 0 2 4 0 3 0 5 12 0 6 21 0 7 10 0 8 19 0 9 16 0 11 20 0 13 17 0 14 18 0 "
},
{
"input": "-44 42\n22\n-67 -15\n74 -14\n67 76\n-57 58\n-64 78\n29 33\n-27 27\n-20 -52\n-54 -2\n-29 22\n31 -65\n-76 -76\n-29 -51\n-5 -79\n-55 36\n72 36\n-80 -26\n5 60\n-26 69\n78 42\n-47 -84\n8 83",
"output": "181122\n0 1 17 0 2 16 0 3 20 0 4 5 0 6 18 0 7 10 0 8 13 0 9 15 0 11 14 0 12 21 0 19 22 0 "
},
{
"input": "52 92\n23\n-67 -82\n31 82\n-31 -14\n-1 35\n-31 -49\n-75 -14\n78 -51\n-35 -24\n28 -84\n44 -51\n-37 -9\n-38 -91\n41 57\n-19 35\n14 -88\n-60 -60\n-13 -91\n65 -8\n-30 -46\n72 -44\n74 -5\n-79 31\n-3 84",
"output": "492344\n0 1 12 0 2 23 0 3 11 0 4 14 0 5 16 0 6 22 0 7 20 0 8 19 0 9 10 0 13 0 15 17 0 18 21 0 "
},
{
"input": "-21 -47\n24\n-37 1\n-65 8\n-74 74\n58 -7\n81 -31\n-77 90\n-51 10\n-42 -37\n-14 -17\n-26 -71\n62 45\n56 43\n-75 -73\n-33 68\n39 10\n-65 -93\n61 -93\n30 69\n-28 -53\n5 24\n93 38\n-45 -14\n3 -86\n63 -80",
"output": "204138\n0 1 22 0 2 7 0 3 6 0 4 5 0 8 19 0 9 20 0 10 23 0 11 21 0 12 15 0 13 16 0 14 18 0 17 24 0 "
},
{
"input": "31 16\n21\n-9 24\n-59 9\n-25 51\n62 52\n39 15\n83 -24\n45 -81\n42 -62\n57 -56\n-7 -3\n54 47\n-14 -54\n-14 -34\n-19 -60\n-38 58\n68 -63\n-1 -49\n6 75\n-27 22\n-58 -77\n-10 56",
"output": "121890\n0 1 10 0 2 19 0 3 15 0 4 11 0 5 0 6 16 0 7 9 0 8 17 0 12 13 0 14 20 0 18 21 0 "
},
{
"input": "20 -1\n22\n-51 -31\n-41 24\n-19 46\n70 -54\n60 5\n-41 35\n73 -6\n-31 0\n-29 23\n85 9\n-7 -86\n8 65\n-86 66\n-35 14\n11 19\n-66 -34\n-36 61\n84 -10\n-58 -74\n-11 -67\n79 74\n3 -67",
"output": "135950\n0 1 16 0 2 6 0 3 12 0 4 18 0 5 7 0 8 14 0 9 15 0 10 21 0 11 22 0 13 17 0 19 20 0 "
},
{
"input": "-49 4\n23\n-18 -53\n-42 31\n18 -84\n-20 -70\n-12 74\n-72 81\n12 26\n3 9\n-70 -27\n34 -32\n74 -47\n-19 -35\n-46 -8\n-77 90\n7 -42\n81 25\n84 81\n-53 -49\n20 81\n-39 0\n-70 -44\n-63 77\n-67 -73",
"output": "169524\n0 1 4 0 2 22 0 3 15 0 5 19 0 6 14 0 7 8 0 9 21 0 10 11 0 12 13 0 16 17 0 18 23 0 20 0 "
},
{
"input": "-81 35\n24\n58 27\n92 -93\n-82 63\n-55 80\n20 67\n33 93\n-29 46\n-71 -51\n-19 8\n58 -71\n13 60\n0 -48\n-2 -68\n-56 53\n62 52\n64 32\n-12 -63\n-82 -22\n9 -43\n55 12\n77 -21\n26 -25\n-91 -32\n-66 57",
"output": "337256\n0 1 16 0 2 10 0 3 24 0 4 14 0 5 11 0 6 15 0 7 9 0 8 17 0 12 13 0 18 23 0 19 22 0 20 21 0 "
},
{
"input": "45 79\n24\n-66 22\n10 77\n74 88\n59 1\n-51 -86\n-60 91\n1 -51\n-23 85\n3 96\n38 -4\n-55 43\n9 -68\n-4 83\n75 -13\n64 -74\n28 27\n92 -57\n-20 -64\n30 -44\n-95 67\n13 55\n67 -4\n42 77\n61 87",
"output": "277576\n0 1 11 0 2 9 0 3 24 0 4 16 0 5 18 0 6 20 0 7 12 0 8 13 0 10 19 0 14 22 0 15 17 0 21 23 0 "
},
{
"input": "-61 34\n24\n-57 -46\n-37 -24\n-87 -54\n51 -89\n-90 2\n95 -63\n-24 -84\n-85 38\n-52 -62\n96 4\n89 -22\n-16 -3\n-2 -14\n71 -62\n-51 68\n-83 -24\n15 77\n-61 45\n17 -32\n-68 -87\n-93 -28\n-85 24\n-84 -34\n-4 1",
"output": "262400\n0 1 9 0 2 12 0 3 23 0 4 19 0 5 22 0 6 14 0 7 20 0 8 18 0 10 11 0 13 24 0 15 17 0 16 21 0 "
},
{
"input": "70 90\n24\n-64 -96\n-87 -82\n10 -65\n94 22\n95 60\n-13 54\n-83 -92\n95 -50\n-65 -91\n96 -88\n80 -56\n-31 85\n58 86\n-28 22\n-22 45\n-24 -12\n-62 70\n-2 -77\n-31 -72\n61 37\n67 43\n-5 -30\n-84 -59\n-91 51",
"output": "585696\n0 1 7 0 2 23 0 3 18 0 4 8 0 5 0 6 12 0 9 19 0 10 11 0 13 0 14 15 0 16 22 0 17 24 0 20 21 0 "
},
{
"input": "72 -37\n24\n56 -47\n-37 -20\n76 -46\n-14 11\n-63 -46\n52 74\n-60 -23\n27 8\n-78 -26\n15 -23\n74 -90\n39 -64\n86 53\n77 11\n-47 -44\n-1 -14\n90 56\n76 -88\n-27 51\n-67 -8\n-27 4\n83 -91\n54 68\n56 26",
"output": "224008\n0 1 3 0 2 7 0 4 19 0 5 15 0 6 23 0 8 10 0 9 20 0 11 12 0 13 17 0 14 24 0 16 21 0 18 22 0 "
},
{
"input": "9 -5\n10\n-22 23\n22 -26\n10 -32\n18 -34\n7 -27\n2 -38\n-5 -24\n-38 -15\n21 -32\n-17 37",
"output": "13454\n0 1 10 0 2 9 0 3 4 0 5 6 0 7 8 0 "
}
] | 1,696,422,606 | 2,147,483,647 |
Python 3
|
WRONG_ANSWER
|
TESTS
| 0 | 15 | 0 |
print('test')
# Wed Oct 04 2023 15:30:05 GMT+0300 (Moscow Standard Time)
|
Title: Looking for Order
Time Limit: 4 seconds
Memory Limit: 512 megabytes
Problem Description:
Girl Lena likes it when everything is in order, and looks for order everywhere. Once she was getting ready for the University and noticed that the room was in a mess — all the objects from her handbag were thrown about the room. Of course, she wanted to put them back into her handbag. The problem is that the girl cannot carry more than two objects at a time, and cannot move the handbag. Also, if he has taken an object, she cannot put it anywhere except her handbag — her inherent sense of order does not let her do so.
You are given the coordinates of the handbag and the coordinates of the objects in some Сartesian coordinate system. It is known that the girl covers the distance between any two objects in the time equal to the squared length of the segment between the points of the objects. It is also known that initially the coordinates of the girl and the handbag are the same. You are asked to find such an order of actions, that the girl can put all the objects back into her handbag in a minimum time period.
Input Specification:
The first line of the input file contains the handbag's coordinates *x**s*,<=*y**s*. The second line contains number *n* (1<=≤<=*n*<=≤<=24) — the amount of objects the girl has. The following *n* lines contain the objects' coordinates. All the coordinates do not exceed 100 in absolute value. All the given positions are different. All the numbers are integer.
Output Specification:
In the first line output the only number — the minimum time the girl needs to put the objects into her handbag.
In the second line output the possible optimum way for Lena. Each object in the input is described by its index number (from 1 to *n*), the handbag's point is described by number 0. The path should start and end in the handbag's point. If there are several optimal paths, print any of them.
Demo Input:
['0 0\n2\n1 1\n-1 1\n', '1 1\n3\n4 3\n3 4\n0 0\n']
Demo Output:
['8\n0 1 2 0 \n', '32\n0 1 2 0 3 0 \n']
Note:
none
|
```python
print('test')
# Wed Oct 04 2023 15:30:05 GMT+0300 (Moscow Standard Time)
```
| 0 |
699 |
B
|
One Bomb
|
PROGRAMMING
| 1,400 |
[
"implementation"
] | null | null |
You are given a description of a depot. It is a rectangular checkered field of *n*<=×<=*m* size. Each cell in a field can be empty (".") or it can be occupied by a wall ("*").
You have one bomb. If you lay the bomb at the cell (*x*,<=*y*), then after triggering it will wipe out all walls in the row *x* and all walls in the column *y*.
You are to determine if it is possible to wipe out all walls in the depot by placing and triggering exactly one bomb. The bomb can be laid both in an empty cell or in a cell occupied by a wall.
|
The first line contains two positive integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=1000) — the number of rows and columns in the depot field.
The next *n* lines contain *m* symbols "." and "*" each — the description of the field. *j*-th symbol in *i*-th of them stands for cell (*i*,<=*j*). If the symbol is equal to ".", then the corresponding cell is empty, otherwise it equals "*" and the corresponding cell is occupied by a wall.
|
If it is impossible to wipe out all walls by placing and triggering exactly one bomb, then print "NO" in the first line (without quotes).
Otherwise print "YES" (without quotes) in the first line and two integers in the second line — the coordinates of the cell at which the bomb should be laid. If there are multiple answers, print any of them.
|
[
"3 4\n.*..\n....\n.*..\n",
"3 3\n..*\n.*.\n*..\n",
"6 5\n..*..\n..*..\n*****\n..*..\n..*..\n..*..\n"
] |
[
"YES\n1 2\n",
"NO\n",
"YES\n3 3\n"
] |
none
| 1,000 |
[
{
"input": "3 4\n.*..\n....\n.*..",
"output": "YES\n1 2"
},
{
"input": "3 3\n..*\n.*.\n*..",
"output": "NO"
},
{
"input": "6 5\n..*..\n..*..\n*****\n..*..\n..*..\n..*..",
"output": "YES\n3 3"
},
{
"input": "1 10\n**********",
"output": "YES\n1 1"
},
{
"input": "10 1\n*\n*\n*\n*\n*\n*\n*\n*\n*\n*",
"output": "YES\n1 1"
},
{
"input": "10 10\n.........*\n.........*\n........**\n.........*\n.........*\n.........*\n.........*\n.........*\n.........*\n.........*",
"output": "YES\n3 10"
},
{
"input": "10 10\n.........*\n.........*\n.........*\n.........*\n.........*\n.........*\n.........*\n.........*\n.........*\n.........*",
"output": "YES\n1 10"
},
{
"input": "2 2\n.*\n*.",
"output": "YES\n2 2"
},
{
"input": "4 4\n....\n...*\n....\n*..*",
"output": "YES\n4 4"
},
{
"input": "4 4\n*...\n*...\n....\n****",
"output": "YES\n4 1"
},
{
"input": "1 1\n*",
"output": "YES\n1 1"
},
{
"input": "1 1\n.",
"output": "YES\n1 1"
},
{
"input": "1 2\n.*",
"output": "YES\n1 2"
},
{
"input": "2 1\n.\n*",
"output": "YES\n1 1"
},
{
"input": "2 2\n**\n**",
"output": "NO"
},
{
"input": "3 1\n*\n*\n*",
"output": "YES\n1 1"
},
{
"input": "3 2\n*.\n.*\n.*",
"output": "YES\n1 2"
},
{
"input": "3 3\n***\n***\n***",
"output": "NO"
},
{
"input": "2 2\n..\n.*",
"output": "YES\n1 2"
},
{
"input": "6 5\n..*..\n..*..\n**.**\n..*..\n..*..\n..*..",
"output": "YES\n3 3"
},
{
"input": "3 3\n.*.\n*.*\n.*.",
"output": "YES\n2 2"
},
{
"input": "4 4\n*...\n....\n....\n...*",
"output": "YES\n4 1"
},
{
"input": "2 4\n...*\n...*",
"output": "YES\n1 4"
},
{
"input": "2 2\n..\n..",
"output": "YES\n1 1"
},
{
"input": "3 3\n..*\n.*.\n..*",
"output": "YES\n2 3"
},
{
"input": "2 2\n*.\n.*",
"output": "YES\n2 1"
},
{
"input": "3 2\n.*\n*.\n.*",
"output": "YES\n2 2"
},
{
"input": "3 3\n***\n.*.\n.*.",
"output": "YES\n1 2"
},
{
"input": "4 4\n*.*.\n..*.\n.***\n..*.",
"output": "NO"
},
{
"input": "2 3\n..*\n**.",
"output": "YES\n2 3"
},
{
"input": "3 2\n*.\n.*\n*.",
"output": "YES\n2 1"
},
{
"input": "4 4\n..*.\n**.*\n..*.\n..*.",
"output": "YES\n2 3"
},
{
"input": "3 3\n*..\n*..\n***",
"output": "YES\n3 1"
},
{
"input": "3 3\n...\n*.*\n.*.",
"output": "YES\n2 2"
},
{
"input": "3 2\n..\n..\n**",
"output": "YES\n3 1"
},
{
"input": "3 4\n...*\n...*\n...*",
"output": "YES\n1 4"
},
{
"input": "5 5\n..*..\n..*..\n**.**\n..*..\n..*..",
"output": "YES\n3 3"
},
{
"input": "6 5\n..*..\n..*..\n*****\n..*..\n..*..\n..*.*",
"output": "NO"
},
{
"input": "3 3\n...\n.*.\n..*",
"output": "YES\n3 2"
},
{
"input": "3 5\n....*\n....*\n....*",
"output": "YES\n1 5"
},
{
"input": "3 3\n...\n...\n.*.",
"output": "YES\n1 2"
},
{
"input": "3 3\n*..\n...\n..*",
"output": "YES\n3 1"
},
{
"input": "2 3\n..*\n..*",
"output": "YES\n1 3"
},
{
"input": "2 2\n**\n.*",
"output": "YES\n1 2"
},
{
"input": "3 3\n..*\n*..\n*..",
"output": "YES\n1 1"
},
{
"input": "5 4\n.*..\n*.**\n.*..\n.*..\n.*..",
"output": "YES\n2 2"
},
{
"input": "6 5\n*.*..\n..*..\n*****\n..*..\n..*..\n..*..",
"output": "NO"
},
{
"input": "4 4\n.*..\n*.**\n....\n.*..",
"output": "YES\n2 2"
},
{
"input": "3 5\n....*\n....*\n*****",
"output": "YES\n3 5"
},
{
"input": "3 3\n..*\n*..\n..*",
"output": "YES\n2 3"
},
{
"input": "6 6\n..*...\n......\n......\n......\n......\n*....*",
"output": "YES\n6 3"
},
{
"input": "4 4\n.*..\n*...\n.*..\n.*..",
"output": "YES\n2 2"
},
{
"input": "3 3\n...\n..*\n.*.",
"output": "YES\n3 3"
},
{
"input": "3 2\n.*\n*.\n*.",
"output": "YES\n1 1"
},
{
"input": "4 2\n**\n.*\n.*\n.*",
"output": "YES\n1 2"
},
{
"input": "5 5\n*...*\n.....\n.....\n.....\n..*..",
"output": "YES\n1 3"
},
{
"input": "3 3\n**.\n...\n..*",
"output": "YES\n1 3"
},
{
"input": "3 3\n*.*\n*..\n*.*",
"output": "NO"
},
{
"input": "5 4\n....\n....\n*..*\n....\n.*..",
"output": "YES\n3 2"
},
{
"input": "5 5\n...*.\n...*.\n...*.\n...*.\n***.*",
"output": "YES\n5 4"
},
{
"input": "5 5\n*****\n*****\n*****\n*****\n*****",
"output": "NO"
},
{
"input": "3 3\n.*.\n..*\n.*.",
"output": "YES\n2 2"
},
{
"input": "3 3\n*.*\n...\n*.*",
"output": "NO"
},
{
"input": "2 3\n.*.\n*.*",
"output": "YES\n2 2"
},
{
"input": "3 10\n.......*..\n........*.\n.........*",
"output": "NO"
},
{
"input": "3 3\n.*.\n.*.\n.**",
"output": "YES\n3 2"
},
{
"input": "4 4\n*...\n....\n....\n..**",
"output": "YES\n4 1"
},
{
"input": "4 4\n****\n****\n****\n****",
"output": "NO"
},
{
"input": "3 2\n.*\n.*\n*.",
"output": "YES\n3 2"
},
{
"input": "3 3\n..*\n..*\n**.",
"output": "YES\n3 3"
},
{
"input": "6 3\n...\n...\n...\n...\n**.\n.*.",
"output": "YES\n5 2"
},
{
"input": "3 4\n****\n..*.\n..*.",
"output": "YES\n1 3"
},
{
"input": "5 5\n*..*.\n.....\n.....\n.....\n...*.",
"output": "YES\n1 4"
},
{
"input": "6 5\n..*..\n..*..\n.*...\n..*..\n..*..\n..*..",
"output": "YES\n3 3"
}
] | 1,570,859,568 | 2,147,483,647 |
Python 3
|
OK
|
TESTS
| 172 | 811 | 1,638,400 |
import sys
input= lambda:sys.stdin.readline()
MOD = 1000000007
ii = lambda: int(input())
si = lambda: input()
dgl = lambda: list(map(int, input()))
f = lambda: list(map(int, input().split()))
il = lambda: list(map(int, input().split()))
ls = lambda: list(input())
lr=[]
lc=[]
l=[]
n,m=f()
cnt=0
for _ in range(n):
x=si()
cnt=x.count('*')
lr.append(cnt)
l.append(x)
for i in range(m):
cnt=0
for j in range(n):
cnt+=(l[j][i]=='*')
lc.append(cnt)
tcnt=sum(lr)
for i in range(n):
for j in range(m):
if (lr[i]+lc[j]-(l[i][j]=='*'))==tcnt:
print('YES')
print(i+1,j+1)
exit()
print('NO')
|
Title: One Bomb
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You are given a description of a depot. It is a rectangular checkered field of *n*<=×<=*m* size. Each cell in a field can be empty (".") or it can be occupied by a wall ("*").
You have one bomb. If you lay the bomb at the cell (*x*,<=*y*), then after triggering it will wipe out all walls in the row *x* and all walls in the column *y*.
You are to determine if it is possible to wipe out all walls in the depot by placing and triggering exactly one bomb. The bomb can be laid both in an empty cell or in a cell occupied by a wall.
Input Specification:
The first line contains two positive integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=1000) — the number of rows and columns in the depot field.
The next *n* lines contain *m* symbols "." and "*" each — the description of the field. *j*-th symbol in *i*-th of them stands for cell (*i*,<=*j*). If the symbol is equal to ".", then the corresponding cell is empty, otherwise it equals "*" and the corresponding cell is occupied by a wall.
Output Specification:
If it is impossible to wipe out all walls by placing and triggering exactly one bomb, then print "NO" in the first line (without quotes).
Otherwise print "YES" (without quotes) in the first line and two integers in the second line — the coordinates of the cell at which the bomb should be laid. If there are multiple answers, print any of them.
Demo Input:
['3 4\n.*..\n....\n.*..\n', '3 3\n..*\n.*.\n*..\n', '6 5\n..*..\n..*..\n*****\n..*..\n..*..\n..*..\n']
Demo Output:
['YES\n1 2\n', 'NO\n', 'YES\n3 3\n']
Note:
none
|
```python
import sys
input= lambda:sys.stdin.readline()
MOD = 1000000007
ii = lambda: int(input())
si = lambda: input()
dgl = lambda: list(map(int, input()))
f = lambda: list(map(int, input().split()))
il = lambda: list(map(int, input().split()))
ls = lambda: list(input())
lr=[]
lc=[]
l=[]
n,m=f()
cnt=0
for _ in range(n):
x=si()
cnt=x.count('*')
lr.append(cnt)
l.append(x)
for i in range(m):
cnt=0
for j in range(n):
cnt+=(l[j][i]=='*')
lc.append(cnt)
tcnt=sum(lr)
for i in range(n):
for j in range(m):
if (lr[i]+lc[j]-(l[i][j]=='*'))==tcnt:
print('YES')
print(i+1,j+1)
exit()
print('NO')
```
| 3 |
|
37 |
A
|
Towers
|
PROGRAMMING
| 1,000 |
[
"sortings"
] |
A. Towers
|
2
|
256
|
Little Vasya has received a young builder’s kit. The kit consists of several wooden bars, the lengths of all of them are known. The bars can be put one on the top of the other if their lengths are the same.
Vasya wants to construct the minimal number of towers from the bars. Help Vasya to use the bars in the best way possible.
|
The first line contains an integer *N* (1<=≤<=*N*<=≤<=1000) — the number of bars at Vasya’s disposal. The second line contains *N* space-separated integers *l**i* — the lengths of the bars. All the lengths are natural numbers not exceeding 1000.
|
In one line output two numbers — the height of the largest tower and their total number. Remember that Vasya should use all the bars.
|
[
"3\n1 2 3\n",
"4\n6 5 6 7\n"
] |
[
"1 3\n",
"2 3\n"
] |
none
| 500 |
[
{
"input": "3\n1 2 3",
"output": "1 3"
},
{
"input": "4\n6 5 6 7",
"output": "2 3"
},
{
"input": "4\n3 2 1 1",
"output": "2 3"
},
{
"input": "4\n1 2 3 3",
"output": "2 3"
},
{
"input": "3\n20 22 36",
"output": "1 3"
},
{
"input": "25\n47 30 94 41 45 20 96 51 110 129 24 116 9 47 32 82 105 114 116 75 154 151 70 42 162",
"output": "2 23"
},
{
"input": "45\n802 664 442 318 318 827 417 878 711 291 231 414 807 553 657 392 279 202 386 606 465 655 658 112 887 15 25 502 95 44 679 775 942 609 209 871 31 234 4 231 150 110 22 823 193",
"output": "2 43"
},
{
"input": "63\n93 180 116 7 8 179 268 279 136 94 221 153 264 190 278 19 19 63 153 26 158 225 25 49 89 218 111 149 255 225 197 122 243 80 3 224 107 178 202 17 53 92 69 42 228 24 81 205 95 8 265 82 228 156 127 241 172 159 106 60 67 155 111",
"output": "2 57"
},
{
"input": "83\n246 535 994 33 390 927 321 97 223 922 812 705 79 80 977 457 476 636 511 137 6 360 815 319 717 674 368 551 714 628 278 713 761 553 184 414 623 753 428 214 581 115 439 61 677 216 772 592 187 603 658 310 439 559 870 376 109 321 189 337 277 26 70 734 796 907 979 693 570 227 345 650 737 633 701 914 134 403 972 940 371 6 642",
"output": "2 80"
},
{
"input": "105\n246 57 12 204 165 123 246 68 191 310 3 152 386 333 374 257 158 104 333 50 80 290 8 340 101 76 221 316 388 289 138 359 316 26 93 290 105 178 81 195 41 196 218 180 244 292 187 97 315 323 174 119 248 239 92 312 31 2 101 180 307 170 338 314 163 281 217 31 142 238 280 190 190 156 70 74 329 113 151 8 141 313 366 40 253 116 168 124 135 230 294 266 353 389 371 359 195 200 183 237 93 102 315 118 188",
"output": "2 92"
},
{
"input": "123\n112 277 170 247 252 115 157 293 256 143 196 90 12 164 164 42 8 223 167 109 175 232 239 111 148 51 9 254 93 32 268 162 231 91 47 162 161 191 195 145 247 292 129 199 230 94 144 217 18 205 176 20 143 198 121 243 211 262 230 277 195 255 108 290 220 275 158 2 286 200 60 267 278 207 123 150 123 116 131 13 12 226 33 244 30 275 263 45 158 192 254 149 242 176 62 224 221 288 250 160 155 225 132 143 276 293 218 145 197 175 33 129 79 206 210 192 222 262 190 52 274 243 233",
"output": "3 101"
},
{
"input": "5\n5 5 5 5 5",
"output": "5 1"
},
{
"input": "3\n1000 1000 1000",
"output": "3 1"
},
{
"input": "1\n1000",
"output": "1 1"
},
{
"input": "1\n1",
"output": "1 1"
},
{
"input": "5\n1 1000 1000 1000 1000",
"output": "4 2"
},
{
"input": "5\n1000 1000 1000 8 7",
"output": "3 3"
}
] | 1,587,289,564 | 2,147,483,647 |
Python 3
|
OK
|
TESTS
| 61 | 248 | 409,600 |
from collections import Counter
n = int(input())
l = list(map(int,input().split()))
count = Counter(l)
_max = 0
for i in count.keys():
_max = max(_max,count[i])
print(_max, len(set(l)))
|
Title: Towers
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Little Vasya has received a young builder’s kit. The kit consists of several wooden bars, the lengths of all of them are known. The bars can be put one on the top of the other if their lengths are the same.
Vasya wants to construct the minimal number of towers from the bars. Help Vasya to use the bars in the best way possible.
Input Specification:
The first line contains an integer *N* (1<=≤<=*N*<=≤<=1000) — the number of bars at Vasya’s disposal. The second line contains *N* space-separated integers *l**i* — the lengths of the bars. All the lengths are natural numbers not exceeding 1000.
Output Specification:
In one line output two numbers — the height of the largest tower and their total number. Remember that Vasya should use all the bars.
Demo Input:
['3\n1 2 3\n', '4\n6 5 6 7\n']
Demo Output:
['1 3\n', '2 3\n']
Note:
none
|
```python
from collections import Counter
n = int(input())
l = list(map(int,input().split()))
count = Counter(l)
_max = 0
for i in count.keys():
_max = max(_max,count[i])
print(_max, len(set(l)))
```
| 3.937237 |
281 |
A
|
Word Capitalization
|
PROGRAMMING
| 800 |
[
"implementation",
"strings"
] | null | null |
Capitalization is writing a word with its first letter as a capital letter. Your task is to capitalize the given word.
Note, that during capitalization all the letters except the first one remains unchanged.
|
A single line contains a non-empty word. This word consists of lowercase and uppercase English letters. The length of the word will not exceed 103.
|
Output the given word after capitalization.
|
[
"ApPLe\n",
"konjac\n"
] |
[
"ApPLe\n",
"Konjac\n"
] |
none
| 500 |
[
{
"input": "ApPLe",
"output": "ApPLe"
},
{
"input": "konjac",
"output": "Konjac"
},
{
"input": "a",
"output": "A"
},
{
"input": "A",
"output": "A"
},
{
"input": "z",
"output": "Z"
},
{
"input": "ABACABA",
"output": "ABACABA"
},
{
"input": "xYaPxPxHxGePfGtQySlNrLxSjDtNnTaRaEpAhPaQpWnDzMqGgRgEwJxGiBdZnMtHxFbObCaGiCeZkUqIgBhHtNvAqAlHpMnQhNeQbMyZrCdElVwHtKrPpJjIaHuIlYwHaRkAkUpPlOhNlBtXwDsKzPyHrPiUwNlXtTaPuMwTqYtJySgFoXvLiHbQwMjSvXsQfKhVlOxGdQkWjBhEyQvBjPoFkThNeRhTuIzFjInJtEfPjOlOsJpJuLgLzFnZmKvFgFrNsOnVqFcNiMfCqTpKnVyLwNqFiTySpWeTdFnWuTwDkRjVxNyQvTrOoEiExYiFaIrLoFmJfZcDkHuWjYfCeEqCvEsZiWnJaEmFbMjDvYwEeJeGcKbVbChGsIzNlExHzHiTlHcSaKxLuZxX",
"output": "XYaPxPxHxGePfGtQySlNrLxSjDtNnTaRaEpAhPaQpWnDzMqGgRgEwJxGiBdZnMtHxFbObCaGiCeZkUqIgBhHtNvAqAlHpMnQhNeQbMyZrCdElVwHtKrPpJjIaHuIlYwHaRkAkUpPlOhNlBtXwDsKzPyHrPiUwNlXtTaPuMwTqYtJySgFoXvLiHbQwMjSvXsQfKhVlOxGdQkWjBhEyQvBjPoFkThNeRhTuIzFjInJtEfPjOlOsJpJuLgLzFnZmKvFgFrNsOnVqFcNiMfCqTpKnVyLwNqFiTySpWeTdFnWuTwDkRjVxNyQvTrOoEiExYiFaIrLoFmJfZcDkHuWjYfCeEqCvEsZiWnJaEmFbMjDvYwEeJeGcKbVbChGsIzNlExHzHiTlHcSaKxLuZxX"
},
{
"input": "rZhIcQlXpNcPgXrOjTiOlMoTgXgIhCfMwZfWoFzGhEkQlOoMjIuShPlZfWkNnMyQfYdUhVgQuSmYoElEtZpDyHtOxXgCpWbZqSbYnPqBcNqRtPgCnJnAyIvNsAhRbNeVlMwZyRyJnFgIsCnSbOdLvUyIeOzQvRpMoMoHfNhHwKvTcHuYnYySfPmAiNwAiWdZnWlLvGfBbRbRrCrBqIgIdWkWiBsNyYkKdNxZdGaToSsDnXpRaGrKxBpQsCzBdQgZzBkGeHgGxNrIyQlSzWsTmSnZwOcHqQpNcQvJlPvKaPiQaMaYsQjUeCqQdCjPgUbDmWiJmNiXgExLqOcCtSwSePnUxIuZfIfBeWbEiVbXnUsPwWyAiXyRbZgKwOqFfCtQuKxEmVeRlAkOeXkO",
"output": "RZhIcQlXpNcPgXrOjTiOlMoTgXgIhCfMwZfWoFzGhEkQlOoMjIuShPlZfWkNnMyQfYdUhVgQuSmYoElEtZpDyHtOxXgCpWbZqSbYnPqBcNqRtPgCnJnAyIvNsAhRbNeVlMwZyRyJnFgIsCnSbOdLvUyIeOzQvRpMoMoHfNhHwKvTcHuYnYySfPmAiNwAiWdZnWlLvGfBbRbRrCrBqIgIdWkWiBsNyYkKdNxZdGaToSsDnXpRaGrKxBpQsCzBdQgZzBkGeHgGxNrIyQlSzWsTmSnZwOcHqQpNcQvJlPvKaPiQaMaYsQjUeCqQdCjPgUbDmWiJmNiXgExLqOcCtSwSePnUxIuZfIfBeWbEiVbXnUsPwWyAiXyRbZgKwOqFfCtQuKxEmVeRlAkOeXkO"
},
{
"input": "hDgZlUmLhYbLkLcNcKeOwJwTePbOvLaRvNzQbSbLsPeHqLhUqWtUbNdQfQqFfXeJqJwWuOrFnDdZiPxIkDyVmHbHvXfIlFqSgAcSyWbOlSlRuPhWdEpEzEeLnXwCtWuVcHaUeRgCiYsIvOaIgDnFuDbRnMoCmPrZfLeFpSjQaTfHgZwZvAzDuSeNwSoWuJvLqKqAuUxFaCxFfRcEjEsJpOfCtDiVrBqNsNwPuGoRgPzRpLpYnNyQxKaNnDnYiJrCrVcHlOxPiPcDbEgKfLwBjLhKcNeMgJhJmOiJvPfOaPaEuGqWvRbErKrIpDkEoQnKwJnTlStLyNsHyOjZfKoIjXwUvRrWpSyYhRpQdLqGmErAiNcGqAqIrTeTiMuPmCrEkHdBrLyCxPtYpRqD",
"output": "HDgZlUmLhYbLkLcNcKeOwJwTePbOvLaRvNzQbSbLsPeHqLhUqWtUbNdQfQqFfXeJqJwWuOrFnDdZiPxIkDyVmHbHvXfIlFqSgAcSyWbOlSlRuPhWdEpEzEeLnXwCtWuVcHaUeRgCiYsIvOaIgDnFuDbRnMoCmPrZfLeFpSjQaTfHgZwZvAzDuSeNwSoWuJvLqKqAuUxFaCxFfRcEjEsJpOfCtDiVrBqNsNwPuGoRgPzRpLpYnNyQxKaNnDnYiJrCrVcHlOxPiPcDbEgKfLwBjLhKcNeMgJhJmOiJvPfOaPaEuGqWvRbErKrIpDkEoQnKwJnTlStLyNsHyOjZfKoIjXwUvRrWpSyYhRpQdLqGmErAiNcGqAqIrTeTiMuPmCrEkHdBrLyCxPtYpRqD"
},
{
"input": "qUdLgGrJeGmIzIeZrCjUtBpYfRvNdXdRpGsThIsEmJjTiMqEwRxBeBaSxEuWrNvExKePjPnXhPzBpWnHiDhTvZhBuIjDnZpTcEkCvRkAcTmMuXhGgErWgFyGyToOyVwYlCuQpTfJkVdWmFyBqQhJjYtXrBbFdHzDlGsFbHmHbFgXgFhIyDhZyEqEiEwNxSeByBwLiVeSnCxIdHbGjOjJrZeVkOzGeMmQrJkVyGhDtCzOlPeAzGrBlWwEnAdUfVaIjNrRyJjCnHkUvFuKuKeKbLzSbEmUcXtVkZzXzKlOrPgQiDmCcCvIyAdBwOeUuLbRmScNcWxIkOkJuIsBxTrIqXhDzLcYdVtPgZdZfAxTmUtByGiTsJkSySjXdJvEwNmSmNoWsChPdAzJrBoW",
"output": "QUdLgGrJeGmIzIeZrCjUtBpYfRvNdXdRpGsThIsEmJjTiMqEwRxBeBaSxEuWrNvExKePjPnXhPzBpWnHiDhTvZhBuIjDnZpTcEkCvRkAcTmMuXhGgErWgFyGyToOyVwYlCuQpTfJkVdWmFyBqQhJjYtXrBbFdHzDlGsFbHmHbFgXgFhIyDhZyEqEiEwNxSeByBwLiVeSnCxIdHbGjOjJrZeVkOzGeMmQrJkVyGhDtCzOlPeAzGrBlWwEnAdUfVaIjNrRyJjCnHkUvFuKuKeKbLzSbEmUcXtVkZzXzKlOrPgQiDmCcCvIyAdBwOeUuLbRmScNcWxIkOkJuIsBxTrIqXhDzLcYdVtPgZdZfAxTmUtByGiTsJkSySjXdJvEwNmSmNoWsChPdAzJrBoW"
},
{
"input": "kHbApGoBcLmIwUlXkVgUmWzYeLoDbGaOkWbIuXoRwMfKuOoMzAoXrBoTvYxGrMbRjDuRxAbGsTnErIiHnHoLeRnTbFiRfDdOkNlWiAcOsChLdLqFqXlDpDoDtPxXqAmSvYgPvOcCpOlWtOjYwFkGkHuCaHwZcFdOfHjBmIxTeSiHkWjXyFcCtOlSuJsZkDxUgPeZkJwMmNpErUlBcGuMlJwKkWnOzFeFiSiPsEvMmQiCsYeHlLuHoMgBjFoZkXlObDkSoQcVyReTmRsFzRhTuIvCeBqVsQdQyTyZjStGrTyDcEcAgTgMiIcVkLbZbGvWeHtXwEqWkXfTcPyHhHjYwIeVxLyVmHmMkUsGiHmNnQuMsXaFyPpVqNrBhOiWmNkBbQuHvQdOjPjKiZcL",
"output": "KHbApGoBcLmIwUlXkVgUmWzYeLoDbGaOkWbIuXoRwMfKuOoMzAoXrBoTvYxGrMbRjDuRxAbGsTnErIiHnHoLeRnTbFiRfDdOkNlWiAcOsChLdLqFqXlDpDoDtPxXqAmSvYgPvOcCpOlWtOjYwFkGkHuCaHwZcFdOfHjBmIxTeSiHkWjXyFcCtOlSuJsZkDxUgPeZkJwMmNpErUlBcGuMlJwKkWnOzFeFiSiPsEvMmQiCsYeHlLuHoMgBjFoZkXlObDkSoQcVyReTmRsFzRhTuIvCeBqVsQdQyTyZjStGrTyDcEcAgTgMiIcVkLbZbGvWeHtXwEqWkXfTcPyHhHjYwIeVxLyVmHmMkUsGiHmNnQuMsXaFyPpVqNrBhOiWmNkBbQuHvQdOjPjKiZcL"
},
{
"input": "aHmRbLgNuWkLxLnWvUbYwTeZeYiOlLhTuOvKfLnVmCiPcMkSgVrYjZiLuRjCiXhAnVzVcTlVeJdBvPdDfFvHkTuIhCdBjEsXbVmGcLrPfNvRdFsZkSdNpYsJeIhIcNqSoLkOjUlYlDmXsOxPbQtIoUxFjGnRtBhFaJvBeEzHsAtVoQbAfYjJqReBiKeUwRqYrUjPjBoHkOkPzDwEwUgTxQxAvKzUpMhKyOhPmEhYhItQwPeKsKaKlUhGuMcTtSwFtXfJsDsFlTtOjVvVfGtBtFlQyIcBaMsPaJlPqUcUvLmReZiFbXxVtRhTzJkLkAjVqTyVuFeKlTyQgUzMsXjOxQnVfTaWmThEnEoIhZeZdStBkKeLpAhJnFoJvQyGwDiStLjEwGfZwBuWsEfC",
"output": "AHmRbLgNuWkLxLnWvUbYwTeZeYiOlLhTuOvKfLnVmCiPcMkSgVrYjZiLuRjCiXhAnVzVcTlVeJdBvPdDfFvHkTuIhCdBjEsXbVmGcLrPfNvRdFsZkSdNpYsJeIhIcNqSoLkOjUlYlDmXsOxPbQtIoUxFjGnRtBhFaJvBeEzHsAtVoQbAfYjJqReBiKeUwRqYrUjPjBoHkOkPzDwEwUgTxQxAvKzUpMhKyOhPmEhYhItQwPeKsKaKlUhGuMcTtSwFtXfJsDsFlTtOjVvVfGtBtFlQyIcBaMsPaJlPqUcUvLmReZiFbXxVtRhTzJkLkAjVqTyVuFeKlTyQgUzMsXjOxQnVfTaWmThEnEoIhZeZdStBkKeLpAhJnFoJvQyGwDiStLjEwGfZwBuWsEfC"
},
{
"input": "sLlZkDiDmEdNaXuUuJwHqYvRtOdGfTiTpEpAoSqAbJaChOiCvHgSwZwEuPkMmXiLcKdXqSsEyViEbZpZsHeZpTuXoGcRmOiQfBfApPjDqSqElWeSeOhUyWjLyNoRuYeGfGwNqUsQoTyVvWeNgNdZfDxGwGfLsDjIdInSqDlMuNvFaHbScZkTlVwNcJpEjMaPaOtFgJjBjOcLlLmDnQrShIrJhOcUmPnZhTxNeClQsZaEaVaReLyQpLwEqJpUwYhLiRzCzKfOoFeTiXzPiNbOsZaZaLgCiNnMkBcFwGgAwPeNyTxJcCtBgXcToKlWaWcBaIvBpNxPeClQlWeQqRyEtAkJdBtSrFdDvAbUlKyLdCuTtXxFvRcKnYnWzVdYqDeCmOqPxUaFjQdTdCtN",
"output": "SLlZkDiDmEdNaXuUuJwHqYvRtOdGfTiTpEpAoSqAbJaChOiCvHgSwZwEuPkMmXiLcKdXqSsEyViEbZpZsHeZpTuXoGcRmOiQfBfApPjDqSqElWeSeOhUyWjLyNoRuYeGfGwNqUsQoTyVvWeNgNdZfDxGwGfLsDjIdInSqDlMuNvFaHbScZkTlVwNcJpEjMaPaOtFgJjBjOcLlLmDnQrShIrJhOcUmPnZhTxNeClQsZaEaVaReLyQpLwEqJpUwYhLiRzCzKfOoFeTiXzPiNbOsZaZaLgCiNnMkBcFwGgAwPeNyTxJcCtBgXcToKlWaWcBaIvBpNxPeClQlWeQqRyEtAkJdBtSrFdDvAbUlKyLdCuTtXxFvRcKnYnWzVdYqDeCmOqPxUaFjQdTdCtN"
},
{
"input": "iRuStKvVhJdJbQwRoIuLiVdTpKaOqKfYlYwAzIpPtUwUtMeKyCaOlXmVrKwWeImYmVuXdLkRlHwFxKqZbZtTzNgOzDbGqTfZnKmUzAcIjDcEmQgYyFbEfWzRpKvCkDmAqDiIiRcLvMxWaJqCgYqXgIcLdNaZlBnXtJyKaMnEaWfXfXwTbDnAiYnWqKbAtDpYdUbZrCzWgRnHzYxFgCdDbOkAgTqBuLqMeStHcDxGnVhSgMzVeTaZoTfLjMxQfRuPcFqVlRyYdHyOdJsDoCeWrUuJyIiAqHwHyVpEeEoMaJwAoUfPtBeJqGhMaHiBjKwAlXoZpUsDhHgMxBkVbLcEvNtJbGnPsUwAvXrAkTlXwYvEnOpNeWyIkRnEnTrIyAcLkRgMyYcKrGiDaAyE",
"output": "IRuStKvVhJdJbQwRoIuLiVdTpKaOqKfYlYwAzIpPtUwUtMeKyCaOlXmVrKwWeImYmVuXdLkRlHwFxKqZbZtTzNgOzDbGqTfZnKmUzAcIjDcEmQgYyFbEfWzRpKvCkDmAqDiIiRcLvMxWaJqCgYqXgIcLdNaZlBnXtJyKaMnEaWfXfXwTbDnAiYnWqKbAtDpYdUbZrCzWgRnHzYxFgCdDbOkAgTqBuLqMeStHcDxGnVhSgMzVeTaZoTfLjMxQfRuPcFqVlRyYdHyOdJsDoCeWrUuJyIiAqHwHyVpEeEoMaJwAoUfPtBeJqGhMaHiBjKwAlXoZpUsDhHgMxBkVbLcEvNtJbGnPsUwAvXrAkTlXwYvEnOpNeWyIkRnEnTrIyAcLkRgMyYcKrGiDaAyE"
},
{
"input": "cRtJkOxHzUbJcDdHzJtLbVmSoWuHoTkVrPqQaVmXeBrHxJbQfNrQbAaMrEhVdQnPxNyCjErKxPoEdWkVrBbDeNmEgBxYiBtWdAfHiLuSwIxJuHpSkAxPoYdNkGoLySsNhUmGoZhDzAfWhJdPlJzQkZbOnMtTkClIoCqOlIcJcMlGjUyOiEmHdYfIcPtTgQhLlLcPqQjAnQnUzHpCaQsCnYgQsBcJrQwBnWsIwFfSfGuYgTzQmShFpKqEeRlRkVfMuZbUsDoFoPrNuNwTtJqFkRiXxPvKyElDzLoUnIwAaBaOiNxMpEvPzSpGpFhMtGhGdJrFnZmNiMcUfMtBnDuUnXqDcMsNyGoLwLeNnLfRsIwRfBtXkHrFcPsLdXaAoYaDzYnZuQeVcZrElWmP",
"output": "CRtJkOxHzUbJcDdHzJtLbVmSoWuHoTkVrPqQaVmXeBrHxJbQfNrQbAaMrEhVdQnPxNyCjErKxPoEdWkVrBbDeNmEgBxYiBtWdAfHiLuSwIxJuHpSkAxPoYdNkGoLySsNhUmGoZhDzAfWhJdPlJzQkZbOnMtTkClIoCqOlIcJcMlGjUyOiEmHdYfIcPtTgQhLlLcPqQjAnQnUzHpCaQsCnYgQsBcJrQwBnWsIwFfSfGuYgTzQmShFpKqEeRlRkVfMuZbUsDoFoPrNuNwTtJqFkRiXxPvKyElDzLoUnIwAaBaOiNxMpEvPzSpGpFhMtGhGdJrFnZmNiMcUfMtBnDuUnXqDcMsNyGoLwLeNnLfRsIwRfBtXkHrFcPsLdXaAoYaDzYnZuQeVcZrElWmP"
},
{
"input": "wVaCsGxZrBbFnTbKsCoYlAvUkIpBaYpYmJkMlPwCaFvUkDxAiJgIqWsFqZlFvTtAnGzEwXbYiBdFfFxRiDoUkLmRfAwOlKeOlKgXdUnVqLkTuXtNdQpBpXtLvZxWoBeNePyHcWmZyRiUkPlRqYiQdGeXwOhHbCqVjDcEvJmBkRwWnMqPjXpUsIyXqGjHsEsDwZiFpIbTkQaUlUeFxMwJzSaHdHnDhLaLdTuYgFuJsEcMmDvXyPjKsSeBaRwNtPuOuBtNeOhQdVgKzPzOdYtPjPfDzQzHoWcYjFbSvRgGdGsCmGnQsErToBkCwGeQaCbBpYkLhHxTbUvRnJpZtXjKrHdRiUmUbSlJyGaLnWsCrJbBnSjFaZrIzIrThCmGhQcMsTtOxCuUcRaEyPaG",
"output": "WVaCsGxZrBbFnTbKsCoYlAvUkIpBaYpYmJkMlPwCaFvUkDxAiJgIqWsFqZlFvTtAnGzEwXbYiBdFfFxRiDoUkLmRfAwOlKeOlKgXdUnVqLkTuXtNdQpBpXtLvZxWoBeNePyHcWmZyRiUkPlRqYiQdGeXwOhHbCqVjDcEvJmBkRwWnMqPjXpUsIyXqGjHsEsDwZiFpIbTkQaUlUeFxMwJzSaHdHnDhLaLdTuYgFuJsEcMmDvXyPjKsSeBaRwNtPuOuBtNeOhQdVgKzPzOdYtPjPfDzQzHoWcYjFbSvRgGdGsCmGnQsErToBkCwGeQaCbBpYkLhHxTbUvRnJpZtXjKrHdRiUmUbSlJyGaLnWsCrJbBnSjFaZrIzIrThCmGhQcMsTtOxCuUcRaEyPaG"
},
{
"input": "kEiLxLmPjGzNoGkJdBlAfXhThYhMsHmZoZbGyCvNiUoLoZdAxUbGyQiEfXvPzZzJrPbEcMpHsMjIkRrVvDvQtHuKmXvGpQtXbPzJpFjJdUgWcPdFxLjLtXgVpEiFhImHnKkGiWnZbJqRjCyEwHsNbYfYfTyBaEuKlCtWnOqHmIgGrFmQiYrBnLiFcGuZxXlMfEuVoCxPkVrQvZoIpEhKsYtXrPxLcSfQqXsWaDgVlOnAzUvAhOhMrJfGtWcOwQfRjPmGhDyAeXrNqBvEiDfCiIvWxPjTwPlXpVsMjVjUnCkXgBuWnZaDyJpWkCfBrWnHxMhJgItHdRqNrQaEeRjAuUwRkUdRhEeGlSqVqGmOjNcUhFfXjCmWzBrGvIuZpRyWkWiLyUwFpYjNmNfV",
"output": "KEiLxLmPjGzNoGkJdBlAfXhThYhMsHmZoZbGyCvNiUoLoZdAxUbGyQiEfXvPzZzJrPbEcMpHsMjIkRrVvDvQtHuKmXvGpQtXbPzJpFjJdUgWcPdFxLjLtXgVpEiFhImHnKkGiWnZbJqRjCyEwHsNbYfYfTyBaEuKlCtWnOqHmIgGrFmQiYrBnLiFcGuZxXlMfEuVoCxPkVrQvZoIpEhKsYtXrPxLcSfQqXsWaDgVlOnAzUvAhOhMrJfGtWcOwQfRjPmGhDyAeXrNqBvEiDfCiIvWxPjTwPlXpVsMjVjUnCkXgBuWnZaDyJpWkCfBrWnHxMhJgItHdRqNrQaEeRjAuUwRkUdRhEeGlSqVqGmOjNcUhFfXjCmWzBrGvIuZpRyWkWiLyUwFpYjNmNfV"
},
{
"input": "eIhDoLmDeReKqXsHcVgFxUqNfScAiQnFrTlCgSuTtXiYvBxKaPaGvUeYfSgHqEaWcHxKpFaSlCxGqAmNeFcIzFcZsBiVoZhUjXaDaIcKoBzYdIlEnKfScRqSkYpPtVsVhXsBwUsUfAqRoCkBxWbHgDiCkRtPvUwVgDjOzObYwNiQwXlGnAqEkHdSqLgUkOdZiWaHqQnOhUnDhIzCiQtVcJlGoRfLuVlFjWqSuMsLgLwOdZvKtWdRuRqDoBoInKqPbJdXpIqLtFlMlDaWgSiKbFpCxOnQeNeQzXeKsBzIjCyPxCmBnYuHzQoYxZgGzSgGtZiTeQmUeWlNzZeKiJbQmEjIiDhPeSyZlNdHpZnIkPdJzSeJpPiXxToKyBjJfPwNzZpWzIzGySqPxLtI",
"output": "EIhDoLmDeReKqXsHcVgFxUqNfScAiQnFrTlCgSuTtXiYvBxKaPaGvUeYfSgHqEaWcHxKpFaSlCxGqAmNeFcIzFcZsBiVoZhUjXaDaIcKoBzYdIlEnKfScRqSkYpPtVsVhXsBwUsUfAqRoCkBxWbHgDiCkRtPvUwVgDjOzObYwNiQwXlGnAqEkHdSqLgUkOdZiWaHqQnOhUnDhIzCiQtVcJlGoRfLuVlFjWqSuMsLgLwOdZvKtWdRuRqDoBoInKqPbJdXpIqLtFlMlDaWgSiKbFpCxOnQeNeQzXeKsBzIjCyPxCmBnYuHzQoYxZgGzSgGtZiTeQmUeWlNzZeKiJbQmEjIiDhPeSyZlNdHpZnIkPdJzSeJpPiXxToKyBjJfPwNzZpWzIzGySqPxLtI"
},
{
"input": "uOoQzIeTwYeKpJtGoUdNiXbPgEwVsZkAnJcArHxIpEnEhZwQhZvAiOuLeMkVqLeDsAyKeYgFxGmRoLaRsZjAeXgNfYhBkHeDrHdPuTuYhKmDlAvYzYxCdYgYfVaYlGeVqTeSfBxQePbQrKsTaIkGzMjFrQlJuYaMxWpQkLdEcDsIiMnHnDtThRvAcKyGwBsHqKdXpJfIeTeZtYjFbMeUoXoXzGrShTwSwBpQlKeDrZdCjRqNtXoTsIzBkWbMsObTtDvYaPhUeLeHqHeMpZmTaCcIqXzAmGnPfNdDaFhOqWqDrWuFiBpRjZrQmAdViOuMbFfRyXyWfHgRkGpPnDrEqQcEmHcKpEvWlBrOtJbUaXbThJaSxCbVoGvTmHvZrHvXpCvLaYbRiHzYuQyX",
"output": "UOoQzIeTwYeKpJtGoUdNiXbPgEwVsZkAnJcArHxIpEnEhZwQhZvAiOuLeMkVqLeDsAyKeYgFxGmRoLaRsZjAeXgNfYhBkHeDrHdPuTuYhKmDlAvYzYxCdYgYfVaYlGeVqTeSfBxQePbQrKsTaIkGzMjFrQlJuYaMxWpQkLdEcDsIiMnHnDtThRvAcKyGwBsHqKdXpJfIeTeZtYjFbMeUoXoXzGrShTwSwBpQlKeDrZdCjRqNtXoTsIzBkWbMsObTtDvYaPhUeLeHqHeMpZmTaCcIqXzAmGnPfNdDaFhOqWqDrWuFiBpRjZrQmAdViOuMbFfRyXyWfHgRkGpPnDrEqQcEmHcKpEvWlBrOtJbUaXbThJaSxCbVoGvTmHvZrHvXpCvLaYbRiHzYuQyX"
},
{
"input": "lZqBqKeGvNdSeYuWxRiVnFtYbKuJwQtUcKnVtQhAlOeUzMaAuTaEnDdPfDcNyHgEoBmYjZyFePeJrRiKyAzFnBfAuGiUyLrIeLrNhBeBdVcEeKgCcBrQzDsPwGcNnZvTsEaYmFfMeOmMdNuZbUtDoQoNcGwDqEkEjIdQaPwAxJbXeNxOgKgXoEbZiIsVkRrNpNyAkLeHkNfEpLuQvEcMbIoGaDzXbEtNsLgGfOkZaFiUsOvEjVeCaMcZqMzKeAdXxJsVeCrZaFpJtZxInQxFaSmGgSsVyGeLlFgFqTpIbAvPkIfJrVcJeBxSdEvPyVwIjHpYrLrKqLnAmCuGmPoZrSbOtGaLaTmBmSuUyAmAsRiMqOtRjJhPhAfXaJnTpLbFqPmJgFcBxImTqIiJ",
"output": "LZqBqKeGvNdSeYuWxRiVnFtYbKuJwQtUcKnVtQhAlOeUzMaAuTaEnDdPfDcNyHgEoBmYjZyFePeJrRiKyAzFnBfAuGiUyLrIeLrNhBeBdVcEeKgCcBrQzDsPwGcNnZvTsEaYmFfMeOmMdNuZbUtDoQoNcGwDqEkEjIdQaPwAxJbXeNxOgKgXoEbZiIsVkRrNpNyAkLeHkNfEpLuQvEcMbIoGaDzXbEtNsLgGfOkZaFiUsOvEjVeCaMcZqMzKeAdXxJsVeCrZaFpJtZxInQxFaSmGgSsVyGeLlFgFqTpIbAvPkIfJrVcJeBxSdEvPyVwIjHpYrLrKqLnAmCuGmPoZrSbOtGaLaTmBmSuUyAmAsRiMqOtRjJhPhAfXaJnTpLbFqPmJgFcBxImTqIiJ"
},
{
"input": "P",
"output": "P"
},
{
"input": "Xyzzy",
"output": "Xyzzy"
},
{
"input": "Zzz",
"output": "Zzz"
},
{
"input": "Zp",
"output": "Zp"
}
] | 1,698,780,151 | 2,147,483,647 |
PyPy 3-64
|
WRONG_ANSWER
|
TESTS
| 0 | 92 | 0 |
word = input()
word = word.capitalize()
print(word)
|
Title: Word Capitalization
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Capitalization is writing a word with its first letter as a capital letter. Your task is to capitalize the given word.
Note, that during capitalization all the letters except the first one remains unchanged.
Input Specification:
A single line contains a non-empty word. This word consists of lowercase and uppercase English letters. The length of the word will not exceed 103.
Output Specification:
Output the given word after capitalization.
Demo Input:
['ApPLe\n', 'konjac\n']
Demo Output:
['ApPLe\n', 'Konjac\n']
Note:
none
|
```python
word = input()
word = word.capitalize()
print(word)
```
| 0 |
|
6 |
C
|
Alice, Bob and Chocolate
|
PROGRAMMING
| 1,200 |
[
"greedy",
"two pointers"
] |
C. Alice, Bob and Chocolate
|
2
|
64
|
Alice and Bob like games. And now they are ready to start a new game. They have placed *n* chocolate bars in a line. Alice starts to eat chocolate bars one by one from left to right, and Bob — from right to left. For each chocololate bar the time, needed for the player to consume it, is known (Alice and Bob eat them with equal speed). When the player consumes a chocolate bar, he immediately starts with another. It is not allowed to eat two chocolate bars at the same time, to leave the bar unfinished and to make pauses. If both players start to eat the same bar simultaneously, Bob leaves it to Alice as a true gentleman.
How many bars each of the players will consume?
|
The first line contains one integer *n* (1<=≤<=*n*<=≤<=105) — the amount of bars on the table. The second line contains a sequence *t*1,<=*t*2,<=...,<=*t**n* (1<=≤<=*t**i*<=≤<=1000), where *t**i* is the time (in seconds) needed to consume the *i*-th bar (in the order from left to right).
|
Print two numbers *a* and *b*, where *a* is the amount of bars consumed by Alice, and *b* is the amount of bars consumed by Bob.
|
[
"5\n2 9 8 2 7\n"
] |
[
"2 3\n"
] |
none
| 0 |
[
{
"input": "5\n2 9 8 2 7",
"output": "2 3"
},
{
"input": "1\n1",
"output": "1 0"
},
{
"input": "2\n1 1",
"output": "1 1"
},
{
"input": "3\n1 1 1",
"output": "2 1"
},
{
"input": "4\n1 1 1 1",
"output": "2 2"
},
{
"input": "1\n6",
"output": "1 0"
},
{
"input": "2\n8 2",
"output": "1 1"
},
{
"input": "3\n6 8 4",
"output": "1 2"
},
{
"input": "4\n4 3 2 8",
"output": "3 1"
},
{
"input": "5\n1 9 8 2 7",
"output": "2 3"
},
{
"input": "6\n1 4 7 3 2 1",
"output": "3 3"
},
{
"input": "11\n7 9 1 8 7 1 7 1 4 8 1",
"output": "4 7"
},
{
"input": "12\n4 2 7 1 9 5 6 2 7 8 5 7",
"output": "7 5"
},
{
"input": "13\n9 9 9 9 9 9 9 9 9 9 9 9 9",
"output": "7 6"
}
] | 1,669,400,389 | 2,147,483,647 |
PyPy 3
|
WRONG_ANSWER
|
TESTS
| 0 | 154 | 0 |
choco = int(input("Кол-во шоколадок: "))
time = input("Время: ")
lst = time.split()
lst = list(map(int, lst))
counterAlisa = 0
counterBob = 0
def result():
global counterBob,counterAlisa
print(f"Bob:{counterBob}, Alisa:{counterAlisa}")
def eat(timeAlisa,timeBob):
global counterBob, counterAlisa
if len(lst) == 1:
counterAlisa += 1
return result()
timeBob -= 1
timeAlisa -= 1
if timeBob == 0 and timeAlisa == 0:
counterBob += 1
counterAlisa += 1
if len(lst) >= 2:
lst.pop(0)
lst.pop(-1)
if len(lst) > 1:
eat(lst[0],lst[-1])
elif len(lst) == 1:
counterAlisa += 1
result()
else:
result()
elif timeBob > 0 and timeAlisa == 0:
counterAlisa += 1
if len(lst) == 1:
counterAlisa += 1
counterBob += 1
result()
elif len(lst) == 2:
lst[-1] = timeBob
lst.pop(0)
counterBob += 1
result()
else:
lst[-1] = timeBob
lst.pop(0)
eat(lst[0],lst[-1])
print(lst[0],lst[-1])
elif timeBob == 0 and timeAlisa > 0:
counterBob += 1
if len(lst) == 1:
counterAlisa += 1
counterBob += 1
result()
elif len(lst) == 2:
lst[0] = timeAlisa
lst.pop(-1)
counterAlisa += 1
result()
else:
lst[0] = timeAlisa
lst.pop(-1)
eat(lst[0], lst[-1])
else:
print(timeBob,timeAlisa)
eat(timeAlisa,timeBob)
eat(lst[0],lst[-1])
|
Title: Alice, Bob and Chocolate
Time Limit: 2 seconds
Memory Limit: 64 megabytes
Problem Description:
Alice and Bob like games. And now they are ready to start a new game. They have placed *n* chocolate bars in a line. Alice starts to eat chocolate bars one by one from left to right, and Bob — from right to left. For each chocololate bar the time, needed for the player to consume it, is known (Alice and Bob eat them with equal speed). When the player consumes a chocolate bar, he immediately starts with another. It is not allowed to eat two chocolate bars at the same time, to leave the bar unfinished and to make pauses. If both players start to eat the same bar simultaneously, Bob leaves it to Alice as a true gentleman.
How many bars each of the players will consume?
Input Specification:
The first line contains one integer *n* (1<=≤<=*n*<=≤<=105) — the amount of bars on the table. The second line contains a sequence *t*1,<=*t*2,<=...,<=*t**n* (1<=≤<=*t**i*<=≤<=1000), where *t**i* is the time (in seconds) needed to consume the *i*-th bar (in the order from left to right).
Output Specification:
Print two numbers *a* and *b*, where *a* is the amount of bars consumed by Alice, and *b* is the amount of bars consumed by Bob.
Demo Input:
['5\n2 9 8 2 7\n']
Demo Output:
['2 3\n']
Note:
none
|
```python
choco = int(input("Кол-во шоколадок: "))
time = input("Время: ")
lst = time.split()
lst = list(map(int, lst))
counterAlisa = 0
counterBob = 0
def result():
global counterBob,counterAlisa
print(f"Bob:{counterBob}, Alisa:{counterAlisa}")
def eat(timeAlisa,timeBob):
global counterBob, counterAlisa
if len(lst) == 1:
counterAlisa += 1
return result()
timeBob -= 1
timeAlisa -= 1
if timeBob == 0 and timeAlisa == 0:
counterBob += 1
counterAlisa += 1
if len(lst) >= 2:
lst.pop(0)
lst.pop(-1)
if len(lst) > 1:
eat(lst[0],lst[-1])
elif len(lst) == 1:
counterAlisa += 1
result()
else:
result()
elif timeBob > 0 and timeAlisa == 0:
counterAlisa += 1
if len(lst) == 1:
counterAlisa += 1
counterBob += 1
result()
elif len(lst) == 2:
lst[-1] = timeBob
lst.pop(0)
counterBob += 1
result()
else:
lst[-1] = timeBob
lst.pop(0)
eat(lst[0],lst[-1])
print(lst[0],lst[-1])
elif timeBob == 0 and timeAlisa > 0:
counterBob += 1
if len(lst) == 1:
counterAlisa += 1
counterBob += 1
result()
elif len(lst) == 2:
lst[0] = timeAlisa
lst.pop(-1)
counterAlisa += 1
result()
else:
lst[0] = timeAlisa
lst.pop(-1)
eat(lst[0], lst[-1])
else:
print(timeBob,timeAlisa)
eat(timeAlisa,timeBob)
eat(lst[0],lst[-1])
```
| 0 |
14 |
B
|
Young Photographer
|
PROGRAMMING
| 1,000 |
[
"implementation"
] |
B. Young Photographer
|
2
|
64
|
Among other things, Bob is keen on photography. Especially he likes to take pictures of sportsmen. That was the reason why he placed himself in position *x*0 of a long straight racetrack and got ready to take pictures. But the problem was that not all the runners passed him. The total amount of sportsmen, training at that racetrack, equals *n*. And each of them regularly runs distances within a particular segment of the racetrack, which is the same for each sportsman. For example, the first sportsman runs from position *a*1 to position *b*1, the second — from *a*2 to *b*2
What is the minimum distance that Bob should move to have a chance to take pictures of each sportsman? Bob can take a picture of a sportsman, if he stands within the segment that this sportsman covers on the racetrack.
|
The first line of the input file contains integers *n* and *x*0 (1<=≤<=*n*<=≤<=100; 0<=≤<=*x*0<=≤<=1000). The following *n* lines contain pairs of integers *a**i*,<=*b**i* (0<=≤<=*a**i*,<=*b**i*<=≤<=1000; *a**i*<=≠<=*b**i*).
|
Output the required minimum distance in the same units as the positions on the racetrack. If there is no such a position, output -1.
|
[
"3 3\n0 7\n14 2\n4 6\n"
] |
[
"1\n"
] |
none
| 0 |
[
{
"input": "3 3\n0 7\n14 2\n4 6",
"output": "1"
},
{
"input": "1 1\n0 10",
"output": "0"
},
{
"input": "2 2\n1 2\n3 2",
"output": "0"
},
{
"input": "3 2\n1 2\n2 3\n3 4",
"output": "-1"
},
{
"input": "2 4\n10 4\n1 5",
"output": "0"
},
{
"input": "1 10\n1 9",
"output": "1"
},
{
"input": "1 10\n123 12",
"output": "2"
},
{
"input": "1 17\n10 17",
"output": "0"
},
{
"input": "1 22\n22 33",
"output": "0"
},
{
"input": "1 3\n1 2",
"output": "1"
},
{
"input": "2 5\n0 3\n2 1",
"output": "3"
},
{
"input": "3 3\n7 3\n6 4\n3 7",
"output": "1"
},
{
"input": "4 9\n8 6\n11 5\n5 11\n8 3",
"output": "1"
},
{
"input": "2 4\n1 4\n4 0",
"output": "0"
},
{
"input": "3 7\n5 8\n7 5\n4 7",
"output": "0"
},
{
"input": "4 7\n8 2\n5 7\n8 2\n5 8",
"output": "0"
},
{
"input": "2 3\n4 1\n4 1",
"output": "0"
},
{
"input": "3 8\n7 2\n3 7\n5 2",
"output": "3"
},
{
"input": "4 0\n9 1\n8 1\n8 4\n4 5",
"output": "4"
},
{
"input": "4 7\n2 5\n3 6\n3 5\n7 4",
"output": "2"
},
{
"input": "10 16\n4 18\n6 19\n22 1\n23 0\n1 22\n9 22\n4 19\n0 14\n6 14\n0 16",
"output": "2"
},
{
"input": "20 1\n35 8\n40 6\n49 5\n48 18\n46 16\n45 16\n44 10\n16 44\n8 46\n2 45\n38 3\n42 1\n13 35\n35 18\n12 33\n32 11\n31 3\n50 20\n47 6\n38 2",
"output": "19"
},
{
"input": "30 43\n17 72\n75 26\n23 69\n83 30\n15 82\n4 67\n83 27\n33 62\n26 83\n70 26\n69 25\n16 67\n77 26\n66 33\n7 88\n70 9\n10 79\n76 9\n30 77\n77 28\n21 68\n81 14\n13 72\n88 15\n60 29\n87 28\n16 58\n6 58\n71 9\n83 18",
"output": "0"
},
{
"input": "40 69\n29 109\n28 87\n52 106\n101 34\n32 92\n91 60\n90 47\n62 102\n33 72\n27 87\n45 78\n103 37\n94 33\n56 98\n38 79\n31 83\n105 53\n47 89\n50 83\n93 62\n96 49\n47 75\n89 47\n89 61\n93 54\n46 100\n110 41\n103 28\n101 57\n100 62\n71 37\n65 80\n86 28\n73 42\n96 44\n33 111\n98 39\n87 55\n108 65\n31 101",
"output": "0"
},
{
"input": "50 77\n95 55\n113 33\n101 17\n109 56\n117 7\n77 12\n14 84\n57 101\n96 28\n108 22\n105 12\n17 114\n51 115\n18 112\n104 25\n50 115\n14 111\n55 113\n124 20\n101 37\n18 121\n41 90\n77 41\n117 16\n8 83\n92 45\n48 86\n16 84\n13 98\n40 107\n14 94\n23 111\n36 121\n50 100\n35 90\n103 37\n96 51\n109 15\n13 117\n117 42\n112 45\n88 36\n51 121\n127 49\n112 15\n9 95\n122 46\n126 40\n57 93\n56 88",
"output": "0"
},
{
"input": "5 12\n2 7\n7 5\n3 10\n11 3\n2 11",
"output": "5"
},
{
"input": "15 15\n12 37\n40 4\n38 8\n5 36\n11 31\n21 33\n9 37\n4 38\n8 33\n5 39\n7 39\n38 16\n16 41\n38 9\n5 32",
"output": "6"
},
{
"input": "25 40\n66 26\n56 19\n64 38\n64 23\n25 49\n51 26\n67 20\n65 35\n33 66\n28 63\n27 57\n40 56\n59 26\n35 56\n39 67\n30 63\n69 22\n21 63\n67 22\n20 66\n26 65\n64 26\n44 57\n57 41\n35 50",
"output": "4"
},
{
"input": "50 77\n24 119\n43 119\n102 22\n117 30\n127 54\n93 19\n120 9\n118 27\n98 16\n17 105\n22 127\n109 52\n115 40\n11 121\n12 120\n113 30\n13 108\n33 124\n31 116\n112 39\n37 108\n127 28\n127 39\n120 29\n19 114\n103 18\n106 16\n24 121\n93 10\n36 112\n104 40\n39 100\n36 97\n83 9\n14 114\n126 12\n85 47\n25 84\n105 29\n35 113\n102 19\n8 110\n111 28\n94 12\n11 115\n40 124\n39 85\n47 93\n94 31\n17 121",
"output": "0"
},
{
"input": "1 21\n973 373",
"output": "352"
},
{
"input": "2 212\n831 551\n810 753",
"output": "541"
},
{
"input": "3 404\n690 728\n820 260\n186 402",
"output": "-1"
},
{
"input": "4 906\n548 906\n830 457\n228 638\n464 167",
"output": "-1"
},
{
"input": "5 97\n97 393\n840 965\n269 183\n596 49\n975 62",
"output": "-1"
},
{
"input": "3 183\n416 335\n773 648\n434 198",
"output": "-1"
},
{
"input": "3 868\n251 927\n862 464\n157 756",
"output": "112"
},
{
"input": "3 242\n397 208\n951 279\n570 622",
"output": "-1"
},
{
"input": "3 618\n543 800\n38 94\n293 179",
"output": "-1"
},
{
"input": "3 993\n378 81\n127 911\n16 737",
"output": "615"
},
{
"input": "5 12\n11 1\n9 6\n1 11\n3 8\n874 842",
"output": "-1"
},
{
"input": "15 16\n11 40\n5 32\n5 31\n36 10\n34 9\n43 6\n28 6\n34 8\n43 15\n9 28\n14 34\n34 6\n7 31\n31 14\n68 478",
"output": "-1"
},
{
"input": "25 57\n47 31\n64 21\n43 56\n47 19\n70 27\n28 61\n41 61\n39 45\n46 21\n55 35\n70 22\n22 69\n30 67\n55 42\n37 58\n50 28\n57 42\n35 48\n68 40\n38 50\n62 20\n31 52\n38 70\n64 35\n666 393",
"output": "-1"
},
{
"input": "50 118\n83 55\n101 33\n89 17\n97 56\n105 7\n65 12\n14 72\n57 89\n84 28\n96 22\n93 12\n17 102\n51 103\n18 100\n92 25\n50 103\n14 99\n55 101\n112 20\n89 37\n18 109\n41 78\n65 41\n105 16\n8 71\n80 45\n48 74\n16 72\n13 86\n40 95\n14 82\n23 99\n36 109\n50 88\n35 78\n91 37\n84 51\n97 15\n13 105\n105 42\n100 45\n76 36\n51 109\n115 49\n100 15\n9 83\n110 46\n114 40\n57 81\n528 348",
"output": "-1"
},
{
"input": "1 21\n0 1000",
"output": "0"
}
] | 1,623,219,856 | 2,147,483,647 |
PyPy 3
|
OK
|
TESTS
| 52 | 342 | 2,867,200 |
n, x0 = map(int, input().split())
has = set([x for x in range(1, 1001)])
for _ in range(n):
a, b = map(int, input().split())
a, b = min(a, b), max(a, b)
has2 = set([x for x in range(a, b+1)])
has = has & has2
if len(has) == 0:
print(-1)
elif x0 in has:
print(0)
elif x0 < min(has):
print(min(has) - x0)
else:
print(x0 - max(has))
|
Title: Young Photographer
Time Limit: 2 seconds
Memory Limit: 64 megabytes
Problem Description:
Among other things, Bob is keen on photography. Especially he likes to take pictures of sportsmen. That was the reason why he placed himself in position *x*0 of a long straight racetrack and got ready to take pictures. But the problem was that not all the runners passed him. The total amount of sportsmen, training at that racetrack, equals *n*. And each of them regularly runs distances within a particular segment of the racetrack, which is the same for each sportsman. For example, the first sportsman runs from position *a*1 to position *b*1, the second — from *a*2 to *b*2
What is the minimum distance that Bob should move to have a chance to take pictures of each sportsman? Bob can take a picture of a sportsman, if he stands within the segment that this sportsman covers on the racetrack.
Input Specification:
The first line of the input file contains integers *n* and *x*0 (1<=≤<=*n*<=≤<=100; 0<=≤<=*x*0<=≤<=1000). The following *n* lines contain pairs of integers *a**i*,<=*b**i* (0<=≤<=*a**i*,<=*b**i*<=≤<=1000; *a**i*<=≠<=*b**i*).
Output Specification:
Output the required minimum distance in the same units as the positions on the racetrack. If there is no such a position, output -1.
Demo Input:
['3 3\n0 7\n14 2\n4 6\n']
Demo Output:
['1\n']
Note:
none
|
```python
n, x0 = map(int, input().split())
has = set([x for x in range(1, 1001)])
for _ in range(n):
a, b = map(int, input().split())
a, b = min(a, b), max(a, b)
has2 = set([x for x in range(a, b+1)])
has = has & has2
if len(has) == 0:
print(-1)
elif x0 in has:
print(0)
elif x0 < min(has):
print(min(has) - x0)
else:
print(x0 - max(has))
```
| 3.893138 |
0 |
none
|
none
|
none
| 0 |
[
"none"
] | null | null |
Slastyona and her loyal dog Pushok are playing a meaningless game that is indeed very interesting.
The game consists of multiple rounds. Its rules are very simple: in each round, a natural number *k* is chosen. Then, the one who says (or barks) it faster than the other wins the round. After that, the winner's score is multiplied by *k*2, and the loser's score is multiplied by *k*. In the beginning of the game, both Slastyona and Pushok have scores equal to one.
Unfortunately, Slastyona had lost her notepad where the history of all *n* games was recorded. She managed to recall the final results for each games, though, but all of her memories of them are vague. Help Slastyona verify their correctness, or, to put it another way, for each given pair of scores determine whether it was possible for a game to finish with such result or not.
|
In the first string, the number of games *n* (1<=≤<=*n*<=≤<=350000) is given.
Each game is represented by a pair of scores *a*, *b* (1<=≤<=*a*,<=*b*<=≤<=109) – the results of Slastyona and Pushok, correspondingly.
|
For each pair of scores, answer "Yes" if it's possible for a game to finish with given score, and "No" otherwise.
You can output each letter in arbitrary case (upper or lower).
|
[
"6\n2 4\n75 45\n8 8\n16 16\n247 994\n1000000000 1000000\n"
] |
[
"Yes\nYes\nYes\nNo\nNo\nYes\n"
] |
First game might have been consisted of one round, in which the number 2 would have been chosen and Pushok would have won.
The second game needs exactly two rounds to finish with such result: in the first one, Slastyona would have said the number 5, and in the second one, Pushok would have barked the number 3.
| 0 |
[
{
"input": "6\n2 4\n75 45\n8 8\n16 16\n247 994\n1000000000 1000000",
"output": "Yes\nYes\nYes\nNo\nNo\nYes"
},
{
"input": "3\n1 1\n8 27\n1000 1331",
"output": "Yes\nNo\nNo"
},
{
"input": "1\n12004 18012002",
"output": "Yes"
},
{
"input": "1\n3331 11095561",
"output": "Yes"
},
{
"input": "1\n2 3",
"output": "No"
},
{
"input": "1\n1062961 1031",
"output": "Yes"
},
{
"input": "1\n6 12",
"output": "No"
},
{
"input": "1\n3 1",
"output": "No"
},
{
"input": "1\n3 10",
"output": "No"
},
{
"input": "1\n31159 970883281",
"output": "Yes"
},
{
"input": "1\n9907 98148649",
"output": "Yes"
},
{
"input": "1\n16 8",
"output": "No"
},
{
"input": "1\n90 72",
"output": "No"
}
] | 1,589,908,314 | 2,147,483,647 |
PyPy 3
|
TIME_LIMIT_EXCEEDED
|
TESTS
| 7 | 1,000 | 135,065,600 |
import sys
import math
input = sys.stdin.readline
dic={}
for i in range(1,10**6+1):
dic[i*i*i]=i
def main():
# write your entire code in this funtion
for _ in range(int(input())):
A,B=list(map(int,input().split()))
c=A*B
if(c not in dic):
print("NO")
else:
t=dic[c]
if(A%t==0 and B%t==0):
print("YES")
else:
print("NO")
if __name__ == '__main__':
main()
|
Title: none
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Slastyona and her loyal dog Pushok are playing a meaningless game that is indeed very interesting.
The game consists of multiple rounds. Its rules are very simple: in each round, a natural number *k* is chosen. Then, the one who says (or barks) it faster than the other wins the round. After that, the winner's score is multiplied by *k*2, and the loser's score is multiplied by *k*. In the beginning of the game, both Slastyona and Pushok have scores equal to one.
Unfortunately, Slastyona had lost her notepad where the history of all *n* games was recorded. She managed to recall the final results for each games, though, but all of her memories of them are vague. Help Slastyona verify their correctness, or, to put it another way, for each given pair of scores determine whether it was possible for a game to finish with such result or not.
Input Specification:
In the first string, the number of games *n* (1<=≤<=*n*<=≤<=350000) is given.
Each game is represented by a pair of scores *a*, *b* (1<=≤<=*a*,<=*b*<=≤<=109) – the results of Slastyona and Pushok, correspondingly.
Output Specification:
For each pair of scores, answer "Yes" if it's possible for a game to finish with given score, and "No" otherwise.
You can output each letter in arbitrary case (upper or lower).
Demo Input:
['6\n2 4\n75 45\n8 8\n16 16\n247 994\n1000000000 1000000\n']
Demo Output:
['Yes\nYes\nYes\nNo\nNo\nYes\n']
Note:
First game might have been consisted of one round, in which the number 2 would have been chosen and Pushok would have won.
The second game needs exactly two rounds to finish with such result: in the first one, Slastyona would have said the number 5, and in the second one, Pushok would have barked the number 3.
|
```python
import sys
import math
input = sys.stdin.readline
dic={}
for i in range(1,10**6+1):
dic[i*i*i]=i
def main():
# write your entire code in this funtion
for _ in range(int(input())):
A,B=list(map(int,input().split()))
c=A*B
if(c not in dic):
print("NO")
else:
t=dic[c]
if(A%t==0 and B%t==0):
print("YES")
else:
print("NO")
if __name__ == '__main__':
main()
```
| 0 |
|
12 |
A
|
Super Agent
|
PROGRAMMING
| 800 |
[
"implementation"
] |
A. Super Agent
|
2
|
256
|
There is a very secret base in Potatoland where potato mash is made according to a special recipe. The neighbours from Porridgia decided to seize this recipe and to sell it to Pilauland. For this mission they have been preparing special agent Pearlo for many years. When, finally, Pearlo learned all secrets of espionage, he penetrated into the Potatoland territory and reached the secret base.
Now he is standing at the entrance, but to get inside he need to pass combination lock. Minute ago one of the workers entered the password on the terminal and opened the door. The terminal is a square digital keyboard 3<=×<=3 with digits from 1 to 9.
Pearlo knows that the password consists from distinct digits and is probably symmetric with respect to the central button of the terminal. He has heat sensor which allowed him to detect the digits which the worker pressed. Now he wants to check whether the password entered by the worker is symmetric with respect to the central button of the terminal. This fact can Help Pearlo to reduce the number of different possible password combinations.
|
Input contains the matrix of three rows of three symbols each. Symbol «X» means that the corresponding button was pressed, and «.» means that is was not pressed. The matrix may contain no «X», also it may contain no «.».
|
Print YES if the password is symmetric with respect to the central button of the terminal and NO otherwise.
|
[
"XX.\n...\n.XX\n",
"X.X\nX..\n...\n"
] |
[
"YES\n",
"NO\n"
] |
If you are not familiar with the term «central symmetry», you may look into http://en.wikipedia.org/wiki/Central_symmetry
| 0 |
[
{
"input": "XX.\n...\n.XX",
"output": "YES"
},
{
"input": ".X.\n.X.\n.X.",
"output": "YES"
},
{
"input": "XXX\nXXX\nXXX",
"output": "YES"
},
{
"input": "XXX\nX.X\nXXX",
"output": "YES"
},
{
"input": "X..\n.X.\n..X",
"output": "YES"
},
{
"input": "...\nX.X\nX..",
"output": "NO"
},
{
"input": ".X.\nX.X\n.X.",
"output": "YES"
},
{
"input": "X.X\n.X.\nX.X",
"output": "YES"
},
{
"input": "...\n...\n..X",
"output": "NO"
},
{
"input": "XXX\n...\nXXX",
"output": "YES"
},
{
"input": "..X\nX..\n..X",
"output": "NO"
},
{
"input": ".X.\n...\nX.X",
"output": "NO"
},
{
"input": "X.X\nX.X\nX.X",
"output": "YES"
},
{
"input": ".X.\nX.X\nXX.",
"output": "NO"
},
{
"input": "...\nXXX\nXXX",
"output": "NO"
},
{
"input": "XXX\n..X\nXXX",
"output": "NO"
},
{
"input": "X..\nX.X\n.X.",
"output": "NO"
},
{
"input": "...\n..X\nXXX",
"output": "NO"
},
{
"input": "..X\nX.X\nX..",
"output": "YES"
},
{
"input": "..X\n..X\nXXX",
"output": "NO"
},
{
"input": "X..\nX..\nX..",
"output": "NO"
},
{
"input": "XXX\n.X.\nXXX",
"output": "YES"
},
{
"input": "..X\n...\nX..",
"output": "YES"
},
{
"input": "...\n...\nX..",
"output": "NO"
},
{
"input": "...\n...\n.X.",
"output": "NO"
},
{
"input": "...\n...\n..X",
"output": "NO"
},
{
"input": "...\n.X.\nX..",
"output": "NO"
}
] | 1,676,479,824 | 2,147,483,647 |
PyPy 3-64
|
OK
|
TESTS
| 40 | 124 | 0 |
a = [input(), input(), input()]
ans = "YES"
for i in range(3):
for j in range(3):
if a[i][j] != a[~i][~j]:
ans = "NO"
break
print(ans)
|
Title: Super Agent
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
There is a very secret base in Potatoland where potato mash is made according to a special recipe. The neighbours from Porridgia decided to seize this recipe and to sell it to Pilauland. For this mission they have been preparing special agent Pearlo for many years. When, finally, Pearlo learned all secrets of espionage, he penetrated into the Potatoland territory and reached the secret base.
Now he is standing at the entrance, but to get inside he need to pass combination lock. Minute ago one of the workers entered the password on the terminal and opened the door. The terminal is a square digital keyboard 3<=×<=3 with digits from 1 to 9.
Pearlo knows that the password consists from distinct digits and is probably symmetric with respect to the central button of the terminal. He has heat sensor which allowed him to detect the digits which the worker pressed. Now he wants to check whether the password entered by the worker is symmetric with respect to the central button of the terminal. This fact can Help Pearlo to reduce the number of different possible password combinations.
Input Specification:
Input contains the matrix of three rows of three symbols each. Symbol «X» means that the corresponding button was pressed, and «.» means that is was not pressed. The matrix may contain no «X», also it may contain no «.».
Output Specification:
Print YES if the password is symmetric with respect to the central button of the terminal and NO otherwise.
Demo Input:
['XX.\n...\n.XX\n', 'X.X\nX..\n...\n']
Demo Output:
['YES\n', 'NO\n']
Note:
If you are not familiar with the term «central symmetry», you may look into http://en.wikipedia.org/wiki/Central_symmetry
|
```python
a = [input(), input(), input()]
ans = "YES"
for i in range(3):
for j in range(3):
if a[i][j] != a[~i][~j]:
ans = "NO"
break
print(ans)
```
| 3.969 |
633 |
A
|
Ebony and Ivory
|
PROGRAMMING
| 1,100 |
[
"brute force",
"math",
"number theory"
] | null | null |
Dante is engaged in a fight with "The Savior". Before he can fight it with his sword, he needs to break its shields. He has two guns, Ebony and Ivory, each of them is able to perform any non-negative number of shots.
For every bullet that hits the shield, Ebony deals *a* units of damage while Ivory deals *b* units of damage. In order to break the shield Dante has to deal exactly *c* units of damage. Find out if this is possible.
|
The first line of the input contains three integers *a*, *b*, *c* (1<=≤<=*a*,<=*b*<=≤<=100,<=1<=≤<=*c*<=≤<=10<=000) — the number of units of damage dealt by Ebony gun and Ivory gun, and the total number of damage required to break the shield, respectively.
|
Print "Yes" (without quotes) if Dante can deal exactly *c* damage to the shield and "No" (without quotes) otherwise.
|
[
"4 6 15\n",
"3 2 7\n",
"6 11 6\n"
] |
[
"No\n",
"Yes\n",
"Yes\n"
] |
In the second sample, Dante can fire 1 bullet from Ebony and 2 from Ivory to deal exactly 1·3 + 2·2 = 7 damage. In the third sample, Dante can fire 1 bullet from ebony and no bullets from ivory to do 1·6 + 0·11 = 6 damage.
| 250 |
[
{
"input": "4 6 15",
"output": "No"
},
{
"input": "3 2 7",
"output": "Yes"
},
{
"input": "6 11 6",
"output": "Yes"
},
{
"input": "3 12 15",
"output": "Yes"
},
{
"input": "5 5 10",
"output": "Yes"
},
{
"input": "6 6 7",
"output": "No"
},
{
"input": "1 1 20",
"output": "Yes"
},
{
"input": "12 14 19",
"output": "No"
},
{
"input": "15 12 26",
"output": "No"
},
{
"input": "2 4 8",
"output": "Yes"
},
{
"input": "4 5 30",
"output": "Yes"
},
{
"input": "4 5 48",
"output": "Yes"
},
{
"input": "2 17 105",
"output": "Yes"
},
{
"input": "10 25 282",
"output": "No"
},
{
"input": "6 34 323",
"output": "No"
},
{
"input": "2 47 464",
"output": "Yes"
},
{
"input": "4 53 113",
"output": "Yes"
},
{
"input": "6 64 546",
"output": "Yes"
},
{
"input": "1 78 725",
"output": "Yes"
},
{
"input": "1 84 811",
"output": "Yes"
},
{
"input": "3 100 441",
"output": "Yes"
},
{
"input": "20 5 57",
"output": "No"
},
{
"input": "14 19 143",
"output": "No"
},
{
"input": "17 23 248",
"output": "No"
},
{
"input": "11 34 383",
"output": "Yes"
},
{
"input": "20 47 568",
"output": "Yes"
},
{
"input": "16 58 410",
"output": "Yes"
},
{
"input": "11 70 1199",
"output": "Yes"
},
{
"input": "16 78 712",
"output": "Yes"
},
{
"input": "20 84 562",
"output": "No"
},
{
"input": "19 100 836",
"output": "Yes"
},
{
"input": "23 10 58",
"output": "No"
},
{
"input": "25 17 448",
"output": "Yes"
},
{
"input": "22 24 866",
"output": "Yes"
},
{
"input": "24 35 67",
"output": "No"
},
{
"input": "29 47 264",
"output": "Yes"
},
{
"input": "23 56 45",
"output": "No"
},
{
"input": "25 66 1183",
"output": "Yes"
},
{
"input": "21 71 657",
"output": "Yes"
},
{
"input": "29 81 629",
"output": "No"
},
{
"input": "23 95 2226",
"output": "Yes"
},
{
"input": "32 4 62",
"output": "No"
},
{
"input": "37 15 789",
"output": "Yes"
},
{
"input": "39 24 999",
"output": "Yes"
},
{
"input": "38 32 865",
"output": "No"
},
{
"input": "32 50 205",
"output": "No"
},
{
"input": "31 57 1362",
"output": "Yes"
},
{
"input": "38 68 1870",
"output": "Yes"
},
{
"input": "36 76 549",
"output": "No"
},
{
"input": "35 84 1257",
"output": "No"
},
{
"input": "39 92 2753",
"output": "Yes"
},
{
"input": "44 1 287",
"output": "Yes"
},
{
"input": "42 12 830",
"output": "No"
},
{
"input": "42 27 9",
"output": "No"
},
{
"input": "49 40 1422",
"output": "No"
},
{
"input": "44 42 2005",
"output": "No"
},
{
"input": "50 55 2479",
"output": "No"
},
{
"input": "48 65 917",
"output": "No"
},
{
"input": "45 78 152",
"output": "No"
},
{
"input": "43 90 4096",
"output": "Yes"
},
{
"input": "43 94 4316",
"output": "Yes"
},
{
"input": "60 7 526",
"output": "Yes"
},
{
"input": "53 11 735",
"output": "Yes"
},
{
"input": "52 27 609",
"output": "Yes"
},
{
"input": "57 32 992",
"output": "Yes"
},
{
"input": "52 49 421",
"output": "No"
},
{
"input": "57 52 2634",
"output": "Yes"
},
{
"input": "54 67 3181",
"output": "Yes"
},
{
"input": "52 73 638",
"output": "No"
},
{
"input": "57 84 3470",
"output": "No"
},
{
"input": "52 100 5582",
"output": "No"
},
{
"input": "62 1 501",
"output": "Yes"
},
{
"input": "63 17 858",
"output": "Yes"
},
{
"input": "70 24 1784",
"output": "Yes"
},
{
"input": "65 32 1391",
"output": "Yes"
},
{
"input": "62 50 2775",
"output": "No"
},
{
"input": "62 58 88",
"output": "No"
},
{
"input": "66 68 3112",
"output": "Yes"
},
{
"input": "61 71 1643",
"output": "No"
},
{
"input": "69 81 3880",
"output": "No"
},
{
"input": "63 100 1960",
"output": "Yes"
},
{
"input": "73 6 431",
"output": "Yes"
},
{
"input": "75 19 736",
"output": "Yes"
},
{
"input": "78 25 247",
"output": "No"
},
{
"input": "79 36 2854",
"output": "Yes"
},
{
"input": "80 43 1864",
"output": "Yes"
},
{
"input": "76 55 2196",
"output": "Yes"
},
{
"input": "76 69 4122",
"output": "Yes"
},
{
"input": "76 76 4905",
"output": "No"
},
{
"input": "75 89 3056",
"output": "Yes"
},
{
"input": "73 100 3111",
"output": "Yes"
},
{
"input": "84 9 530",
"output": "No"
},
{
"input": "82 18 633",
"output": "No"
},
{
"input": "85 29 2533",
"output": "Yes"
},
{
"input": "89 38 2879",
"output": "Yes"
},
{
"input": "89 49 2200",
"output": "Yes"
},
{
"input": "88 60 4140",
"output": "Yes"
},
{
"input": "82 68 1299",
"output": "No"
},
{
"input": "90 76 2207",
"output": "No"
},
{
"input": "83 84 4923",
"output": "Yes"
},
{
"input": "89 99 7969",
"output": "Yes"
},
{
"input": "94 9 168",
"output": "No"
},
{
"input": "91 20 1009",
"output": "No"
},
{
"input": "93 23 2872",
"output": "Yes"
},
{
"input": "97 31 3761",
"output": "Yes"
},
{
"input": "99 46 1341",
"output": "Yes"
},
{
"input": "98 51 2845",
"output": "No"
},
{
"input": "93 66 3412",
"output": "No"
},
{
"input": "95 76 3724",
"output": "Yes"
},
{
"input": "91 87 6237",
"output": "Yes"
},
{
"input": "98 97 7886",
"output": "Yes"
},
{
"input": "12 17 15",
"output": "No"
},
{
"input": "93 94 95",
"output": "No"
},
{
"input": "27 43 27",
"output": "Yes"
},
{
"input": "17 43 68",
"output": "Yes"
},
{
"input": "44 12 12",
"output": "Yes"
},
{
"input": "44 50 150",
"output": "Yes"
},
{
"input": "1 1 10000",
"output": "Yes"
},
{
"input": "2 3 10000",
"output": "Yes"
},
{
"input": "100 1 10",
"output": "Yes"
},
{
"input": "3 2 1",
"output": "No"
},
{
"input": "1 1 1",
"output": "Yes"
},
{
"input": "9 9 10000",
"output": "No"
},
{
"input": "2 3 9995",
"output": "Yes"
},
{
"input": "3 5 4",
"output": "No"
},
{
"input": "99 98 100",
"output": "No"
},
{
"input": "6 10 2",
"output": "No"
},
{
"input": "1 6 5",
"output": "Yes"
},
{
"input": "1 4 3",
"output": "Yes"
},
{
"input": "3 2 3",
"output": "Yes"
},
{
"input": "1 7 6",
"output": "Yes"
},
{
"input": "2 3 9871",
"output": "Yes"
},
{
"input": "10 5 5",
"output": "Yes"
},
{
"input": "10 8 2",
"output": "No"
}
] | 1,493,634,070 | 2,147,483,647 |
Python 3
|
WRONG_ANSWER
|
TESTS
| 64 | 62 | 5,529,600 |
a,b,c=map(int,input().split(' '))
for i in range(1,10001):
if((c-a*i)%b==0 and c-a*i>=0):
print('Yes')
break
else:
print('No')
|
Title: Ebony and Ivory
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Dante is engaged in a fight with "The Savior". Before he can fight it with his sword, he needs to break its shields. He has two guns, Ebony and Ivory, each of them is able to perform any non-negative number of shots.
For every bullet that hits the shield, Ebony deals *a* units of damage while Ivory deals *b* units of damage. In order to break the shield Dante has to deal exactly *c* units of damage. Find out if this is possible.
Input Specification:
The first line of the input contains three integers *a*, *b*, *c* (1<=≤<=*a*,<=*b*<=≤<=100,<=1<=≤<=*c*<=≤<=10<=000) — the number of units of damage dealt by Ebony gun and Ivory gun, and the total number of damage required to break the shield, respectively.
Output Specification:
Print "Yes" (without quotes) if Dante can deal exactly *c* damage to the shield and "No" (without quotes) otherwise.
Demo Input:
['4 6 15\n', '3 2 7\n', '6 11 6\n']
Demo Output:
['No\n', 'Yes\n', 'Yes\n']
Note:
In the second sample, Dante can fire 1 bullet from Ebony and 2 from Ivory to deal exactly 1·3 + 2·2 = 7 damage. In the third sample, Dante can fire 1 bullet from ebony and no bullets from ivory to do 1·6 + 0·11 = 6 damage.
|
```python
a,b,c=map(int,input().split(' '))
for i in range(1,10001):
if((c-a*i)%b==0 and c-a*i>=0):
print('Yes')
break
else:
print('No')
```
| 0 |
|
886 |
C
|
Petya and Catacombs
|
PROGRAMMING
| 1,300 |
[
"dsu",
"greedy",
"implementation",
"trees"
] | null | null |
A very brave explorer Petya once decided to explore Paris catacombs. Since Petya is not really experienced, his exploration is just walking through the catacombs.
Catacombs consist of several rooms and bidirectional passages between some pairs of them. Some passages can connect a room to itself and since the passages are built on different depths they do not intersect each other. Every minute Petya arbitrary chooses a passage from the room he is currently in and then reaches the room on the other end of the passage in exactly one minute. When he enters a room at minute *i*, he makes a note in his logbook with number *t**i*:
- If Petya has visited this room before, he writes down the minute he was in this room last time; - Otherwise, Petya writes down an arbitrary non-negative integer strictly less than current minute *i*.
Initially, Petya was in one of the rooms at minute 0, he didn't write down number *t*0.
At some point during his wandering Petya got tired, threw out his logbook and went home. Vasya found his logbook and now he is curious: what is the minimum possible number of rooms in Paris catacombs according to Petya's logbook?
|
The first line contains a single integer *n* (1<=≤<=*n*<=≤<=2·105) — then number of notes in Petya's logbook.
The second line contains *n* non-negative integers *t*1,<=*t*2,<=...,<=*t**n* (0<=≤<=*t**i*<=<<=*i*) — notes in the logbook.
|
In the only line print a single integer — the minimum possible number of rooms in Paris catacombs.
|
[
"2\n0 0\n",
"5\n0 1 0 1 3\n"
] |
[
"2\n",
"3\n"
] |
In the first sample, sequence of rooms Petya visited could be, for example 1 → 1 → 2, 1 → 2 → 1 or 1 → 2 → 3. The minimum possible number of rooms is 2.
In the second sample, the sequence could be 1 → 2 → 3 → 1 → 2 → 1.
| 1,500 |
[
{
"input": "2\n0 0",
"output": "2"
},
{
"input": "5\n0 1 0 1 3",
"output": "3"
},
{
"input": "7\n0 1 0 0 0 0 0",
"output": "6"
},
{
"input": "100\n0 0 0 0 0 0 1 4 4 0 2 2 4 1 7 1 11 0 8 4 12 12 3 0 3 2 2 4 3 9 1 5 4 6 9 14 6 2 4 18 7 7 19 11 20 13 17 16 0 34 2 6 12 27 9 4 29 22 4 20 20 17 17 20 37 53 17 3 3 15 1 46 11 24 31 6 12 6 11 18 13 1 5 0 19 10 24 41 16 41 18 52 46 39 16 30 18 23 53 13",
"output": "66"
},
{
"input": "100\n0 0 0 0 1 2 0 0 3 3 2 2 6 4 1 6 2 9 8 0 2 0 2 2 0 0 10 0 4 20 4 11 3 9 0 3 8 2 6 3 13 2 1 23 20 20 16 7 1 37 6 1 25 25 14 30 6 23 18 3 2 16 0 4 37 9 4 6 2 14 15 11 16 35 36 7 32 26 8 1 0 37 35 38 27 3 16 8 3 7 7 25 13 13 30 11 5 28 0 12",
"output": "71"
},
{
"input": "1\n0",
"output": "1"
},
{
"input": "14\n0 0 1 1 2 2 3 3 4 4 5 5 6 6",
"output": "8"
},
{
"input": "2\n0 1",
"output": "1"
}
] | 1,587,167,988 | 2,147,483,647 |
PyPy 3
|
OK
|
TESTS
| 31 | 233 | 21,401,600 |
import math
import sys
from collections import defaultdict
from collections import Counter
import bisect
input = iter(sys.stdin.buffer.read().decode().splitlines()).__next__
ilele = lambda: map(int,input().split())
alele = lambda: list(map(int, input().split()))
def list2d(a, b, c): return [[c] * b for i in range(a)]
def list3d(a, b, c, d): return [[[d] * c for j in range(b)] for i in range(a)]
INF = 10 ** 18
MOD = 10 ** 9 + 7
N, =ilele()
A = alele()
C = Counter(A)
tot = 1
for i in C.values():
tot += max(0,i-1)
print(tot)
|
Title: Petya and Catacombs
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
A very brave explorer Petya once decided to explore Paris catacombs. Since Petya is not really experienced, his exploration is just walking through the catacombs.
Catacombs consist of several rooms and bidirectional passages between some pairs of them. Some passages can connect a room to itself and since the passages are built on different depths they do not intersect each other. Every minute Petya arbitrary chooses a passage from the room he is currently in and then reaches the room on the other end of the passage in exactly one minute. When he enters a room at minute *i*, he makes a note in his logbook with number *t**i*:
- If Petya has visited this room before, he writes down the minute he was in this room last time; - Otherwise, Petya writes down an arbitrary non-negative integer strictly less than current minute *i*.
Initially, Petya was in one of the rooms at minute 0, he didn't write down number *t*0.
At some point during his wandering Petya got tired, threw out his logbook and went home. Vasya found his logbook and now he is curious: what is the minimum possible number of rooms in Paris catacombs according to Petya's logbook?
Input Specification:
The first line contains a single integer *n* (1<=≤<=*n*<=≤<=2·105) — then number of notes in Petya's logbook.
The second line contains *n* non-negative integers *t*1,<=*t*2,<=...,<=*t**n* (0<=≤<=*t**i*<=<<=*i*) — notes in the logbook.
Output Specification:
In the only line print a single integer — the minimum possible number of rooms in Paris catacombs.
Demo Input:
['2\n0 0\n', '5\n0 1 0 1 3\n']
Demo Output:
['2\n', '3\n']
Note:
In the first sample, sequence of rooms Petya visited could be, for example 1 → 1 → 2, 1 → 2 → 1 or 1 → 2 → 3. The minimum possible number of rooms is 2.
In the second sample, the sequence could be 1 → 2 → 3 → 1 → 2 → 1.
|
```python
import math
import sys
from collections import defaultdict
from collections import Counter
import bisect
input = iter(sys.stdin.buffer.read().decode().splitlines()).__next__
ilele = lambda: map(int,input().split())
alele = lambda: list(map(int, input().split()))
def list2d(a, b, c): return [[c] * b for i in range(a)]
def list3d(a, b, c, d): return [[[d] * c for j in range(b)] for i in range(a)]
INF = 10 ** 18
MOD = 10 ** 9 + 7
N, =ilele()
A = alele()
C = Counter(A)
tot = 1
for i in C.values():
tot += max(0,i-1)
print(tot)
```
| 3 |
|
229 |
B
|
Planets
|
PROGRAMMING
| 1,700 |
[
"binary search",
"data structures",
"graphs",
"shortest paths"
] | null | null |
Goa'uld Apophis captured Jack O'Neill's team again! Jack himself was able to escape, but by that time Apophis's ship had already jumped to hyperspace. But Jack knows on what planet will Apophis land. In order to save his friends, Jack must repeatedly go through stargates to get to this planet.
Overall the galaxy has *n* planets, indexed with numbers from 1 to *n*. Jack is on the planet with index 1, and Apophis will land on the planet with index *n*. Jack can move between some pairs of planets through stargates (he can move in both directions); the transfer takes a positive, and, perhaps, for different pairs of planets unequal number of seconds. Jack begins his journey at time 0.
It can be that other travellers are arriving to the planet where Jack is currently located. In this case, Jack has to wait for exactly 1 second before he can use the stargate. That is, if at time *t* another traveller arrives to the planet, Jack can only pass through the stargate at time *t*<=+<=1, unless there are more travellers arriving at time *t*<=+<=1 to the same planet.
Knowing the information about travel times between the planets, and the times when Jack would not be able to use the stargate on particular planets, determine the minimum time in which he can get to the planet with index *n*.
|
The first line contains two space-separated integers: *n* (2<=≤<=*n*<=≤<=105), the number of planets in the galaxy, and *m* (0<=≤<=*m*<=≤<=105) — the number of pairs of planets between which Jack can travel using stargates. Then *m* lines follow, containing three integers each: the *i*-th line contains numbers of planets *a**i* and *b**i* (1<=≤<=*a**i*,<=*b**i*<=≤<=*n*, *a**i*<=≠<=*b**i*), which are connected through stargates, and the integer transfer time (in seconds) *c**i* (1<=≤<=*c**i*<=≤<=104) between these planets. It is guaranteed that between any pair of planets there is at most one stargate connection.
Then *n* lines follow: the *i*-th line contains an integer *k**i* (0<=≤<=*k**i*<=≤<=105) that denotes the number of moments of time when other travellers arrive to the planet with index *i*. Then *k**i* distinct space-separated integers *t**ij* (0<=≤<=*t**ij*<=<<=109) follow, sorted in ascending order. An integer *t**ij* means that at time *t**ij* (in seconds) another traveller arrives to the planet *i*. It is guaranteed that the sum of all *k**i* does not exceed 105.
|
Print a single number — the least amount of time Jack needs to get from planet 1 to planet *n*. If Jack can't get to planet *n* in any amount of time, print number -1.
|
[
"4 6\n1 2 2\n1 3 3\n1 4 8\n2 3 4\n2 4 5\n3 4 3\n0\n1 3\n2 3 4\n0\n",
"3 1\n1 2 3\n0\n1 3\n0\n"
] |
[
"7\n",
"-1\n"
] |
In the first sample Jack has three ways to go from planet 1. If he moves to planet 4 at once, he spends 8 seconds. If he transfers to planet 3, he spends 3 seconds, but as other travellers arrive to planet 3 at time 3 and 4, he can travel to planet 4 only at time 5, thus spending 8 seconds in total. But if Jack moves to planet 2, and then — to planet 4, then he spends a total of only 2 + 5 = 7 seconds.
In the second sample one can't get from planet 1 to planet 3 by moving through stargates.
| 500 |
[
{
"input": "4 6\n1 2 2\n1 3 3\n1 4 8\n2 3 4\n2 4 5\n3 4 3\n0\n1 3\n2 3 4\n0",
"output": "7"
},
{
"input": "3 1\n1 2 3\n0\n1 3\n0",
"output": "-1"
},
{
"input": "2 1\n1 2 3\n0\n1 3",
"output": "3"
},
{
"input": "2 1\n1 2 3\n1 0\n0",
"output": "4"
},
{
"input": "3 3\n1 2 5\n2 3 6\n1 3 7\n0\n0\n0",
"output": "7"
},
{
"input": "3 3\n1 2 3\n2 3 2\n1 3 7\n0\n0\n0",
"output": "5"
},
{
"input": "2 0\n0\n0",
"output": "-1"
},
{
"input": "3 1\n1 2 3\n1 1\n1 5\n0",
"output": "-1"
},
{
"input": "2 1\n1 2 3\n0\n2 2 4",
"output": "3"
},
{
"input": "2 1\n1 2 1\n0\n0",
"output": "1"
},
{
"input": "2 1\n2 1 10000\n0\n0",
"output": "10000"
},
{
"input": "2 1\n1 2 3\n0\n3 3 4 5",
"output": "3"
},
{
"input": "3 0\n0\n0\n0",
"output": "-1"
},
{
"input": "3 2\n1 2 5\n2 3 7\n2 0 1\n3 4 5 6\n3 11 12 13",
"output": "14"
},
{
"input": "2 1\n1 2 3\n3 0 1 2\n3 5 6 7",
"output": "6"
},
{
"input": "3 3\n1 2 3\n2 3 2\n1 3 7\n0\n4 3 4 5 6\n0",
"output": "7"
},
{
"input": "6 7\n1 2 1\n1 3 8\n2 4 2\n4 3 3\n3 5 4\n4 6 100\n5 6 5\n0\n0\n1 7\n2 3 4\n0\n0",
"output": "17"
},
{
"input": "3 3\n1 2 3\n2 3 2\n1 3 6\n0\n1 3\n0",
"output": "6"
},
{
"input": "7 7\n1 2 1\n2 4 2\n2 3 2\n3 6 2\n6 5 2\n4 5 3\n5 7 7\n0\n0\n0\n3 3 4 5\n0\n0\n0",
"output": "14"
},
{
"input": "7 6\n1 2 1\n1 3 1\n1 4 1\n1 5 1\n1 6 1\n1 7 1\n1 0\n0\n0\n0\n0\n0\n0",
"output": "2"
},
{
"input": "8 10\n1 2 3\n2 8 3\n1 4 1\n4 3 6\n3 7 7\n4 5 5\n5 7 2\n7 8 1\n1 6 8\n6 8 7\n0\n4 1 2 3 4\n0\n0\n0\n0\n0\n0",
"output": "8"
},
{
"input": "7 6\n1 2 1\n1 3 2\n2 4 3\n2 5 4\n3 5 6\n3 6 7\n0\n3 1 2 3\n2 2 3\n0\n2 7 8\n0\n0",
"output": "-1"
}
] | 1,685,090,637 | 2,147,483,647 |
PyPy 3-64
|
OK
|
TESTS
| 68 | 1,184 | 41,676,800 |
# '''
# https://codeforces.com/contest/229/problem/B
# 输入 n(2≤n≤1e5) m(0≤m≤1e5) 表示一个 n 点 m 边的无向图(节点编号从 1 开始)。
# 然后输入 m 条边,每条边包含 3 个数 a b c(1≤c≤1e4),表示有一条边权为 c 的无向边连接 a 和 b。
# 保证无自环、无重边。
# 然后输入 n 行,每行第一个数 k 表示数组 t[i] 的长度,然后输入数组 t[i]。
# 数组 t[i] 是一个严格递增序列,0≤t[i][j]<1e9。
# 所有 k 之和 ≤1e5。
# 初始时间为 0。你从 1 出发,要去 n。
# 如果你在点 i,但是当前时间在数组 t[i] 中,那么你必须等待 1 秒。如果下一秒仍然在 t[i] 中,那么继续等待 1 秒。依此类推。
# 输出到达 n 的最早时间。
# 如果无法到达 n,输出 -1。
# 【易错题】
# 输入
# 4 6
# 1 2 2
# 1 3 3
# 1 4 8
# 2 3 4
# 2 4 5
# 3 4 3
# 0
# 1 3
# 2 3 4
# 0
# 输出 7
# 输入
# 3 1
# 1 2 3
# 0
# 1 3
# 0
# 输出 -1
# '''
# from cmath import inf
# from collections import defaultdict
# from heapq import heappop, heappush
# def _n():
# return int(input())
# def _nA():
# return list(map(int, input().split()))
# def _nS():
# return input().split()
# def solve():
# n, m = _nA()
# graph = [[]for _ in range(n)]
# for i in range(m):
# a, b, c = _nA()
# a -= 1
# b -= 1
# graph[a].append((b, c))
# graph[b].append((a, c))
# t = [None]*n
# for i in range(n):
# t[i] = _nA()[1:]
# dist = [inf]*n
# dist[0] = 0
# q = [(0, 0)]
# while q:
# d, x = heappop(q)
# if d!=dist[x]:
# continue
# for i in t[x]:
# if d == i:
# d += 1
# for y, c in graph[x]:
# if dist[x]+c < dist[y]:
# dist[y] = min(dist[y], d+c)
# heappush(q, (dist[y], y))
# return dist[-1] if dist[-1] != inf else -1
# print(solve())
import sys
from heapq import *
r=sys.stdin.readline
n,m = map(int,r().split())
g=[[] for _ in range(n+1)]
for _ in range(m):
a,b,c=map(int,r().split())
g[a].append((b,c))
g[b].append((a,c))
times=[[]]
for _ in range(n):
times.append(list(map(int,r().split()))[1:])
INF = sys.maxsize
dist = [INF]*(n+1)
dist[1]=0
q=[(0,1)]
while q:
d,idx = heappop(q)
if d !=dist[idx]:
continue
cur = dist[idx]
for i in times[idx]:
if i==cur:
cur+=1
for e,cost in g[idx]:
if dist[e] > dist[idx]+cost:
dist[e] = min(dist[e], cur+cost)
heappush(q,(dist[e],e))
print(dist[n] if dist[n]!=INF else -1)
|
Title: Planets
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Goa'uld Apophis captured Jack O'Neill's team again! Jack himself was able to escape, but by that time Apophis's ship had already jumped to hyperspace. But Jack knows on what planet will Apophis land. In order to save his friends, Jack must repeatedly go through stargates to get to this planet.
Overall the galaxy has *n* planets, indexed with numbers from 1 to *n*. Jack is on the planet with index 1, and Apophis will land on the planet with index *n*. Jack can move between some pairs of planets through stargates (he can move in both directions); the transfer takes a positive, and, perhaps, for different pairs of planets unequal number of seconds. Jack begins his journey at time 0.
It can be that other travellers are arriving to the planet where Jack is currently located. In this case, Jack has to wait for exactly 1 second before he can use the stargate. That is, if at time *t* another traveller arrives to the planet, Jack can only pass through the stargate at time *t*<=+<=1, unless there are more travellers arriving at time *t*<=+<=1 to the same planet.
Knowing the information about travel times between the planets, and the times when Jack would not be able to use the stargate on particular planets, determine the minimum time in which he can get to the planet with index *n*.
Input Specification:
The first line contains two space-separated integers: *n* (2<=≤<=*n*<=≤<=105), the number of planets in the galaxy, and *m* (0<=≤<=*m*<=≤<=105) — the number of pairs of planets between which Jack can travel using stargates. Then *m* lines follow, containing three integers each: the *i*-th line contains numbers of planets *a**i* and *b**i* (1<=≤<=*a**i*,<=*b**i*<=≤<=*n*, *a**i*<=≠<=*b**i*), which are connected through stargates, and the integer transfer time (in seconds) *c**i* (1<=≤<=*c**i*<=≤<=104) between these planets. It is guaranteed that between any pair of planets there is at most one stargate connection.
Then *n* lines follow: the *i*-th line contains an integer *k**i* (0<=≤<=*k**i*<=≤<=105) that denotes the number of moments of time when other travellers arrive to the planet with index *i*. Then *k**i* distinct space-separated integers *t**ij* (0<=≤<=*t**ij*<=<<=109) follow, sorted in ascending order. An integer *t**ij* means that at time *t**ij* (in seconds) another traveller arrives to the planet *i*. It is guaranteed that the sum of all *k**i* does not exceed 105.
Output Specification:
Print a single number — the least amount of time Jack needs to get from planet 1 to planet *n*. If Jack can't get to planet *n* in any amount of time, print number -1.
Demo Input:
['4 6\n1 2 2\n1 3 3\n1 4 8\n2 3 4\n2 4 5\n3 4 3\n0\n1 3\n2 3 4\n0\n', '3 1\n1 2 3\n0\n1 3\n0\n']
Demo Output:
['7\n', '-1\n']
Note:
In the first sample Jack has three ways to go from planet 1. If he moves to planet 4 at once, he spends 8 seconds. If he transfers to planet 3, he spends 3 seconds, but as other travellers arrive to planet 3 at time 3 and 4, he can travel to planet 4 only at time 5, thus spending 8 seconds in total. But if Jack moves to planet 2, and then — to planet 4, then he spends a total of only 2 + 5 = 7 seconds.
In the second sample one can't get from planet 1 to planet 3 by moving through stargates.
|
```python
# '''
# https://codeforces.com/contest/229/problem/B
# 输入 n(2≤n≤1e5) m(0≤m≤1e5) 表示一个 n 点 m 边的无向图(节点编号从 1 开始)。
# 然后输入 m 条边,每条边包含 3 个数 a b c(1≤c≤1e4),表示有一条边权为 c 的无向边连接 a 和 b。
# 保证无自环、无重边。
# 然后输入 n 行,每行第一个数 k 表示数组 t[i] 的长度,然后输入数组 t[i]。
# 数组 t[i] 是一个严格递增序列,0≤t[i][j]<1e9。
# 所有 k 之和 ≤1e5。
# 初始时间为 0。你从 1 出发,要去 n。
# 如果你在点 i,但是当前时间在数组 t[i] 中,那么你必须等待 1 秒。如果下一秒仍然在 t[i] 中,那么继续等待 1 秒。依此类推。
# 输出到达 n 的最早时间。
# 如果无法到达 n,输出 -1。
# 【易错题】
# 输入
# 4 6
# 1 2 2
# 1 3 3
# 1 4 8
# 2 3 4
# 2 4 5
# 3 4 3
# 0
# 1 3
# 2 3 4
# 0
# 输出 7
# 输入
# 3 1
# 1 2 3
# 0
# 1 3
# 0
# 输出 -1
# '''
# from cmath import inf
# from collections import defaultdict
# from heapq import heappop, heappush
# def _n():
# return int(input())
# def _nA():
# return list(map(int, input().split()))
# def _nS():
# return input().split()
# def solve():
# n, m = _nA()
# graph = [[]for _ in range(n)]
# for i in range(m):
# a, b, c = _nA()
# a -= 1
# b -= 1
# graph[a].append((b, c))
# graph[b].append((a, c))
# t = [None]*n
# for i in range(n):
# t[i] = _nA()[1:]
# dist = [inf]*n
# dist[0] = 0
# q = [(0, 0)]
# while q:
# d, x = heappop(q)
# if d!=dist[x]:
# continue
# for i in t[x]:
# if d == i:
# d += 1
# for y, c in graph[x]:
# if dist[x]+c < dist[y]:
# dist[y] = min(dist[y], d+c)
# heappush(q, (dist[y], y))
# return dist[-1] if dist[-1] != inf else -1
# print(solve())
import sys
from heapq import *
r=sys.stdin.readline
n,m = map(int,r().split())
g=[[] for _ in range(n+1)]
for _ in range(m):
a,b,c=map(int,r().split())
g[a].append((b,c))
g[b].append((a,c))
times=[[]]
for _ in range(n):
times.append(list(map(int,r().split()))[1:])
INF = sys.maxsize
dist = [INF]*(n+1)
dist[1]=0
q=[(0,1)]
while q:
d,idx = heappop(q)
if d !=dist[idx]:
continue
cur = dist[idx]
for i in times[idx]:
if i==cur:
cur+=1
for e,cost in g[idx]:
if dist[e] > dist[idx]+cost:
dist[e] = min(dist[e], cur+cost)
heappush(q,(dist[e],e))
print(dist[n] if dist[n]!=INF else -1)
```
| 3 |
|
237 |
A
|
Free Cash
|
PROGRAMMING
| 1,000 |
[
"implementation"
] | null | null |
Valera runs a 24/7 fast food cafe. He magically learned that next day *n* people will visit his cafe. For each person we know the arrival time: the *i*-th person comes exactly at *h**i* hours *m**i* minutes. The cafe spends less than a minute to serve each client, but if a client comes in and sees that there is no free cash, than he doesn't want to wait and leaves the cafe immediately.
Valera is very greedy, so he wants to serve all *n* customers next day (and get more profit). However, for that he needs to ensure that at each moment of time the number of working cashes is no less than the number of clients in the cafe.
Help Valera count the minimum number of cashes to work at his cafe next day, so that they can serve all visitors.
|
The first line contains a single integer *n* (1<=≤<=*n*<=≤<=105), that is the number of cafe visitors.
Each of the following *n* lines has two space-separated integers *h**i* and *m**i* (0<=≤<=*h**i*<=≤<=23; 0<=≤<=*m**i*<=≤<=59), representing the time when the *i*-th person comes into the cafe.
Note that the time is given in the chronological order. All time is given within one 24-hour period.
|
Print a single integer — the minimum number of cashes, needed to serve all clients next day.
|
[
"4\n8 0\n8 10\n8 10\n8 45\n",
"3\n0 12\n10 11\n22 22\n"
] |
[
"2\n",
"1\n"
] |
In the first sample it is not enough one cash to serve all clients, because two visitors will come into cafe in 8:10. Therefore, if there will be one cash in cafe, then one customer will be served by it, and another one will not wait and will go away.
In the second sample all visitors will come in different times, so it will be enough one cash.
| 500 |
[
{
"input": "4\n8 0\n8 10\n8 10\n8 45",
"output": "2"
},
{
"input": "3\n0 12\n10 11\n22 22",
"output": "1"
},
{
"input": "5\n12 8\n15 27\n15 27\n16 2\n19 52",
"output": "2"
},
{
"input": "7\n5 6\n7 34\n7 34\n7 34\n12 29\n15 19\n20 23",
"output": "3"
},
{
"input": "8\n0 36\n4 7\n4 7\n4 7\n11 46\n12 4\n15 39\n18 6",
"output": "3"
},
{
"input": "20\n4 12\n4 21\n4 27\n4 56\n5 55\n7 56\n11 28\n11 36\n14 58\n15 59\n16 8\n17 12\n17 23\n17 23\n17 23\n17 23\n17 23\n17 23\n20 50\n22 32",
"output": "6"
},
{
"input": "10\n1 30\n1 30\n1 30\n1 30\n1 30\n1 30\n1 30\n1 30\n1 30\n1 30",
"output": "10"
},
{
"input": "50\n0 23\n1 21\n2 8\n2 45\n3 1\n4 19\n4 37\n7 7\n7 40\n8 43\n9 51\n10 13\n11 2\n11 19\n11 30\n12 37\n12 37\n12 37\n12 37\n12 37\n12 37\n12 37\n12 37\n12 54\n13 32\n13 42\n14 29\n14 34\n14 48\n15 0\n15 27\n16 22\n16 31\n17 25\n17 26\n17 33\n18 14\n18 16\n18 20\n19 0\n19 5\n19 56\n20 22\n21 26\n22 0\n22 10\n22 11\n22 36\n23 17\n23 20",
"output": "8"
},
{
"input": "10\n0 39\n1 35\n1 49\n1 51\n5 24\n7 40\n7 56\n16 42\n23 33\n23 49",
"output": "1"
},
{
"input": "15\n0 16\n6 15\n8 2\n8 6\n8 7\n10 1\n10 1\n10 3\n10 12\n13 5\n14 16\n14 16\n14 16\n14 16\n14 16",
"output": "5"
},
{
"input": "2\n0 24\n1 0",
"output": "1"
},
{
"input": "1\n0 0",
"output": "1"
},
{
"input": "1\n1 5",
"output": "1"
},
{
"input": "1\n1 1",
"output": "1"
},
{
"input": "3\n0 0\n0 0\n0 0",
"output": "3"
},
{
"input": "1\n5 0",
"output": "1"
},
{
"input": "5\n0 0\n0 0\n0 0\n0 0\n0 0",
"output": "5"
},
{
"input": "1\n10 10",
"output": "1"
},
{
"input": "1\n8 0",
"output": "1"
},
{
"input": "10\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0",
"output": "10"
},
{
"input": "2\n0 0\n0 1",
"output": "1"
},
{
"input": "2\n8 5\n8 5",
"output": "2"
}
] | 1,620,497,558 | 2,147,483,647 |
PyPy 3
|
WRONG_ANSWER
|
TESTS
| 6 | 186 | 20,172,800 |
ho,mi = None,None
ans=1
c =1
maxx=1
for _ in range(int(input())):
a,b = map(int,input().split())
if a==ho and b==mi:
c+=1
ans+=1
maxx = max(c,ans)
else:
c=1
ho,mi = a,b
print(maxx)
|
Title: Free Cash
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Valera runs a 24/7 fast food cafe. He magically learned that next day *n* people will visit his cafe. For each person we know the arrival time: the *i*-th person comes exactly at *h**i* hours *m**i* minutes. The cafe spends less than a minute to serve each client, but if a client comes in and sees that there is no free cash, than he doesn't want to wait and leaves the cafe immediately.
Valera is very greedy, so he wants to serve all *n* customers next day (and get more profit). However, for that he needs to ensure that at each moment of time the number of working cashes is no less than the number of clients in the cafe.
Help Valera count the minimum number of cashes to work at his cafe next day, so that they can serve all visitors.
Input Specification:
The first line contains a single integer *n* (1<=≤<=*n*<=≤<=105), that is the number of cafe visitors.
Each of the following *n* lines has two space-separated integers *h**i* and *m**i* (0<=≤<=*h**i*<=≤<=23; 0<=≤<=*m**i*<=≤<=59), representing the time when the *i*-th person comes into the cafe.
Note that the time is given in the chronological order. All time is given within one 24-hour period.
Output Specification:
Print a single integer — the minimum number of cashes, needed to serve all clients next day.
Demo Input:
['4\n8 0\n8 10\n8 10\n8 45\n', '3\n0 12\n10 11\n22 22\n']
Demo Output:
['2\n', '1\n']
Note:
In the first sample it is not enough one cash to serve all clients, because two visitors will come into cafe in 8:10. Therefore, if there will be one cash in cafe, then one customer will be served by it, and another one will not wait and will go away.
In the second sample all visitors will come in different times, so it will be enough one cash.
|
```python
ho,mi = None,None
ans=1
c =1
maxx=1
for _ in range(int(input())):
a,b = map(int,input().split())
if a==ho and b==mi:
c+=1
ans+=1
maxx = max(c,ans)
else:
c=1
ho,mi = a,b
print(maxx)
```
| 0 |
|
703 |
A
|
Mishka and Game
|
PROGRAMMING
| 800 |
[
"implementation"
] | null | null |
Mishka is a little polar bear. As known, little bears loves spending their free time playing dice for chocolates. Once in a wonderful sunny morning, walking around blocks of ice, Mishka met her friend Chris, and they started playing the game.
Rules of the game are very simple: at first number of rounds *n* is defined. In every round each of the players throws a cubical dice with distinct numbers from 1 to 6 written on its faces. Player, whose value after throwing the dice is greater, wins the round. In case if player dice values are equal, no one of them is a winner.
In average, player, who won most of the rounds, is the winner of the game. In case if two players won the same number of rounds, the result of the game is draw.
Mishka is still very little and can't count wins and losses, so she asked you to watch their game and determine its result. Please help her!
|
The first line of the input contains single integer *n* *n* (1<=≤<=*n*<=≤<=100) — the number of game rounds.
The next *n* lines contains rounds description. *i*-th of them contains pair of integers *m**i* and *c**i* (1<=≤<=*m**i*,<=<=*c**i*<=≤<=6) — values on dice upper face after Mishka's and Chris' throws in *i*-th round respectively.
|
If Mishka is the winner of the game, print "Mishka" (without quotes) in the only line.
If Chris is the winner of the game, print "Chris" (without quotes) in the only line.
If the result of the game is draw, print "Friendship is magic!^^" (without quotes) in the only line.
|
[
"3\n3 5\n2 1\n4 2\n",
"2\n6 1\n1 6\n",
"3\n1 5\n3 3\n2 2\n"
] |
[
"Mishka",
"Friendship is magic!^^",
"Chris"
] |
In the first sample case Mishka loses the first round, but wins second and third rounds and thus she is the winner of the game.
In the second sample case Mishka wins the first round, Chris wins the second round, and the game ends with draw with score 1:1.
In the third sample case Chris wins the first round, but there is no winner of the next two rounds. The winner of the game is Chris.
| 500 |
[
{
"input": "3\n3 5\n2 1\n4 2",
"output": "Mishka"
},
{
"input": "2\n6 1\n1 6",
"output": "Friendship is magic!^^"
},
{
"input": "3\n1 5\n3 3\n2 2",
"output": "Chris"
},
{
"input": "6\n4 1\n4 2\n5 3\n5 1\n5 3\n4 1",
"output": "Mishka"
},
{
"input": "8\n2 4\n1 4\n1 5\n2 6\n2 5\n2 5\n2 4\n2 5",
"output": "Chris"
},
{
"input": "8\n4 1\n2 6\n4 2\n2 5\n5 2\n3 5\n5 2\n1 5",
"output": "Friendship is magic!^^"
},
{
"input": "9\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n2 1\n2 1\n1 3",
"output": "Mishka"
},
{
"input": "9\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n1 6\n1 6\n1 6",
"output": "Mishka"
},
{
"input": "9\n1 2\n1 2\n1 2\n1 2\n1 2\n6 1\n6 1\n6 1\n6 1",
"output": "Chris"
},
{
"input": "9\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n1 6\n1 6\n1 6",
"output": "Mishka"
},
{
"input": "10\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n2 1\n2 1\n2 1\n1 4",
"output": "Mishka"
},
{
"input": "10\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n1 6\n1 6\n1 6",
"output": "Mishka"
},
{
"input": "10\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n6 1\n6 1\n6 1\n6 1",
"output": "Chris"
},
{
"input": "10\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n1 6\n1 6\n1 6",
"output": "Mishka"
},
{
"input": "100\n2 4\n6 6\n3 2\n1 5\n5 2\n1 5\n1 5\n3 1\n6 5\n4 3\n1 1\n5 1\n3 3\n2 4\n1 5\n3 4\n5 1\n5 5\n2 5\n2 1\n4 3\n6 5\n1 1\n2 1\n1 3\n1 1\n6 4\n4 6\n6 4\n2 1\n2 5\n6 2\n3 4\n5 5\n1 4\n4 6\n3 4\n1 6\n5 1\n4 3\n3 4\n2 2\n1 2\n2 3\n1 3\n4 4\n5 5\n4 5\n4 4\n3 1\n4 5\n2 3\n2 6\n6 5\n6 1\n6 6\n2 3\n6 4\n3 3\n2 5\n4 4\n3 1\n2 4\n6 1\n3 2\n1 3\n5 4\n6 6\n2 5\n5 1\n1 1\n2 5\n6 5\n3 6\n5 6\n4 3\n3 4\n3 4\n6 5\n5 2\n4 2\n1 1\n3 1\n2 6\n1 6\n1 2\n6 1\n3 4\n1 6\n3 1\n5 3\n1 3\n5 6\n2 1\n6 4\n3 1\n1 6\n6 3\n3 3\n4 3",
"output": "Chris"
},
{
"input": "100\n4 1\n3 4\n4 6\n4 5\n6 5\n5 3\n6 2\n6 3\n5 2\n4 5\n1 5\n5 4\n1 4\n4 5\n4 6\n1 6\n4 4\n5 1\n6 4\n6 4\n4 6\n2 3\n6 2\n4 6\n1 4\n2 3\n4 3\n1 3\n6 2\n3 1\n3 4\n2 6\n4 5\n5 4\n2 2\n2 5\n4 1\n2 2\n3 3\n1 4\n5 6\n6 4\n4 2\n6 1\n5 5\n4 1\n2 1\n6 4\n4 4\n4 3\n5 3\n4 5\n5 3\n3 5\n6 3\n1 1\n3 4\n6 3\n6 1\n5 1\n2 4\n4 3\n2 2\n5 5\n1 5\n5 3\n4 6\n1 4\n6 3\n4 3\n2 4\n3 2\n2 4\n3 4\n6 2\n5 6\n1 2\n1 5\n5 5\n2 6\n5 1\n1 6\n5 3\n3 5\n2 6\n4 6\n6 2\n3 1\n5 5\n6 1\n3 6\n4 4\n1 1\n4 6\n5 3\n4 2\n5 1\n3 3\n2 1\n1 4",
"output": "Mishka"
},
{
"input": "100\n6 3\n4 5\n4 3\n5 4\n5 1\n6 3\n4 2\n4 6\n3 1\n2 4\n2 2\n4 6\n5 3\n5 5\n4 2\n6 2\n2 3\n4 4\n6 4\n3 5\n2 4\n2 2\n5 2\n3 5\n2 4\n4 4\n3 5\n6 5\n1 3\n1 6\n2 2\n2 4\n3 2\n5 4\n1 6\n3 4\n4 1\n1 5\n1 4\n5 3\n2 2\n4 5\n6 3\n4 4\n1 1\n4 1\n2 4\n4 1\n4 5\n5 3\n1 1\n1 6\n5 6\n6 6\n4 2\n4 3\n3 4\n3 6\n3 4\n6 5\n3 4\n5 4\n5 1\n5 3\n5 1\n1 2\n2 6\n3 4\n6 5\n4 3\n1 1\n5 5\n5 1\n3 3\n5 2\n1 3\n6 6\n5 6\n1 4\n4 4\n1 4\n3 6\n6 5\n3 3\n3 6\n1 5\n1 2\n3 6\n3 6\n4 1\n5 2\n1 2\n5 2\n3 3\n4 4\n4 2\n6 2\n5 4\n6 1\n6 3",
"output": "Mishka"
},
{
"input": "8\n4 1\n6 2\n4 1\n5 3\n4 1\n5 3\n6 2\n5 3",
"output": "Mishka"
},
{
"input": "5\n3 6\n3 5\n3 5\n1 6\n3 5",
"output": "Chris"
},
{
"input": "4\n4 1\n2 4\n5 3\n3 6",
"output": "Friendship is magic!^^"
},
{
"input": "6\n6 3\n5 1\n6 3\n4 3\n4 3\n5 2",
"output": "Mishka"
},
{
"input": "7\n3 4\n1 4\n2 5\n1 6\n1 6\n1 5\n3 4",
"output": "Chris"
},
{
"input": "6\n6 2\n2 5\n5 2\n3 6\n4 3\n1 6",
"output": "Friendship is magic!^^"
},
{
"input": "8\n6 1\n5 3\n4 3\n4 1\n5 1\n4 2\n4 2\n4 1",
"output": "Mishka"
},
{
"input": "9\n2 5\n2 5\n1 4\n2 6\n2 4\n2 5\n2 6\n1 5\n2 5",
"output": "Chris"
},
{
"input": "4\n6 2\n2 4\n4 2\n3 6",
"output": "Friendship is magic!^^"
},
{
"input": "9\n5 2\n4 1\n4 1\n5 1\n6 2\n6 1\n5 3\n6 1\n6 2",
"output": "Mishka"
},
{
"input": "8\n2 4\n3 6\n1 6\n1 6\n2 4\n3 4\n3 6\n3 4",
"output": "Chris"
},
{
"input": "6\n5 3\n3 6\n6 2\n1 6\n5 1\n3 5",
"output": "Friendship is magic!^^"
},
{
"input": "6\n5 2\n5 1\n6 1\n5 2\n4 2\n5 1",
"output": "Mishka"
},
{
"input": "5\n1 4\n2 5\n3 4\n2 6\n3 4",
"output": "Chris"
},
{
"input": "4\n6 2\n3 4\n5 1\n1 6",
"output": "Friendship is magic!^^"
},
{
"input": "93\n4 3\n4 1\n4 2\n5 2\n5 3\n6 3\n4 3\n6 2\n6 3\n5 1\n4 2\n4 2\n5 1\n6 2\n6 3\n6 1\n4 1\n6 2\n5 3\n4 3\n4 1\n4 2\n5 2\n6 3\n5 2\n5 2\n6 3\n5 1\n6 2\n5 2\n4 1\n5 2\n5 1\n4 1\n6 1\n5 2\n4 3\n5 3\n5 3\n5 1\n4 3\n4 3\n4 2\n4 1\n6 2\n6 1\n4 1\n5 2\n5 2\n6 2\n5 3\n5 1\n6 2\n5 1\n6 3\n5 2\n6 2\n6 2\n4 2\n5 2\n6 1\n6 3\n6 3\n5 1\n5 1\n4 1\n5 1\n4 3\n5 3\n6 3\n4 1\n4 3\n6 1\n6 1\n4 2\n6 2\n4 2\n5 2\n4 1\n5 2\n4 1\n5 1\n5 2\n5 1\n4 1\n6 3\n6 2\n4 3\n4 1\n5 2\n4 3\n5 2\n5 1",
"output": "Mishka"
},
{
"input": "11\n1 6\n1 6\n2 4\n2 5\n3 4\n1 5\n1 6\n1 5\n1 6\n2 6\n3 4",
"output": "Chris"
},
{
"input": "70\n6 1\n3 6\n4 3\n2 5\n5 2\n1 4\n6 2\n1 6\n4 3\n1 4\n5 3\n2 4\n5 3\n1 6\n5 1\n3 5\n4 2\n2 4\n5 1\n3 5\n6 2\n1 5\n4 2\n2 5\n5 3\n1 5\n4 2\n1 4\n5 2\n2 6\n4 3\n1 5\n6 2\n3 4\n4 2\n3 5\n6 3\n3 4\n5 1\n1 4\n4 2\n1 4\n6 3\n2 6\n5 2\n1 6\n6 1\n2 6\n5 3\n1 5\n5 1\n1 6\n4 1\n1 5\n4 2\n2 4\n5 1\n2 5\n6 3\n1 4\n6 3\n3 6\n5 1\n1 4\n5 3\n3 5\n4 2\n3 4\n6 2\n1 4",
"output": "Friendship is magic!^^"
},
{
"input": "59\n4 1\n5 3\n6 1\n4 2\n5 1\n4 3\n6 1\n5 1\n4 3\n4 3\n5 2\n5 3\n4 1\n6 2\n5 1\n6 3\n6 3\n5 2\n5 2\n6 1\n4 1\n6 1\n4 3\n5 3\n5 3\n4 3\n4 2\n4 2\n6 3\n6 3\n6 1\n4 3\n5 1\n6 2\n6 1\n4 1\n6 1\n5 3\n4 2\n5 1\n6 2\n6 2\n4 3\n5 3\n4 3\n6 3\n5 2\n5 2\n4 3\n5 1\n5 3\n6 1\n6 3\n6 3\n4 3\n5 2\n5 2\n5 2\n4 3",
"output": "Mishka"
},
{
"input": "42\n1 5\n1 6\n1 6\n1 4\n2 5\n3 6\n1 6\n3 4\n2 5\n2 5\n2 4\n1 4\n3 4\n2 4\n2 6\n1 5\n3 6\n2 6\n2 6\n3 5\n1 4\n1 5\n2 6\n3 6\n1 4\n3 4\n2 4\n1 6\n3 4\n2 4\n2 6\n1 6\n1 4\n1 6\n1 6\n2 4\n1 5\n1 6\n2 5\n3 6\n3 5\n3 4",
"output": "Chris"
},
{
"input": "78\n4 3\n3 5\n4 3\n1 5\n5 1\n1 5\n4 3\n1 4\n6 3\n1 5\n4 1\n2 4\n4 3\n2 4\n5 1\n3 6\n4 2\n3 6\n6 3\n3 4\n4 3\n3 6\n5 3\n1 5\n4 1\n2 6\n4 2\n2 4\n4 1\n3 5\n5 2\n3 6\n4 3\n2 4\n6 3\n1 6\n4 3\n3 5\n6 3\n2 6\n4 1\n2 4\n6 2\n1 6\n4 2\n1 4\n4 3\n1 4\n4 3\n2 4\n6 2\n3 5\n6 1\n3 6\n5 3\n1 6\n6 1\n2 6\n4 2\n1 5\n6 2\n2 6\n6 3\n2 4\n4 2\n3 5\n6 1\n2 5\n5 3\n2 6\n5 1\n3 6\n4 3\n3 6\n6 3\n2 5\n6 1\n2 6",
"output": "Friendship is magic!^^"
},
{
"input": "76\n4 1\n5 2\n4 3\n5 2\n5 3\n5 2\n6 1\n4 2\n6 2\n5 3\n4 2\n6 2\n4 1\n4 2\n5 1\n5 1\n6 2\n5 2\n5 3\n6 3\n5 2\n4 3\n6 3\n6 1\n4 3\n6 2\n6 1\n4 1\n6 1\n5 3\n4 1\n5 3\n4 2\n5 2\n4 3\n6 1\n6 2\n5 2\n6 1\n5 3\n4 3\n5 1\n5 3\n4 3\n5 1\n5 1\n4 1\n4 1\n4 1\n4 3\n5 3\n6 3\n6 3\n5 2\n6 2\n6 3\n5 1\n6 3\n5 3\n6 1\n5 3\n4 1\n5 3\n6 1\n4 2\n6 2\n4 3\n4 1\n6 2\n4 3\n5 3\n5 2\n5 3\n5 1\n6 3\n5 2",
"output": "Mishka"
},
{
"input": "84\n3 6\n3 4\n2 5\n2 4\n1 6\n3 4\n1 5\n1 6\n3 5\n1 6\n2 4\n2 6\n2 6\n2 4\n3 5\n1 5\n3 6\n3 6\n3 4\n3 4\n2 6\n1 6\n1 6\n3 5\n3 4\n1 6\n3 4\n3 5\n2 4\n2 5\n2 5\n3 5\n1 6\n3 4\n2 6\n2 6\n3 4\n3 4\n2 5\n2 5\n2 4\n3 4\n2 5\n3 4\n3 4\n2 6\n2 6\n1 6\n2 4\n1 5\n3 4\n2 5\n2 5\n3 4\n2 4\n2 6\n2 6\n1 4\n3 5\n3 5\n2 4\n2 5\n3 4\n1 5\n1 5\n2 6\n1 5\n3 5\n2 4\n2 5\n3 4\n2 6\n1 6\n2 5\n3 5\n3 5\n3 4\n2 5\n2 6\n3 4\n1 6\n2 5\n2 6\n1 4",
"output": "Chris"
},
{
"input": "44\n6 1\n1 6\n5 2\n1 4\n6 2\n2 5\n5 3\n3 6\n5 2\n1 6\n4 1\n2 4\n6 1\n3 4\n6 3\n3 6\n4 3\n2 4\n6 1\n3 4\n6 1\n1 6\n4 1\n3 5\n6 1\n3 6\n4 1\n1 4\n4 2\n2 6\n6 1\n2 4\n6 2\n1 4\n6 2\n2 4\n5 2\n3 6\n6 3\n2 6\n5 3\n3 4\n5 3\n2 4",
"output": "Friendship is magic!^^"
},
{
"input": "42\n5 3\n5 1\n5 2\n4 1\n6 3\n6 1\n6 2\n4 1\n4 3\n4 1\n5 1\n5 3\n5 1\n4 1\n4 2\n6 1\n6 3\n5 1\n4 1\n4 1\n6 3\n4 3\n6 3\n5 2\n6 1\n4 1\n5 3\n4 3\n5 2\n6 3\n6 1\n5 1\n4 2\n4 3\n5 2\n5 3\n6 3\n5 2\n5 1\n5 3\n6 2\n6 1",
"output": "Mishka"
},
{
"input": "50\n3 6\n2 6\n1 4\n1 4\n1 4\n2 5\n3 4\n3 5\n2 6\n1 6\n3 5\n1 5\n2 6\n2 4\n2 4\n3 5\n1 6\n1 5\n1 5\n1 4\n3 5\n1 6\n3 5\n1 4\n1 5\n1 4\n3 6\n1 6\n1 4\n1 4\n1 4\n1 5\n3 6\n1 6\n1 6\n2 4\n1 5\n2 6\n2 5\n3 5\n3 6\n3 4\n2 4\n2 6\n3 4\n2 5\n3 6\n3 5\n2 4\n2 4",
"output": "Chris"
},
{
"input": "86\n6 3\n2 4\n6 3\n3 5\n6 3\n1 5\n5 2\n2 4\n4 3\n2 6\n4 1\n2 6\n5 2\n1 4\n5 1\n2 4\n4 1\n1 4\n6 2\n3 5\n4 2\n2 4\n6 2\n1 5\n5 3\n2 5\n5 1\n1 6\n6 1\n1 4\n4 3\n3 4\n5 2\n2 4\n5 3\n2 5\n4 3\n3 4\n4 1\n1 5\n6 3\n3 4\n4 3\n3 4\n4 1\n3 4\n5 1\n1 6\n4 2\n1 6\n5 1\n2 4\n5 1\n3 6\n4 1\n1 5\n5 2\n1 4\n4 3\n2 5\n5 1\n1 5\n6 2\n2 6\n4 2\n2 4\n4 1\n2 5\n5 3\n3 4\n5 1\n3 4\n6 3\n3 4\n4 3\n2 6\n6 2\n2 5\n5 2\n3 5\n4 2\n3 6\n6 2\n3 4\n4 2\n2 4",
"output": "Friendship is magic!^^"
},
{
"input": "84\n6 1\n6 3\n6 3\n4 1\n4 3\n4 2\n6 3\n5 3\n6 1\n6 3\n4 3\n5 2\n5 3\n5 1\n6 2\n6 2\n6 1\n4 1\n6 3\n5 2\n4 1\n5 3\n6 3\n4 2\n6 2\n6 3\n4 3\n4 1\n4 3\n5 1\n5 1\n5 1\n4 1\n6 1\n4 3\n6 2\n5 1\n5 1\n6 2\n5 2\n4 1\n6 1\n6 1\n6 3\n6 2\n4 3\n6 3\n6 2\n5 2\n5 1\n4 3\n6 2\n4 1\n6 2\n6 1\n5 2\n5 1\n6 2\n6 1\n5 3\n5 2\n6 1\n6 3\n5 2\n6 1\n6 3\n4 3\n5 1\n6 3\n6 1\n5 3\n4 3\n5 2\n5 1\n6 2\n5 3\n6 1\n5 1\n4 1\n5 1\n5 1\n5 2\n5 2\n5 1",
"output": "Mishka"
},
{
"input": "92\n1 5\n2 4\n3 5\n1 6\n2 5\n1 6\n3 6\n1 6\n2 4\n3 4\n3 4\n3 6\n1 5\n2 5\n1 5\n1 5\n2 6\n2 4\n3 6\n1 4\n1 6\n2 6\n3 4\n2 6\n2 6\n1 4\n3 5\n2 5\n2 6\n1 5\n1 4\n1 5\n3 6\n3 5\n2 5\n1 5\n3 5\n3 6\n2 6\n2 6\n1 5\n3 4\n2 4\n3 6\n2 5\n1 5\n2 4\n1 4\n2 6\n2 6\n2 6\n1 5\n3 6\n3 6\n2 5\n1 4\n2 4\n3 4\n1 5\n2 5\n2 4\n2 5\n3 5\n3 4\n3 6\n2 6\n3 5\n1 4\n3 4\n1 6\n3 6\n2 6\n1 4\n3 6\n3 6\n2 5\n2 6\n1 6\n2 6\n3 5\n2 5\n3 6\n2 5\n2 6\n1 5\n2 4\n1 4\n2 4\n1 5\n2 5\n2 5\n2 6",
"output": "Chris"
},
{
"input": "20\n5 1\n1 4\n4 3\n1 5\n4 2\n3 6\n6 2\n1 6\n4 1\n1 4\n5 2\n3 4\n5 1\n1 6\n5 1\n2 6\n6 3\n2 5\n6 2\n2 4",
"output": "Friendship is magic!^^"
},
{
"input": "100\n4 3\n4 3\n4 2\n4 3\n4 1\n4 3\n5 2\n5 2\n6 2\n4 2\n5 1\n4 2\n5 2\n6 1\n4 1\n6 3\n5 3\n5 1\n5 1\n5 1\n5 3\n6 1\n6 1\n4 1\n5 2\n5 2\n6 1\n6 3\n4 2\n4 1\n5 3\n4 1\n5 3\n5 1\n6 3\n6 3\n6 1\n5 2\n5 3\n5 3\n6 1\n4 1\n6 2\n6 1\n6 2\n6 3\n4 3\n4 3\n6 3\n4 2\n4 2\n5 3\n5 2\n5 2\n4 3\n5 3\n5 2\n4 2\n5 1\n4 2\n5 1\n5 3\n6 3\n5 3\n5 3\n4 2\n4 1\n4 2\n4 3\n6 3\n4 3\n6 2\n6 1\n5 3\n5 2\n4 1\n6 1\n5 2\n6 2\n4 2\n6 3\n4 3\n5 1\n6 3\n5 2\n4 3\n5 3\n5 3\n4 3\n6 3\n4 3\n4 1\n5 1\n6 2\n6 3\n5 3\n6 1\n6 3\n5 3\n6 1",
"output": "Mishka"
},
{
"input": "100\n1 5\n1 4\n1 5\n2 4\n2 6\n3 6\n3 5\n1 5\n2 5\n3 6\n3 5\n1 6\n1 4\n1 5\n1 6\n2 6\n1 5\n3 5\n3 4\n2 6\n2 6\n2 5\n3 4\n1 6\n1 4\n2 4\n1 5\n1 6\n3 5\n1 6\n2 6\n3 5\n1 6\n3 4\n3 5\n1 6\n3 6\n2 4\n2 4\n3 5\n2 6\n1 5\n3 5\n3 6\n2 4\n2 4\n2 6\n3 4\n3 4\n1 5\n1 4\n2 5\n3 4\n1 4\n2 6\n2 5\n2 4\n2 4\n2 5\n1 5\n1 6\n1 5\n1 5\n1 5\n1 6\n3 4\n2 4\n3 5\n3 5\n1 6\n3 5\n1 5\n1 6\n3 6\n3 4\n1 5\n3 5\n3 6\n1 4\n3 6\n1 5\n3 5\n3 6\n3 5\n1 4\n3 4\n2 4\n2 4\n2 5\n3 6\n3 5\n1 5\n2 4\n1 4\n3 4\n1 5\n3 4\n3 6\n3 5\n3 4",
"output": "Chris"
},
{
"input": "100\n4 3\n3 4\n5 1\n2 5\n5 3\n1 5\n6 3\n2 4\n5 2\n2 6\n5 2\n1 5\n6 3\n1 5\n6 3\n3 4\n5 2\n1 5\n6 1\n1 5\n4 2\n3 5\n6 3\n2 6\n6 3\n1 4\n6 2\n3 4\n4 1\n3 6\n5 1\n2 4\n5 1\n3 4\n6 2\n3 5\n4 1\n2 6\n4 3\n2 6\n5 2\n3 6\n6 2\n3 5\n4 3\n1 5\n5 3\n3 6\n4 2\n3 4\n6 1\n3 4\n5 2\n2 6\n5 2\n2 4\n6 2\n3 6\n4 3\n2 4\n4 3\n2 6\n4 2\n3 4\n6 3\n2 4\n6 3\n3 5\n5 2\n1 5\n6 3\n3 6\n4 3\n1 4\n5 2\n1 6\n4 1\n2 5\n4 1\n2 4\n4 2\n2 5\n6 1\n2 4\n6 3\n1 5\n4 3\n2 6\n6 3\n2 6\n5 3\n1 5\n4 1\n1 5\n6 2\n2 5\n5 1\n3 6\n4 3\n3 4",
"output": "Friendship is magic!^^"
},
{
"input": "99\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n2 1\n2 1\n1 3",
"output": "Mishka"
},
{
"input": "99\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6",
"output": "Mishka"
},
{
"input": "99\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1",
"output": "Chris"
},
{
"input": "99\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6",
"output": "Mishka"
},
{
"input": "100\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n2 1\n2 1\n2 1\n1 4",
"output": "Mishka"
},
{
"input": "100\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6",
"output": "Mishka"
},
{
"input": "100\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1\n6 1",
"output": "Chris"
},
{
"input": "100\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6\n1 6",
"output": "Mishka"
},
{
"input": "84\n6 2\n1 5\n6 2\n2 3\n5 5\n1 2\n3 4\n3 4\n6 5\n6 4\n2 5\n4 1\n1 2\n1 1\n1 4\n2 5\n5 6\n6 3\n2 4\n5 5\n2 6\n3 4\n5 1\n3 3\n5 5\n4 6\n4 6\n2 4\n4 1\n5 2\n2 2\n3 6\n3 3\n4 6\n1 1\n2 4\n6 5\n5 2\n6 5\n5 5\n2 5\n6 4\n1 1\n6 2\n3 6\n6 5\n4 4\n1 5\n5 6\n4 4\n3 5\n6 1\n3 4\n1 5\n4 6\n4 6\n4 1\n3 6\n6 2\n1 1\n4 5\n5 4\n5 3\n3 4\n6 4\n1 1\n5 2\n6 5\n6 1\n2 2\n2 4\n3 3\n4 6\n1 3\n6 6\n5 2\n1 6\n6 2\n6 6\n4 1\n3 6\n6 4\n2 3\n3 4",
"output": "Chris"
},
{
"input": "70\n3 4\n2 3\n2 3\n6 5\n6 6\n4 3\n2 3\n3 1\n3 5\n5 6\n1 6\n2 5\n5 3\n2 5\n4 6\n5 1\n6 1\n3 1\n3 3\n5 3\n2 1\n3 3\n6 4\n6 3\n4 3\n4 5\n3 5\n5 5\n5 2\n1 6\n3 4\n5 2\n2 4\n1 6\n4 3\n4 3\n6 2\n1 3\n1 5\n6 1\n3 1\n1 1\n1 3\n2 2\n3 2\n6 4\n1 1\n4 4\n3 1\n4 5\n4 2\n6 3\n4 4\n3 2\n1 2\n2 6\n3 3\n1 5\n1 1\n6 5\n2 2\n3 1\n5 4\n5 2\n6 4\n6 3\n6 6\n6 3\n3 3\n5 4",
"output": "Mishka"
},
{
"input": "56\n6 4\n3 4\n6 1\n3 3\n1 4\n2 3\n1 5\n2 5\n1 5\n5 5\n2 3\n1 1\n3 2\n3 5\n4 6\n4 4\n5 2\n4 3\n3 1\n3 6\n2 3\n3 4\n5 6\n5 2\n5 6\n1 5\n1 5\n4 1\n6 3\n2 2\n2 1\n5 5\n2 1\n4 1\n5 4\n2 5\n4 1\n6 2\n3 4\n4 2\n6 4\n5 4\n4 2\n4 3\n6 2\n6 2\n3 1\n1 4\n3 6\n5 1\n5 5\n3 6\n6 4\n2 3\n6 5\n3 3",
"output": "Mishka"
},
{
"input": "94\n2 4\n6 4\n1 6\n1 4\n5 1\n3 3\n4 3\n6 1\n6 5\n3 2\n2 3\n5 1\n5 3\n1 2\n4 3\n3 2\n2 3\n4 6\n1 3\n6 3\n1 1\n3 2\n4 3\n1 5\n4 6\n3 2\n6 3\n1 6\n1 1\n1 2\n3 5\n1 3\n3 5\n4 4\n4 2\n1 4\n4 5\n1 3\n1 2\n1 1\n5 4\n5 5\n6 1\n2 1\n2 6\n6 6\n4 2\n3 6\n1 6\n6 6\n1 5\n3 2\n1 2\n4 4\n6 4\n4 1\n1 5\n3 3\n1 3\n3 4\n4 4\n1 1\n2 5\n4 5\n3 1\n3 1\n3 6\n3 2\n1 4\n1 6\n6 3\n2 4\n1 1\n2 2\n2 2\n2 1\n5 4\n1 2\n6 6\n2 2\n3 3\n6 3\n6 3\n1 6\n2 3\n2 4\n2 3\n6 6\n2 6\n6 3\n3 5\n1 4\n1 1\n3 5",
"output": "Chris"
},
{
"input": "81\n4 2\n1 2\n2 3\n4 5\n6 2\n1 6\n3 6\n3 4\n4 6\n4 4\n3 5\n4 6\n3 6\n3 5\n3 1\n1 3\n5 3\n3 4\n1 1\n4 1\n1 2\n6 1\n1 3\n6 5\n4 5\n4 2\n4 5\n6 2\n1 2\n2 6\n5 2\n1 5\n2 4\n4 3\n5 4\n1 2\n5 3\n2 6\n6 4\n1 1\n1 3\n3 1\n3 1\n6 5\n5 5\n6 1\n6 6\n5 2\n1 3\n1 4\n2 3\n5 5\n3 1\n3 1\n4 4\n1 6\n6 4\n2 2\n4 6\n4 4\n2 6\n2 4\n2 4\n4 1\n1 6\n1 4\n1 3\n6 5\n5 1\n1 3\n5 1\n1 4\n3 5\n2 6\n1 3\n5 6\n3 5\n4 4\n5 5\n5 6\n4 3",
"output": "Chris"
},
{
"input": "67\n6 5\n3 6\n1 6\n5 3\n5 4\n5 1\n1 6\n1 1\n3 2\n4 4\n3 1\n4 1\n1 5\n5 3\n3 3\n6 4\n2 4\n2 2\n4 3\n1 4\n1 4\n6 1\n1 2\n2 2\n5 1\n6 2\n3 5\n5 5\n2 2\n6 5\n6 2\n4 4\n3 1\n4 2\n6 6\n6 4\n5 1\n2 2\n4 5\n5 5\n4 6\n1 5\n6 3\n4 4\n1 5\n6 4\n3 6\n3 4\n1 6\n2 4\n2 1\n2 5\n6 5\n6 4\n4 1\n3 2\n1 2\n5 1\n5 6\n1 5\n3 5\n3 1\n5 3\n3 2\n5 1\n4 6\n6 6",
"output": "Mishka"
},
{
"input": "55\n6 6\n6 5\n2 2\n2 2\n6 4\n5 5\n6 5\n5 3\n1 3\n2 2\n5 6\n3 3\n3 3\n6 5\n3 5\n5 5\n1 2\n1 1\n4 6\n1 2\n5 5\n6 2\n6 3\n1 2\n5 1\n1 3\n3 3\n4 4\n2 5\n1 1\n5 3\n4 3\n2 2\n4 5\n5 6\n4 5\n6 3\n1 6\n6 4\n3 6\n1 6\n5 2\n6 3\n2 3\n5 5\n4 3\n3 1\n4 2\n1 1\n2 5\n5 3\n2 2\n6 3\n4 5\n2 2",
"output": "Mishka"
},
{
"input": "92\n2 3\n1 3\n2 6\n5 1\n5 5\n3 2\n5 6\n2 5\n3 1\n3 6\n4 5\n2 5\n1 2\n2 3\n6 5\n3 6\n4 4\n6 2\n4 5\n4 4\n5 1\n6 1\n3 4\n3 5\n6 6\n3 2\n6 4\n2 2\n3 5\n6 4\n6 3\n6 6\n3 4\n3 3\n6 1\n5 4\n6 2\n2 6\n5 6\n1 4\n4 6\n6 3\n3 1\n4 1\n6 6\n3 5\n6 3\n6 1\n1 6\n3 2\n6 6\n4 3\n3 4\n1 3\n3 5\n5 3\n6 5\n4 3\n5 5\n4 1\n1 5\n6 4\n2 3\n2 3\n1 5\n1 2\n5 2\n4 3\n3 6\n5 5\n5 4\n1 4\n3 3\n1 6\n5 6\n5 4\n5 3\n1 1\n6 2\n5 5\n2 5\n4 3\n6 6\n5 1\n1 1\n4 6\n4 6\n3 1\n6 4\n2 4\n2 2\n2 1",
"output": "Chris"
},
{
"input": "79\n5 3\n4 6\n3 6\n2 1\n5 2\n2 3\n4 4\n6 2\n2 5\n1 6\n6 6\n2 6\n3 3\n4 5\n6 2\n2 1\n1 5\n5 1\n2 1\n2 6\n5 3\n6 2\n2 6\n2 3\n1 5\n4 4\n6 3\n5 2\n3 2\n1 3\n1 3\n6 3\n2 6\n3 6\n5 3\n4 5\n6 1\n3 5\n3 5\n6 5\n1 5\n4 2\n6 2\n2 3\n4 6\n3 6\n2 5\n4 4\n1 1\n4 6\n2 6\n6 4\n3 2\n4 1\n1 2\n6 4\n5 6\n1 4\n2 2\n5 4\n3 2\n1 2\n2 4\n2 5\n2 1\n3 6\n3 3\n1 1\n2 2\n4 4\n4 5\n3 3\n5 3\n6 2\n4 5\n6 5\n2 5\n5 6\n2 2",
"output": "Chris"
},
{
"input": "65\n1 1\n5 1\n2 2\n5 4\n4 5\n2 5\n3 2\n5 6\n6 3\n1 1\n6 1\n1 5\n1 1\n5 2\n6 4\n1 6\n1 1\n4 3\n2 3\n5 6\n4 4\n6 2\n1 3\n4 3\n1 3\n6 3\n3 5\n4 2\n4 1\n6 1\n3 2\n2 6\n3 2\n3 5\n6 3\n4 3\n1 5\n2 6\n1 3\n4 1\n4 1\n2 5\n2 5\n6 2\n5 3\n3 1\n3 3\n5 1\n2 4\n5 3\n3 3\n1 1\n6 3\n3 3\n5 1\n1 6\n4 5\n6 6\n5 5\n2 5\n4 1\n2 2\n1 4\n1 6\n6 5",
"output": "Mishka"
},
{
"input": "1\n1 1",
"output": "Friendship is magic!^^"
}
] | 1,674,479,471 | 2,147,483,647 |
Python 3
|
WRONG_ANSWER
|
TESTS
| 15 | 46 | 0 |
n=int(input())
mm=0
cc=0
for i in range(n):
m,c=map(int,input().split())
if(m>c):
mm=mm+1
else:
cc=cc+1
if(mm>cc):
print("Mishka")
elif(mm==cc):
print("Friendship is magic!^^")
else:
print("Chris")
|
Title: Mishka and Game
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Mishka is a little polar bear. As known, little bears loves spending their free time playing dice for chocolates. Once in a wonderful sunny morning, walking around blocks of ice, Mishka met her friend Chris, and they started playing the game.
Rules of the game are very simple: at first number of rounds *n* is defined. In every round each of the players throws a cubical dice with distinct numbers from 1 to 6 written on its faces. Player, whose value after throwing the dice is greater, wins the round. In case if player dice values are equal, no one of them is a winner.
In average, player, who won most of the rounds, is the winner of the game. In case if two players won the same number of rounds, the result of the game is draw.
Mishka is still very little and can't count wins and losses, so she asked you to watch their game and determine its result. Please help her!
Input Specification:
The first line of the input contains single integer *n* *n* (1<=≤<=*n*<=≤<=100) — the number of game rounds.
The next *n* lines contains rounds description. *i*-th of them contains pair of integers *m**i* and *c**i* (1<=≤<=*m**i*,<=<=*c**i*<=≤<=6) — values on dice upper face after Mishka's and Chris' throws in *i*-th round respectively.
Output Specification:
If Mishka is the winner of the game, print "Mishka" (without quotes) in the only line.
If Chris is the winner of the game, print "Chris" (without quotes) in the only line.
If the result of the game is draw, print "Friendship is magic!^^" (without quotes) in the only line.
Demo Input:
['3\n3 5\n2 1\n4 2\n', '2\n6 1\n1 6\n', '3\n1 5\n3 3\n2 2\n']
Demo Output:
['Mishka', 'Friendship is magic!^^', 'Chris']
Note:
In the first sample case Mishka loses the first round, but wins second and third rounds and thus she is the winner of the game.
In the second sample case Mishka wins the first round, Chris wins the second round, and the game ends with draw with score 1:1.
In the third sample case Chris wins the first round, but there is no winner of the next two rounds. The winner of the game is Chris.
|
```python
n=int(input())
mm=0
cc=0
for i in range(n):
m,c=map(int,input().split())
if(m>c):
mm=mm+1
else:
cc=cc+1
if(mm>cc):
print("Mishka")
elif(mm==cc):
print("Friendship is magic!^^")
else:
print("Chris")
```
| 0 |
|
731 |
A
|
Night at the Museum
|
PROGRAMMING
| 800 |
[
"implementation",
"strings"
] | null | null |
Grigoriy, like the hero of one famous comedy film, found a job as a night security guard at the museum. At first night he received embosser and was to take stock of the whole exposition.
Embosser is a special devise that allows to "print" the text of a plastic tape. Text is printed sequentially, character by character. The device consists of a wheel with a lowercase English letters written in a circle, static pointer to the current letter and a button that print the chosen letter. At one move it's allowed to rotate the alphabetic wheel one step clockwise or counterclockwise. Initially, static pointer points to letter 'a'. Other letters are located as shown on the picture:
After Grigoriy add new item to the base he has to print its name on the plastic tape and attach it to the corresponding exhibit. It's not required to return the wheel to its initial position with pointer on the letter 'a'.
Our hero is afraid that some exhibits may become alive and start to attack him, so he wants to print the names as fast as possible. Help him, for the given string find the minimum number of rotations of the wheel required to print it.
|
The only line of input contains the name of some exhibit — the non-empty string consisting of no more than 100 characters. It's guaranteed that the string consists of only lowercase English letters.
|
Print one integer — the minimum number of rotations of the wheel, required to print the name given in the input.
|
[
"zeus\n",
"map\n",
"ares\n"
] |
[
"18\n",
"35\n",
"34\n"
] |
To print the string from the first sample it would be optimal to perform the following sequence of rotations:
1. from 'a' to 'z' (1 rotation counterclockwise), 1. from 'z' to 'e' (5 clockwise rotations), 1. from 'e' to 'u' (10 rotations counterclockwise), 1. from 'u' to 's' (2 counterclockwise rotations).
| 500 |
[
{
"input": "zeus",
"output": "18"
},
{
"input": "map",
"output": "35"
},
{
"input": "ares",
"output": "34"
},
{
"input": "l",
"output": "11"
},
{
"input": "abcdefghijklmnopqrstuvwxyzabcdefghijklmnopqrstuvwxyzabcdefghijklmnopqrstuvwxyzabcdefghijklmnopqrstuv",
"output": "99"
},
{
"input": "gngvi",
"output": "44"
},
{
"input": "aaaaa",
"output": "0"
},
{
"input": "a",
"output": "0"
},
{
"input": "z",
"output": "1"
},
{
"input": "vyadeehhikklnoqrs",
"output": "28"
},
{
"input": "jjiihhhhgggfedcccbazyxx",
"output": "21"
},
{
"input": "fyyptqqxuciqvwdewyppjdzur",
"output": "117"
},
{
"input": "fqcnzmzmbobmancqcoalzmanaobpdse",
"output": "368"
},
{
"input": "zzzzzaaaaaaazzzzzzaaaaaaazzzzzzaaaazzzza",
"output": "8"
},
{
"input": "aucnwhfixuruefkypvrvnvznwtjgwlghoqtisbkhuwxmgzuljvqhmnwzisnsgjhivnjmbknptxatdkelhzkhsuxzrmlcpeoyukiy",
"output": "644"
},
{
"input": "sssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssssss",
"output": "8"
},
{
"input": "nypjygrdtpzpigzyrisqeqfriwgwlengnezppgttgtndbrryjdl",
"output": "421"
},
{
"input": "pnllnnmmmmoqqqqqrrtssssuuvtsrpopqoonllmonnnpppopnonoopooqpnopppqppqstuuuwwwwvxzxzzaa",
"output": "84"
},
{
"input": "btaoahqgxnfsdmzsjxgvdwjukcvereqeskrdufqfqgzqfsftdqcthtkcnaipftcnco",
"output": "666"
},
{
"input": "eeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeerrrrrrrrrrrrrrrrwwwwwwwwww",
"output": "22"
},
{
"input": "uyknzcrwjyzmscqucclvacmorepdgmnyhmakmmnygqwglrxkxhkpansbmruwxdeoprxzmpsvwackopujxbbkpwyeggsvjykpxh",
"output": "643"
},
{
"input": "gzwpooohffcxwtpjgfzwtooiccxsrrokezutoojdzwsrmmhecaxwrojcbyrqlfdwwrliiib",
"output": "245"
},
{
"input": "dbvnkktasjdwqsrzfwwtmjgbcxggdxsoeilecihduypktkkbwfbruxzzhlttrssicgdwqruddwrlbtxgmhdbatzvdxbbro",
"output": "468"
},
{
"input": "mdtvowlktxzzbuaeiuebfeorgbdczauxsovbucactkvyvemsknsjfhifqgycqredzchipmkvzbxdjkcbyukomjlzvxzoswumned",
"output": "523"
},
{
"input": "kkkkkkkaaaaxxaaaaaaaxxxxxxxxaaaaaaxaaaaaaaaaakkkkkkkkkaaaaaaannnnnxxxxkkkkkkkkaannnnnnna",
"output": "130"
},
{
"input": "dffiknqqrsvwzcdgjkmpqtuwxadfhkkkmpqrtwxyadfggjmpppsuuwyyzcdgghhknnpsvvvwwwyabccffiloqruwwyyzabeeehh",
"output": "163"
},
{
"input": "qpppmmkjihgecbyvvsppnnnkjiffeebaaywutrrqpmkjhgddbzzzywtssssqnmmljheddbbaxvusrqonmlifedbbzyywwtqnkheb",
"output": "155"
},
{
"input": "wvvwwwvvwxxxyyyxxwwvwwvuttttttuvvwxxwxxyxxwwwwwvvuttssrssstsssssrqpqqppqrssrsrrssrssssrrsrqqrrqpppqp",
"output": "57"
},
{
"input": "dqcpcobpcobnznamznamzlykxkxlxlylzmaobnaobpbnanbpcoaobnboaoboanzlymzmykylymylzlylymanboanaocqdqesfrfs",
"output": "1236"
},
{
"input": "nnnnnnnnnnnnnnnnnnnnaaaaaaaaaaaaaaaaaaaakkkkkkkkkkkkkkkkkkkkkkaaaaaaaaaaaaaaaaaaaaxxxxxxxxxxxxxxxxxx",
"output": "49"
},
{
"input": "aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa",
"output": "0"
},
{
"input": "cgilqsuwzaffilptwwbgmnttyyejkorxzflqvzbddhmnrvxchijpuwaeiimosxyycejlpquuwbfkpvbgijkqvxybdjjjptxcfkqt",
"output": "331"
},
{
"input": "ufsepwgtzgtgjssxaitgpailuvgqweoppszjwhoxdhhhpwwdorwfrdjwcdekxiktwziqwbkvbknrtvajpyeqbjvhiikxxaejjpte",
"output": "692"
},
{
"input": "uhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuhuh",
"output": "1293"
},
{
"input": "vvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvvgggggggggggggggggggggggggggggggggggggggggggggggggg",
"output": "16"
},
{
"input": "lyidmjyzbszgiwkxhhpnnthfwcvvstueionspfrvqgkvngmwyhezlosrpdnbvtcjjxxsykixwnepbumaacdzadlqhnjlcejovple",
"output": "616"
},
{
"input": "etzqqbaveffalkdguunfmyyrzkccnxmlluxeasqmopxzfvlkbhipqdwjgrttoemruohgwukfisdhznqyvhswbbypoxgtxyappcrl",
"output": "605"
},
{
"input": "lizussgedcbdjhrbeskhgatyozvwwekanlggcstijrniivupmcoofbaxfqrxddyzzptwxcftlhajsmmkkriarrqtkoauhcqefyud",
"output": "549"
},
{
"input": "dvjuvgfdogpknmbowlsfjzcimnygbtjiucyeeroqwhmzwpjqxlbjkqawrdtmvxbiqufllfuqibxvmtdrwaqkjblxqjpwzmhwqore",
"output": "688"
},
{
"input": "eeycuijtbgynmiczjfslwobmnkpgodfgvujvduyfeqchuaoktqrrairkkmmsjahltfcxwtpzzyddxrqfxabfoocmpuviinrjitsc",
"output": "604"
},
{
"input": "cgglnakewwvzoytaghksebrhjdbcdegssuzilrcppayxtgxopybbwshvyqnzhdsifkuwghourmeottrgjwdqpihbklvfzxpomqsa",
"output": "572"
},
{
"input": "aexullmxncckzryymfnuugdklaffevabqqztelpvojecljnhqldazdcaamubpenwxikysxxjjctvbndprsolzehywmgnvkgqvrfp",
"output": "609"
},
{
"input": "psnoieutsvvcwfhtnnphhxkwigzsbzyjmdiyl",
"output": "223"
},
{
"input": "aa",
"output": "0"
}
] | 1,673,211,825 | 2,147,483,647 |
Python 3
|
OK
|
TESTS
| 44 | 62 | 409,600 |
from string import *
alp = list(ascii_lowercase)
s = list(input())
count = 0
x = 0
for i in s:
y = alp.index(i)
count += min(abs(x-y), 26-(abs(x-y)))
x = y
print(count)
|
Title: Night at the Museum
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Grigoriy, like the hero of one famous comedy film, found a job as a night security guard at the museum. At first night he received embosser and was to take stock of the whole exposition.
Embosser is a special devise that allows to "print" the text of a plastic tape. Text is printed sequentially, character by character. The device consists of a wheel with a lowercase English letters written in a circle, static pointer to the current letter and a button that print the chosen letter. At one move it's allowed to rotate the alphabetic wheel one step clockwise or counterclockwise. Initially, static pointer points to letter 'a'. Other letters are located as shown on the picture:
After Grigoriy add new item to the base he has to print its name on the plastic tape and attach it to the corresponding exhibit. It's not required to return the wheel to its initial position with pointer on the letter 'a'.
Our hero is afraid that some exhibits may become alive and start to attack him, so he wants to print the names as fast as possible. Help him, for the given string find the minimum number of rotations of the wheel required to print it.
Input Specification:
The only line of input contains the name of some exhibit — the non-empty string consisting of no more than 100 characters. It's guaranteed that the string consists of only lowercase English letters.
Output Specification:
Print one integer — the minimum number of rotations of the wheel, required to print the name given in the input.
Demo Input:
['zeus\n', 'map\n', 'ares\n']
Demo Output:
['18\n', '35\n', '34\n']
Note:
To print the string from the first sample it would be optimal to perform the following sequence of rotations:
1. from 'a' to 'z' (1 rotation counterclockwise), 1. from 'z' to 'e' (5 clockwise rotations), 1. from 'e' to 'u' (10 rotations counterclockwise), 1. from 'u' to 's' (2 counterclockwise rotations).
|
```python
from string import *
alp = list(ascii_lowercase)
s = list(input())
count = 0
x = 0
for i in s:
y = alp.index(i)
count += min(abs(x-y), 26-(abs(x-y)))
x = y
print(count)
```
| 3 |
|
268 |
A
|
Games
|
PROGRAMMING
| 800 |
[
"brute force"
] | null | null |
Manao works on a sports TV. He's spent much time watching the football games of some country. After a while he began to notice different patterns. For example, each team has two sets of uniforms: home uniform and guest uniform. When a team plays a game at home, the players put on the home uniform. When a team plays as a guest on somebody else's stadium, the players put on the guest uniform. The only exception to that rule is: when the home uniform color of the host team matches the guests' uniform, the host team puts on its guest uniform as well. For each team the color of the home and guest uniform is different.
There are *n* teams taking part in the national championship. The championship consists of *n*·(*n*<=-<=1) games: each team invites each other team to its stadium. At this point Manao wondered: how many times during the championship is a host team going to put on the guest uniform? Note that the order of the games does not affect this number.
You know the colors of the home and guest uniform for each team. For simplicity, the colors are numbered by integers in such a way that no two distinct colors have the same number. Help Manao find the answer to his question.
|
The first line contains an integer *n* (2<=≤<=*n*<=≤<=30). Each of the following *n* lines contains a pair of distinct space-separated integers *h**i*, *a**i* (1<=≤<=*h**i*,<=*a**i*<=≤<=100) — the colors of the *i*-th team's home and guest uniforms, respectively.
|
In a single line print the number of games where the host team is going to play in the guest uniform.
|
[
"3\n1 2\n2 4\n3 4\n",
"4\n100 42\n42 100\n5 42\n100 5\n",
"2\n1 2\n1 2\n"
] |
[
"1\n",
"5\n",
"0\n"
] |
In the first test case the championship consists of 6 games. The only game with the event in question is the game between teams 2 and 1 on the stadium of team 2.
In the second test sample the host team will have to wear guest uniform in the games between teams: 1 and 2, 2 and 1, 2 and 3, 3 and 4, 4 and 2 (the host team is written first).
| 500 |
[
{
"input": "3\n1 2\n2 4\n3 4",
"output": "1"
},
{
"input": "4\n100 42\n42 100\n5 42\n100 5",
"output": "5"
},
{
"input": "2\n1 2\n1 2",
"output": "0"
},
{
"input": "7\n4 7\n52 55\n16 4\n55 4\n20 99\n3 4\n7 52",
"output": "6"
},
{
"input": "10\n68 42\n1 35\n25 70\n59 79\n65 63\n46 6\n28 82\n92 62\n43 96\n37 28",
"output": "1"
},
{
"input": "30\n10 39\n89 1\n78 58\n75 99\n36 13\n77 50\n6 97\n79 28\n27 52\n56 5\n93 96\n40 21\n33 74\n26 37\n53 59\n98 56\n61 65\n42 57\n9 7\n25 63\n74 34\n96 84\n95 47\n12 23\n34 21\n71 6\n27 13\n15 47\n64 14\n12 77",
"output": "6"
},
{
"input": "30\n46 100\n87 53\n34 84\n44 66\n23 20\n50 34\n90 66\n17 39\n13 22\n94 33\n92 46\n63 78\n26 48\n44 61\n3 19\n41 84\n62 31\n65 89\n23 28\n58 57\n19 85\n26 60\n75 66\n69 67\n76 15\n64 15\n36 72\n90 89\n42 69\n45 35",
"output": "4"
},
{
"input": "2\n46 6\n6 46",
"output": "2"
},
{
"input": "29\n8 18\n33 75\n69 22\n97 95\n1 97\n78 10\n88 18\n13 3\n19 64\n98 12\n79 92\n41 72\n69 15\n98 31\n57 74\n15 56\n36 37\n15 66\n63 100\n16 42\n47 56\n6 4\n73 15\n30 24\n27 71\n12 19\n88 69\n85 6\n50 11",
"output": "10"
},
{
"input": "23\n43 78\n31 28\n58 80\n66 63\n20 4\n51 95\n40 20\n50 14\n5 34\n36 39\n77 42\n64 97\n62 89\n16 56\n8 34\n58 16\n37 35\n37 66\n8 54\n50 36\n24 8\n68 48\n85 33",
"output": "6"
},
{
"input": "13\n76 58\n32 85\n99 79\n23 58\n96 59\n72 35\n53 43\n96 55\n41 78\n75 10\n28 11\n72 7\n52 73",
"output": "0"
},
{
"input": "18\n6 90\n70 79\n26 52\n67 81\n29 95\n41 32\n94 88\n18 58\n59 65\n51 56\n64 68\n34 2\n6 98\n95 82\n34 2\n40 98\n83 78\n29 2",
"output": "1"
},
{
"input": "18\n6 90\n100 79\n26 100\n67 100\n29 100\n100 32\n94 88\n18 58\n59 65\n51 56\n64 68\n34 2\n6 98\n95 82\n34 2\n40 98\n83 78\n29 100",
"output": "8"
},
{
"input": "30\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1",
"output": "450"
},
{
"input": "30\n100 99\n58 59\n56 57\n54 55\n52 53\n50 51\n48 49\n46 47\n44 45\n42 43\n40 41\n38 39\n36 37\n34 35\n32 33\n30 31\n28 29\n26 27\n24 25\n22 23\n20 21\n18 19\n16 17\n14 15\n12 13\n10 11\n8 9\n6 7\n4 5\n2 3",
"output": "0"
},
{
"input": "15\n9 3\n2 6\n7 6\n5 10\n9 5\n8 1\n10 5\n2 8\n4 5\n9 8\n5 3\n3 8\n9 8\n4 10\n8 5",
"output": "20"
},
{
"input": "15\n2 1\n1 2\n1 2\n1 2\n2 1\n2 1\n2 1\n1 2\n2 1\n2 1\n2 1\n1 2\n2 1\n2 1\n1 2",
"output": "108"
},
{
"input": "25\n2 1\n1 2\n1 2\n1 2\n2 1\n1 2\n1 2\n1 2\n2 1\n2 1\n2 1\n1 2\n1 2\n1 2\n2 1\n2 1\n2 1\n1 2\n2 1\n1 2\n2 1\n2 1\n2 1\n2 1\n1 2",
"output": "312"
},
{
"input": "25\n91 57\n2 73\n54 57\n2 57\n23 57\n2 6\n57 54\n57 23\n91 54\n91 23\n57 23\n91 57\n54 2\n6 91\n57 54\n2 57\n57 91\n73 91\n57 23\n91 57\n2 73\n91 2\n23 6\n2 73\n23 6",
"output": "96"
},
{
"input": "28\n31 66\n31 91\n91 31\n97 66\n31 66\n31 66\n66 91\n91 31\n97 31\n91 97\n97 31\n66 31\n66 97\n91 31\n31 66\n31 66\n66 31\n31 97\n66 97\n97 31\n31 91\n66 91\n91 66\n31 66\n91 66\n66 31\n66 31\n91 97",
"output": "210"
},
{
"input": "29\n78 27\n50 68\n24 26\n68 43\n38 78\n26 38\n78 28\n28 26\n27 24\n23 38\n24 26\n24 43\n61 50\n38 78\n27 23\n61 26\n27 28\n43 23\n28 78\n43 27\n43 78\n27 61\n28 38\n61 78\n50 26\n43 27\n26 78\n28 50\n43 78",
"output": "73"
},
{
"input": "29\n80 27\n69 80\n27 80\n69 80\n80 27\n80 27\n80 27\n80 69\n27 69\n80 69\n80 27\n27 69\n69 27\n80 69\n27 69\n69 80\n27 69\n80 69\n80 27\n69 27\n27 69\n27 80\n80 27\n69 80\n27 69\n80 69\n69 80\n69 80\n27 80",
"output": "277"
},
{
"input": "30\n19 71\n7 89\n89 71\n21 7\n19 21\n7 89\n19 71\n89 8\n89 21\n19 8\n21 7\n8 89\n19 89\n7 21\n19 8\n19 7\n7 19\n8 21\n71 21\n71 89\n7 19\n7 19\n21 7\n21 19\n21 19\n71 8\n21 8\n71 19\n19 71\n8 21",
"output": "154"
},
{
"input": "30\n44 17\n44 17\n44 17\n17 44\n44 17\n44 17\n17 44\n17 44\n17 44\n44 17\n44 17\n44 17\n44 17\n44 17\n17 44\n17 44\n17 44\n44 17\n44 17\n17 44\n44 17\n44 17\n44 17\n17 44\n17 44\n44 17\n17 44\n44 17\n44 17\n44 17",
"output": "418"
},
{
"input": "22\n78 92\n15 92\n92 78\n78 80\n92 16\n24 80\n92 16\n16 92\n78 16\n24 78\n80 78\n92 80\n16 80\n80 78\n15 78\n92 16\n24 15\n24 80\n80 16\n16 80\n92 80\n24 80",
"output": "74"
},
{
"input": "24\n9 83\n90 31\n83 3\n83 3\n21 31\n83 3\n32 31\n12 21\n31 21\n90 32\n32 21\n12 9\n12 31\n9 83\n83 12\n32 3\n32 83\n90 31\n9 32\n31 21\n83 90\n32 21\n21 3\n32 9",
"output": "59"
},
{
"input": "30\n67 21\n85 39\n85 87\n21 39\n66 85\n10 95\n10 21\n87 85\n82 21\n67 21\n95 10\n21 39\n82 21\n21 66\n66 39\n95 30\n67 85\n66 82\n85 82\n21 66\n10 39\n67 10\n21 85\n10 82\n85 95\n10 85\n21 39\n85 39\n39 10\n95 67",
"output": "100"
},
{
"input": "4\n8 7\n8 7\n7 8\n7 8",
"output": "8"
},
{
"input": "6\n1 2\n1 2\n1 2\n1 2\n1 2\n2 1",
"output": "10"
},
{
"input": "12\n1 2\n1 2\n1 2\n1 2\n1 2\n1 2\n2 1\n2 1\n2 1\n2 1\n2 1\n2 1",
"output": "72"
},
{
"input": "4\n1 2\n1 2\n2 1\n2 1",
"output": "8"
}
] | 1,697,738,945 | 2,147,483,647 |
Python 3
|
OK
|
TESTS
| 31 | 92 | 0 |
n = int(input())
mas1 = []
mas2 = []
for i in range(n):
h,a = map(int,input().split())
mas1.append(h)
mas2.append(a)
res = 0
for i in range(n):
c = 0
for j in range(n):
if mas2[j] == mas1[i]:
c+=1
res+=c
print(res)
|
Title: Games
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Manao works on a sports TV. He's spent much time watching the football games of some country. After a while he began to notice different patterns. For example, each team has two sets of uniforms: home uniform and guest uniform. When a team plays a game at home, the players put on the home uniform. When a team plays as a guest on somebody else's stadium, the players put on the guest uniform. The only exception to that rule is: when the home uniform color of the host team matches the guests' uniform, the host team puts on its guest uniform as well. For each team the color of the home and guest uniform is different.
There are *n* teams taking part in the national championship. The championship consists of *n*·(*n*<=-<=1) games: each team invites each other team to its stadium. At this point Manao wondered: how many times during the championship is a host team going to put on the guest uniform? Note that the order of the games does not affect this number.
You know the colors of the home and guest uniform for each team. For simplicity, the colors are numbered by integers in such a way that no two distinct colors have the same number. Help Manao find the answer to his question.
Input Specification:
The first line contains an integer *n* (2<=≤<=*n*<=≤<=30). Each of the following *n* lines contains a pair of distinct space-separated integers *h**i*, *a**i* (1<=≤<=*h**i*,<=*a**i*<=≤<=100) — the colors of the *i*-th team's home and guest uniforms, respectively.
Output Specification:
In a single line print the number of games where the host team is going to play in the guest uniform.
Demo Input:
['3\n1 2\n2 4\n3 4\n', '4\n100 42\n42 100\n5 42\n100 5\n', '2\n1 2\n1 2\n']
Demo Output:
['1\n', '5\n', '0\n']
Note:
In the first test case the championship consists of 6 games. The only game with the event in question is the game between teams 2 and 1 on the stadium of team 2.
In the second test sample the host team will have to wear guest uniform in the games between teams: 1 and 2, 2 and 1, 2 and 3, 3 and 4, 4 and 2 (the host team is written first).
|
```python
n = int(input())
mas1 = []
mas2 = []
for i in range(n):
h,a = map(int,input().split())
mas1.append(h)
mas2.append(a)
res = 0
for i in range(n):
c = 0
for j in range(n):
if mas2[j] == mas1[i]:
c+=1
res+=c
print(res)
```
| 3 |
|
389 |
A
|
Fox and Number Game
|
PROGRAMMING
| 1,000 |
[
"greedy",
"math"
] | null | null |
Fox Ciel is playing a game with numbers now.
Ciel has *n* positive integers: *x*1, *x*2, ..., *x**n*. She can do the following operation as many times as needed: select two different indexes *i* and *j* such that *x**i* > *x**j* hold, and then apply assignment *x**i* = *x**i* - *x**j*. The goal is to make the sum of all numbers as small as possible.
Please help Ciel to find this minimal sum.
|
The first line contains an integer *n* (2<=≤<=*n*<=≤<=100). Then the second line contains *n* integers: *x*1, *x*2, ..., *x**n* (1<=≤<=*x**i*<=≤<=100).
|
Output a single integer — the required minimal sum.
|
[
"2\n1 2\n",
"3\n2 4 6\n",
"2\n12 18\n",
"5\n45 12 27 30 18\n"
] |
[
"2\n",
"6\n",
"12\n",
"15\n"
] |
In the first example the optimal way is to do the assignment: *x*<sub class="lower-index">2</sub> = *x*<sub class="lower-index">2</sub> - *x*<sub class="lower-index">1</sub>.
In the second example the optimal sequence of operations is: *x*<sub class="lower-index">3</sub> = *x*<sub class="lower-index">3</sub> - *x*<sub class="lower-index">2</sub>, *x*<sub class="lower-index">2</sub> = *x*<sub class="lower-index">2</sub> - *x*<sub class="lower-index">1</sub>.
| 500 |
[
{
"input": "2\n1 2",
"output": "2"
},
{
"input": "3\n2 4 6",
"output": "6"
},
{
"input": "2\n12 18",
"output": "12"
},
{
"input": "5\n45 12 27 30 18",
"output": "15"
},
{
"input": "2\n1 1",
"output": "2"
},
{
"input": "2\n100 100",
"output": "200"
},
{
"input": "2\n87 58",
"output": "58"
},
{
"input": "39\n52 52 52 52 52 52 52 52 52 52 52 52 52 52 52 52 52 52 52 52 52 52 52 52 52 52 52 52 52 52 52 52 52 52 52 52 52 52 52",
"output": "2028"
},
{
"input": "59\n96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96 96",
"output": "5664"
},
{
"input": "100\n100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100",
"output": "10000"
},
{
"input": "100\n70 70 77 42 98 84 56 91 35 21 7 70 77 77 56 63 14 84 56 14 77 77 63 70 14 7 28 91 63 49 21 84 98 56 77 98 98 84 98 14 7 56 49 28 91 98 7 56 14 91 14 98 49 28 98 14 98 98 14 70 35 28 63 28 49 63 63 56 91 98 35 42 42 35 63 35 42 14 63 21 77 56 42 77 35 91 56 21 28 84 56 70 70 91 98 70 84 63 21 98",
"output": "700"
},
{
"input": "39\n63 21 21 42 21 63 21 84 42 21 84 63 42 63 84 84 84 42 42 84 21 63 42 63 42 42 63 42 42 63 84 42 21 84 21 63 42 21 42",
"output": "819"
},
{
"input": "59\n70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70 70",
"output": "4130"
},
{
"input": "87\n44 88 88 88 88 66 88 22 22 88 88 44 88 22 22 22 88 88 88 88 66 22 88 88 88 88 66 66 44 88 44 44 66 22 88 88 22 44 66 44 88 66 66 22 22 22 22 88 22 22 44 66 88 22 22 88 66 66 88 22 66 88 66 88 66 44 88 44 22 44 44 22 44 88 44 44 44 44 22 88 88 88 66 66 88 44 22",
"output": "1914"
},
{
"input": "15\n63 63 63 63 63 63 63 63 63 63 63 63 63 63 63",
"output": "945"
},
{
"input": "39\n63 77 21 14 14 35 21 21 70 42 21 70 28 77 28 77 7 42 63 7 98 49 98 84 35 70 70 91 14 42 98 7 42 7 98 42 56 35 91",
"output": "273"
},
{
"input": "18\n18 18 18 36 36 36 54 72 54 36 72 54 36 36 36 36 18 36",
"output": "324"
},
{
"input": "46\n71 71 71 71 71 71 71 71 71 71 71 71 71 71 71 71 71 71 71 71 71 71 71 71 71 71 71 71 71 71 71 71 71 71 71 71 71 71 71 71 71 71 71 71 71 71",
"output": "3266"
},
{
"input": "70\n66 11 66 11 44 11 44 99 55 22 88 11 11 22 55 44 22 77 44 77 77 22 44 55 88 11 99 99 88 22 77 77 66 11 11 66 99 55 55 44 66 44 77 44 44 55 33 55 44 88 77 77 22 66 33 44 11 22 55 44 22 66 77 33 33 44 44 44 22 33",
"output": "770"
},
{
"input": "10\n60 12 96 48 60 24 60 36 60 60",
"output": "120"
},
{
"input": "20\n51 51 51 51 51 51 51 51 51 51 51 51 51 51 51 51 51 51 51 51",
"output": "1020"
},
{
"input": "50\n58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58 58",
"output": "2900"
},
{
"input": "98\n70 60 100 30 70 20 30 50 50 30 90 40 30 40 60 80 60 60 80 50 10 80 20 10 20 10 50 70 30 80 30 50 60 90 90 100 60 30 90 20 30 60 90 80 60 60 10 90 10 50 40 40 80 90 100 40 70 40 30 50 60 50 60 30 40 20 90 60 20 20 20 70 60 70 50 100 90 50 20 40 80 60 10 60 50 40 40 10 50 10 40 10 80 100 100 90 10 90",
"output": "980"
},
{
"input": "100\n82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82 82",
"output": "8200"
},
{
"input": "100\n11 87 77 93 3 54 21 93 9 71 37 23 69 85 74 3 48 99 51 31 56 19 21 96 39 6 4 4 29 69 100 42 1 22 81 53 48 49 81 61 10 7 40 61 7 71 51 59 79 44 50 35 95 80 83 8 98 40 18 94 84 49 52 74 66 69 39 37 100 44 38 62 2 80 46 31 35 53 5 60 21 49 63 55 20 53 80 53 66 34 23 92 77 50 86 63 65 24 12 70",
"output": "100"
},
{
"input": "2\n100 1",
"output": "2"
},
{
"input": "2\n18 30",
"output": "12"
},
{
"input": "2\n3 5",
"output": "2"
},
{
"input": "2\n1 10",
"output": "2"
},
{
"input": "2\n8 5",
"output": "2"
},
{
"input": "5\n2 3 5 8 18",
"output": "5"
},
{
"input": "5\n2 4 1 6 8",
"output": "5"
},
{
"input": "3\n12 10 5",
"output": "3"
},
{
"input": "3\n6 10 15",
"output": "3"
}
] | 1,579,332,629 | 2,147,483,647 |
PyPy 3
|
OK
|
TESTS
| 34 | 140 | 0 |
from math import gcd
n = int(input()); res = 0
for i in input().split():
res = gcd(res, int(i))
print(res * n)
|
Title: Fox and Number Game
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Fox Ciel is playing a game with numbers now.
Ciel has *n* positive integers: *x*1, *x*2, ..., *x**n*. She can do the following operation as many times as needed: select two different indexes *i* and *j* such that *x**i* > *x**j* hold, and then apply assignment *x**i* = *x**i* - *x**j*. The goal is to make the sum of all numbers as small as possible.
Please help Ciel to find this minimal sum.
Input Specification:
The first line contains an integer *n* (2<=≤<=*n*<=≤<=100). Then the second line contains *n* integers: *x*1, *x*2, ..., *x**n* (1<=≤<=*x**i*<=≤<=100).
Output Specification:
Output a single integer — the required minimal sum.
Demo Input:
['2\n1 2\n', '3\n2 4 6\n', '2\n12 18\n', '5\n45 12 27 30 18\n']
Demo Output:
['2\n', '6\n', '12\n', '15\n']
Note:
In the first example the optimal way is to do the assignment: *x*<sub class="lower-index">2</sub> = *x*<sub class="lower-index">2</sub> - *x*<sub class="lower-index">1</sub>.
In the second example the optimal sequence of operations is: *x*<sub class="lower-index">3</sub> = *x*<sub class="lower-index">3</sub> - *x*<sub class="lower-index">2</sub>, *x*<sub class="lower-index">2</sub> = *x*<sub class="lower-index">2</sub> - *x*<sub class="lower-index">1</sub>.
|
```python
from math import gcd
n = int(input()); res = 0
for i in input().split():
res = gcd(res, int(i))
print(res * n)
```
| 3 |
|
805 |
B
|
3-palindrome
|
PROGRAMMING
| 1,000 |
[
"constructive algorithms"
] | null | null |
In the beginning of the new year Keivan decided to reverse his name. He doesn't like palindromes, so he changed Naviek to Navick.
He is too selfish, so for a given *n* he wants to obtain a string of *n* characters, each of which is either 'a', 'b' or 'c', with no palindromes of length 3 appearing in the string as a substring. For example, the strings "abc" and "abca" suit him, while the string "aba" doesn't. He also want the number of letters 'c' in his string to be as little as possible.
|
The first line contains single integer *n* (1<=≤<=*n*<=≤<=2·105) — the length of the string.
|
Print the string that satisfies all the constraints.
If there are multiple answers, print any of them.
|
[
"2\n",
"3\n"
] |
[
"aa\n",
"bba\n"
] |
A palindrome is a sequence of characters which reads the same backward and forward.
| 1,000 |
[
{
"input": "2",
"output": "aa"
},
{
"input": "3",
"output": "aab"
},
{
"input": "38",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaa"
},
{
"input": "47",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab"
},
{
"input": "59",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab"
},
{
"input": "67",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab"
},
{
"input": "77",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabba"
},
{
"input": "89",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabba"
},
{
"input": "98",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaa"
},
{
"input": "109",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabba"
},
{
"input": "117",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabba"
},
{
"input": "1",
"output": "a"
},
{
"input": "200000",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "100000",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "143670",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "104217",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "17879",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "131809",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "140873",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "77859",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "153022",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "179227",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "182801",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "5188",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "86539",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "12802",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "120289",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "132866",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "133377",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "31775",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "160397",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "161415",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "163623",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "22942",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "134767",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "52257",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "64905",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "183758",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "60131",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "146883",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "6",
"output": "aabbaa"
},
{
"input": "4",
"output": "aabb"
}
] | 1,628,491,926 | 2,147,483,647 |
Python 3
|
OK
|
TESTS
| 42 | 530 | 7,168,000 |
n=int(input())
for i in range(n):
if i%4==0 or i%4==3:
print('a',end='')
else:
print('b',end='')
|
Title: 3-palindrome
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
In the beginning of the new year Keivan decided to reverse his name. He doesn't like palindromes, so he changed Naviek to Navick.
He is too selfish, so for a given *n* he wants to obtain a string of *n* characters, each of which is either 'a', 'b' or 'c', with no palindromes of length 3 appearing in the string as a substring. For example, the strings "abc" and "abca" suit him, while the string "aba" doesn't. He also want the number of letters 'c' in his string to be as little as possible.
Input Specification:
The first line contains single integer *n* (1<=≤<=*n*<=≤<=2·105) — the length of the string.
Output Specification:
Print the string that satisfies all the constraints.
If there are multiple answers, print any of them.
Demo Input:
['2\n', '3\n']
Demo Output:
['aa\n', 'bba\n']
Note:
A palindrome is a sequence of characters which reads the same backward and forward.
|
```python
n=int(input())
for i in range(n):
if i%4==0 or i%4==3:
print('a',end='')
else:
print('b',end='')
```
| 3 |
|
281 |
A
|
Word Capitalization
|
PROGRAMMING
| 800 |
[
"implementation",
"strings"
] | null | null |
Capitalization is writing a word with its first letter as a capital letter. Your task is to capitalize the given word.
Note, that during capitalization all the letters except the first one remains unchanged.
|
A single line contains a non-empty word. This word consists of lowercase and uppercase English letters. The length of the word will not exceed 103.
|
Output the given word after capitalization.
|
[
"ApPLe\n",
"konjac\n"
] |
[
"ApPLe\n",
"Konjac\n"
] |
none
| 500 |
[
{
"input": "ApPLe",
"output": "ApPLe"
},
{
"input": "konjac",
"output": "Konjac"
},
{
"input": "a",
"output": "A"
},
{
"input": "A",
"output": "A"
},
{
"input": "z",
"output": "Z"
},
{
"input": "ABACABA",
"output": "ABACABA"
},
{
"input": "xYaPxPxHxGePfGtQySlNrLxSjDtNnTaRaEpAhPaQpWnDzMqGgRgEwJxGiBdZnMtHxFbObCaGiCeZkUqIgBhHtNvAqAlHpMnQhNeQbMyZrCdElVwHtKrPpJjIaHuIlYwHaRkAkUpPlOhNlBtXwDsKzPyHrPiUwNlXtTaPuMwTqYtJySgFoXvLiHbQwMjSvXsQfKhVlOxGdQkWjBhEyQvBjPoFkThNeRhTuIzFjInJtEfPjOlOsJpJuLgLzFnZmKvFgFrNsOnVqFcNiMfCqTpKnVyLwNqFiTySpWeTdFnWuTwDkRjVxNyQvTrOoEiExYiFaIrLoFmJfZcDkHuWjYfCeEqCvEsZiWnJaEmFbMjDvYwEeJeGcKbVbChGsIzNlExHzHiTlHcSaKxLuZxX",
"output": "XYaPxPxHxGePfGtQySlNrLxSjDtNnTaRaEpAhPaQpWnDzMqGgRgEwJxGiBdZnMtHxFbObCaGiCeZkUqIgBhHtNvAqAlHpMnQhNeQbMyZrCdElVwHtKrPpJjIaHuIlYwHaRkAkUpPlOhNlBtXwDsKzPyHrPiUwNlXtTaPuMwTqYtJySgFoXvLiHbQwMjSvXsQfKhVlOxGdQkWjBhEyQvBjPoFkThNeRhTuIzFjInJtEfPjOlOsJpJuLgLzFnZmKvFgFrNsOnVqFcNiMfCqTpKnVyLwNqFiTySpWeTdFnWuTwDkRjVxNyQvTrOoEiExYiFaIrLoFmJfZcDkHuWjYfCeEqCvEsZiWnJaEmFbMjDvYwEeJeGcKbVbChGsIzNlExHzHiTlHcSaKxLuZxX"
},
{
"input": "rZhIcQlXpNcPgXrOjTiOlMoTgXgIhCfMwZfWoFzGhEkQlOoMjIuShPlZfWkNnMyQfYdUhVgQuSmYoElEtZpDyHtOxXgCpWbZqSbYnPqBcNqRtPgCnJnAyIvNsAhRbNeVlMwZyRyJnFgIsCnSbOdLvUyIeOzQvRpMoMoHfNhHwKvTcHuYnYySfPmAiNwAiWdZnWlLvGfBbRbRrCrBqIgIdWkWiBsNyYkKdNxZdGaToSsDnXpRaGrKxBpQsCzBdQgZzBkGeHgGxNrIyQlSzWsTmSnZwOcHqQpNcQvJlPvKaPiQaMaYsQjUeCqQdCjPgUbDmWiJmNiXgExLqOcCtSwSePnUxIuZfIfBeWbEiVbXnUsPwWyAiXyRbZgKwOqFfCtQuKxEmVeRlAkOeXkO",
"output": "RZhIcQlXpNcPgXrOjTiOlMoTgXgIhCfMwZfWoFzGhEkQlOoMjIuShPlZfWkNnMyQfYdUhVgQuSmYoElEtZpDyHtOxXgCpWbZqSbYnPqBcNqRtPgCnJnAyIvNsAhRbNeVlMwZyRyJnFgIsCnSbOdLvUyIeOzQvRpMoMoHfNhHwKvTcHuYnYySfPmAiNwAiWdZnWlLvGfBbRbRrCrBqIgIdWkWiBsNyYkKdNxZdGaToSsDnXpRaGrKxBpQsCzBdQgZzBkGeHgGxNrIyQlSzWsTmSnZwOcHqQpNcQvJlPvKaPiQaMaYsQjUeCqQdCjPgUbDmWiJmNiXgExLqOcCtSwSePnUxIuZfIfBeWbEiVbXnUsPwWyAiXyRbZgKwOqFfCtQuKxEmVeRlAkOeXkO"
},
{
"input": "hDgZlUmLhYbLkLcNcKeOwJwTePbOvLaRvNzQbSbLsPeHqLhUqWtUbNdQfQqFfXeJqJwWuOrFnDdZiPxIkDyVmHbHvXfIlFqSgAcSyWbOlSlRuPhWdEpEzEeLnXwCtWuVcHaUeRgCiYsIvOaIgDnFuDbRnMoCmPrZfLeFpSjQaTfHgZwZvAzDuSeNwSoWuJvLqKqAuUxFaCxFfRcEjEsJpOfCtDiVrBqNsNwPuGoRgPzRpLpYnNyQxKaNnDnYiJrCrVcHlOxPiPcDbEgKfLwBjLhKcNeMgJhJmOiJvPfOaPaEuGqWvRbErKrIpDkEoQnKwJnTlStLyNsHyOjZfKoIjXwUvRrWpSyYhRpQdLqGmErAiNcGqAqIrTeTiMuPmCrEkHdBrLyCxPtYpRqD",
"output": "HDgZlUmLhYbLkLcNcKeOwJwTePbOvLaRvNzQbSbLsPeHqLhUqWtUbNdQfQqFfXeJqJwWuOrFnDdZiPxIkDyVmHbHvXfIlFqSgAcSyWbOlSlRuPhWdEpEzEeLnXwCtWuVcHaUeRgCiYsIvOaIgDnFuDbRnMoCmPrZfLeFpSjQaTfHgZwZvAzDuSeNwSoWuJvLqKqAuUxFaCxFfRcEjEsJpOfCtDiVrBqNsNwPuGoRgPzRpLpYnNyQxKaNnDnYiJrCrVcHlOxPiPcDbEgKfLwBjLhKcNeMgJhJmOiJvPfOaPaEuGqWvRbErKrIpDkEoQnKwJnTlStLyNsHyOjZfKoIjXwUvRrWpSyYhRpQdLqGmErAiNcGqAqIrTeTiMuPmCrEkHdBrLyCxPtYpRqD"
},
{
"input": "qUdLgGrJeGmIzIeZrCjUtBpYfRvNdXdRpGsThIsEmJjTiMqEwRxBeBaSxEuWrNvExKePjPnXhPzBpWnHiDhTvZhBuIjDnZpTcEkCvRkAcTmMuXhGgErWgFyGyToOyVwYlCuQpTfJkVdWmFyBqQhJjYtXrBbFdHzDlGsFbHmHbFgXgFhIyDhZyEqEiEwNxSeByBwLiVeSnCxIdHbGjOjJrZeVkOzGeMmQrJkVyGhDtCzOlPeAzGrBlWwEnAdUfVaIjNrRyJjCnHkUvFuKuKeKbLzSbEmUcXtVkZzXzKlOrPgQiDmCcCvIyAdBwOeUuLbRmScNcWxIkOkJuIsBxTrIqXhDzLcYdVtPgZdZfAxTmUtByGiTsJkSySjXdJvEwNmSmNoWsChPdAzJrBoW",
"output": "QUdLgGrJeGmIzIeZrCjUtBpYfRvNdXdRpGsThIsEmJjTiMqEwRxBeBaSxEuWrNvExKePjPnXhPzBpWnHiDhTvZhBuIjDnZpTcEkCvRkAcTmMuXhGgErWgFyGyToOyVwYlCuQpTfJkVdWmFyBqQhJjYtXrBbFdHzDlGsFbHmHbFgXgFhIyDhZyEqEiEwNxSeByBwLiVeSnCxIdHbGjOjJrZeVkOzGeMmQrJkVyGhDtCzOlPeAzGrBlWwEnAdUfVaIjNrRyJjCnHkUvFuKuKeKbLzSbEmUcXtVkZzXzKlOrPgQiDmCcCvIyAdBwOeUuLbRmScNcWxIkOkJuIsBxTrIqXhDzLcYdVtPgZdZfAxTmUtByGiTsJkSySjXdJvEwNmSmNoWsChPdAzJrBoW"
},
{
"input": "kHbApGoBcLmIwUlXkVgUmWzYeLoDbGaOkWbIuXoRwMfKuOoMzAoXrBoTvYxGrMbRjDuRxAbGsTnErIiHnHoLeRnTbFiRfDdOkNlWiAcOsChLdLqFqXlDpDoDtPxXqAmSvYgPvOcCpOlWtOjYwFkGkHuCaHwZcFdOfHjBmIxTeSiHkWjXyFcCtOlSuJsZkDxUgPeZkJwMmNpErUlBcGuMlJwKkWnOzFeFiSiPsEvMmQiCsYeHlLuHoMgBjFoZkXlObDkSoQcVyReTmRsFzRhTuIvCeBqVsQdQyTyZjStGrTyDcEcAgTgMiIcVkLbZbGvWeHtXwEqWkXfTcPyHhHjYwIeVxLyVmHmMkUsGiHmNnQuMsXaFyPpVqNrBhOiWmNkBbQuHvQdOjPjKiZcL",
"output": "KHbApGoBcLmIwUlXkVgUmWzYeLoDbGaOkWbIuXoRwMfKuOoMzAoXrBoTvYxGrMbRjDuRxAbGsTnErIiHnHoLeRnTbFiRfDdOkNlWiAcOsChLdLqFqXlDpDoDtPxXqAmSvYgPvOcCpOlWtOjYwFkGkHuCaHwZcFdOfHjBmIxTeSiHkWjXyFcCtOlSuJsZkDxUgPeZkJwMmNpErUlBcGuMlJwKkWnOzFeFiSiPsEvMmQiCsYeHlLuHoMgBjFoZkXlObDkSoQcVyReTmRsFzRhTuIvCeBqVsQdQyTyZjStGrTyDcEcAgTgMiIcVkLbZbGvWeHtXwEqWkXfTcPyHhHjYwIeVxLyVmHmMkUsGiHmNnQuMsXaFyPpVqNrBhOiWmNkBbQuHvQdOjPjKiZcL"
},
{
"input": "aHmRbLgNuWkLxLnWvUbYwTeZeYiOlLhTuOvKfLnVmCiPcMkSgVrYjZiLuRjCiXhAnVzVcTlVeJdBvPdDfFvHkTuIhCdBjEsXbVmGcLrPfNvRdFsZkSdNpYsJeIhIcNqSoLkOjUlYlDmXsOxPbQtIoUxFjGnRtBhFaJvBeEzHsAtVoQbAfYjJqReBiKeUwRqYrUjPjBoHkOkPzDwEwUgTxQxAvKzUpMhKyOhPmEhYhItQwPeKsKaKlUhGuMcTtSwFtXfJsDsFlTtOjVvVfGtBtFlQyIcBaMsPaJlPqUcUvLmReZiFbXxVtRhTzJkLkAjVqTyVuFeKlTyQgUzMsXjOxQnVfTaWmThEnEoIhZeZdStBkKeLpAhJnFoJvQyGwDiStLjEwGfZwBuWsEfC",
"output": "AHmRbLgNuWkLxLnWvUbYwTeZeYiOlLhTuOvKfLnVmCiPcMkSgVrYjZiLuRjCiXhAnVzVcTlVeJdBvPdDfFvHkTuIhCdBjEsXbVmGcLrPfNvRdFsZkSdNpYsJeIhIcNqSoLkOjUlYlDmXsOxPbQtIoUxFjGnRtBhFaJvBeEzHsAtVoQbAfYjJqReBiKeUwRqYrUjPjBoHkOkPzDwEwUgTxQxAvKzUpMhKyOhPmEhYhItQwPeKsKaKlUhGuMcTtSwFtXfJsDsFlTtOjVvVfGtBtFlQyIcBaMsPaJlPqUcUvLmReZiFbXxVtRhTzJkLkAjVqTyVuFeKlTyQgUzMsXjOxQnVfTaWmThEnEoIhZeZdStBkKeLpAhJnFoJvQyGwDiStLjEwGfZwBuWsEfC"
},
{
"input": "sLlZkDiDmEdNaXuUuJwHqYvRtOdGfTiTpEpAoSqAbJaChOiCvHgSwZwEuPkMmXiLcKdXqSsEyViEbZpZsHeZpTuXoGcRmOiQfBfApPjDqSqElWeSeOhUyWjLyNoRuYeGfGwNqUsQoTyVvWeNgNdZfDxGwGfLsDjIdInSqDlMuNvFaHbScZkTlVwNcJpEjMaPaOtFgJjBjOcLlLmDnQrShIrJhOcUmPnZhTxNeClQsZaEaVaReLyQpLwEqJpUwYhLiRzCzKfOoFeTiXzPiNbOsZaZaLgCiNnMkBcFwGgAwPeNyTxJcCtBgXcToKlWaWcBaIvBpNxPeClQlWeQqRyEtAkJdBtSrFdDvAbUlKyLdCuTtXxFvRcKnYnWzVdYqDeCmOqPxUaFjQdTdCtN",
"output": "SLlZkDiDmEdNaXuUuJwHqYvRtOdGfTiTpEpAoSqAbJaChOiCvHgSwZwEuPkMmXiLcKdXqSsEyViEbZpZsHeZpTuXoGcRmOiQfBfApPjDqSqElWeSeOhUyWjLyNoRuYeGfGwNqUsQoTyVvWeNgNdZfDxGwGfLsDjIdInSqDlMuNvFaHbScZkTlVwNcJpEjMaPaOtFgJjBjOcLlLmDnQrShIrJhOcUmPnZhTxNeClQsZaEaVaReLyQpLwEqJpUwYhLiRzCzKfOoFeTiXzPiNbOsZaZaLgCiNnMkBcFwGgAwPeNyTxJcCtBgXcToKlWaWcBaIvBpNxPeClQlWeQqRyEtAkJdBtSrFdDvAbUlKyLdCuTtXxFvRcKnYnWzVdYqDeCmOqPxUaFjQdTdCtN"
},
{
"input": "iRuStKvVhJdJbQwRoIuLiVdTpKaOqKfYlYwAzIpPtUwUtMeKyCaOlXmVrKwWeImYmVuXdLkRlHwFxKqZbZtTzNgOzDbGqTfZnKmUzAcIjDcEmQgYyFbEfWzRpKvCkDmAqDiIiRcLvMxWaJqCgYqXgIcLdNaZlBnXtJyKaMnEaWfXfXwTbDnAiYnWqKbAtDpYdUbZrCzWgRnHzYxFgCdDbOkAgTqBuLqMeStHcDxGnVhSgMzVeTaZoTfLjMxQfRuPcFqVlRyYdHyOdJsDoCeWrUuJyIiAqHwHyVpEeEoMaJwAoUfPtBeJqGhMaHiBjKwAlXoZpUsDhHgMxBkVbLcEvNtJbGnPsUwAvXrAkTlXwYvEnOpNeWyIkRnEnTrIyAcLkRgMyYcKrGiDaAyE",
"output": "IRuStKvVhJdJbQwRoIuLiVdTpKaOqKfYlYwAzIpPtUwUtMeKyCaOlXmVrKwWeImYmVuXdLkRlHwFxKqZbZtTzNgOzDbGqTfZnKmUzAcIjDcEmQgYyFbEfWzRpKvCkDmAqDiIiRcLvMxWaJqCgYqXgIcLdNaZlBnXtJyKaMnEaWfXfXwTbDnAiYnWqKbAtDpYdUbZrCzWgRnHzYxFgCdDbOkAgTqBuLqMeStHcDxGnVhSgMzVeTaZoTfLjMxQfRuPcFqVlRyYdHyOdJsDoCeWrUuJyIiAqHwHyVpEeEoMaJwAoUfPtBeJqGhMaHiBjKwAlXoZpUsDhHgMxBkVbLcEvNtJbGnPsUwAvXrAkTlXwYvEnOpNeWyIkRnEnTrIyAcLkRgMyYcKrGiDaAyE"
},
{
"input": "cRtJkOxHzUbJcDdHzJtLbVmSoWuHoTkVrPqQaVmXeBrHxJbQfNrQbAaMrEhVdQnPxNyCjErKxPoEdWkVrBbDeNmEgBxYiBtWdAfHiLuSwIxJuHpSkAxPoYdNkGoLySsNhUmGoZhDzAfWhJdPlJzQkZbOnMtTkClIoCqOlIcJcMlGjUyOiEmHdYfIcPtTgQhLlLcPqQjAnQnUzHpCaQsCnYgQsBcJrQwBnWsIwFfSfGuYgTzQmShFpKqEeRlRkVfMuZbUsDoFoPrNuNwTtJqFkRiXxPvKyElDzLoUnIwAaBaOiNxMpEvPzSpGpFhMtGhGdJrFnZmNiMcUfMtBnDuUnXqDcMsNyGoLwLeNnLfRsIwRfBtXkHrFcPsLdXaAoYaDzYnZuQeVcZrElWmP",
"output": "CRtJkOxHzUbJcDdHzJtLbVmSoWuHoTkVrPqQaVmXeBrHxJbQfNrQbAaMrEhVdQnPxNyCjErKxPoEdWkVrBbDeNmEgBxYiBtWdAfHiLuSwIxJuHpSkAxPoYdNkGoLySsNhUmGoZhDzAfWhJdPlJzQkZbOnMtTkClIoCqOlIcJcMlGjUyOiEmHdYfIcPtTgQhLlLcPqQjAnQnUzHpCaQsCnYgQsBcJrQwBnWsIwFfSfGuYgTzQmShFpKqEeRlRkVfMuZbUsDoFoPrNuNwTtJqFkRiXxPvKyElDzLoUnIwAaBaOiNxMpEvPzSpGpFhMtGhGdJrFnZmNiMcUfMtBnDuUnXqDcMsNyGoLwLeNnLfRsIwRfBtXkHrFcPsLdXaAoYaDzYnZuQeVcZrElWmP"
},
{
"input": "wVaCsGxZrBbFnTbKsCoYlAvUkIpBaYpYmJkMlPwCaFvUkDxAiJgIqWsFqZlFvTtAnGzEwXbYiBdFfFxRiDoUkLmRfAwOlKeOlKgXdUnVqLkTuXtNdQpBpXtLvZxWoBeNePyHcWmZyRiUkPlRqYiQdGeXwOhHbCqVjDcEvJmBkRwWnMqPjXpUsIyXqGjHsEsDwZiFpIbTkQaUlUeFxMwJzSaHdHnDhLaLdTuYgFuJsEcMmDvXyPjKsSeBaRwNtPuOuBtNeOhQdVgKzPzOdYtPjPfDzQzHoWcYjFbSvRgGdGsCmGnQsErToBkCwGeQaCbBpYkLhHxTbUvRnJpZtXjKrHdRiUmUbSlJyGaLnWsCrJbBnSjFaZrIzIrThCmGhQcMsTtOxCuUcRaEyPaG",
"output": "WVaCsGxZrBbFnTbKsCoYlAvUkIpBaYpYmJkMlPwCaFvUkDxAiJgIqWsFqZlFvTtAnGzEwXbYiBdFfFxRiDoUkLmRfAwOlKeOlKgXdUnVqLkTuXtNdQpBpXtLvZxWoBeNePyHcWmZyRiUkPlRqYiQdGeXwOhHbCqVjDcEvJmBkRwWnMqPjXpUsIyXqGjHsEsDwZiFpIbTkQaUlUeFxMwJzSaHdHnDhLaLdTuYgFuJsEcMmDvXyPjKsSeBaRwNtPuOuBtNeOhQdVgKzPzOdYtPjPfDzQzHoWcYjFbSvRgGdGsCmGnQsErToBkCwGeQaCbBpYkLhHxTbUvRnJpZtXjKrHdRiUmUbSlJyGaLnWsCrJbBnSjFaZrIzIrThCmGhQcMsTtOxCuUcRaEyPaG"
},
{
"input": "kEiLxLmPjGzNoGkJdBlAfXhThYhMsHmZoZbGyCvNiUoLoZdAxUbGyQiEfXvPzZzJrPbEcMpHsMjIkRrVvDvQtHuKmXvGpQtXbPzJpFjJdUgWcPdFxLjLtXgVpEiFhImHnKkGiWnZbJqRjCyEwHsNbYfYfTyBaEuKlCtWnOqHmIgGrFmQiYrBnLiFcGuZxXlMfEuVoCxPkVrQvZoIpEhKsYtXrPxLcSfQqXsWaDgVlOnAzUvAhOhMrJfGtWcOwQfRjPmGhDyAeXrNqBvEiDfCiIvWxPjTwPlXpVsMjVjUnCkXgBuWnZaDyJpWkCfBrWnHxMhJgItHdRqNrQaEeRjAuUwRkUdRhEeGlSqVqGmOjNcUhFfXjCmWzBrGvIuZpRyWkWiLyUwFpYjNmNfV",
"output": "KEiLxLmPjGzNoGkJdBlAfXhThYhMsHmZoZbGyCvNiUoLoZdAxUbGyQiEfXvPzZzJrPbEcMpHsMjIkRrVvDvQtHuKmXvGpQtXbPzJpFjJdUgWcPdFxLjLtXgVpEiFhImHnKkGiWnZbJqRjCyEwHsNbYfYfTyBaEuKlCtWnOqHmIgGrFmQiYrBnLiFcGuZxXlMfEuVoCxPkVrQvZoIpEhKsYtXrPxLcSfQqXsWaDgVlOnAzUvAhOhMrJfGtWcOwQfRjPmGhDyAeXrNqBvEiDfCiIvWxPjTwPlXpVsMjVjUnCkXgBuWnZaDyJpWkCfBrWnHxMhJgItHdRqNrQaEeRjAuUwRkUdRhEeGlSqVqGmOjNcUhFfXjCmWzBrGvIuZpRyWkWiLyUwFpYjNmNfV"
},
{
"input": "eIhDoLmDeReKqXsHcVgFxUqNfScAiQnFrTlCgSuTtXiYvBxKaPaGvUeYfSgHqEaWcHxKpFaSlCxGqAmNeFcIzFcZsBiVoZhUjXaDaIcKoBzYdIlEnKfScRqSkYpPtVsVhXsBwUsUfAqRoCkBxWbHgDiCkRtPvUwVgDjOzObYwNiQwXlGnAqEkHdSqLgUkOdZiWaHqQnOhUnDhIzCiQtVcJlGoRfLuVlFjWqSuMsLgLwOdZvKtWdRuRqDoBoInKqPbJdXpIqLtFlMlDaWgSiKbFpCxOnQeNeQzXeKsBzIjCyPxCmBnYuHzQoYxZgGzSgGtZiTeQmUeWlNzZeKiJbQmEjIiDhPeSyZlNdHpZnIkPdJzSeJpPiXxToKyBjJfPwNzZpWzIzGySqPxLtI",
"output": "EIhDoLmDeReKqXsHcVgFxUqNfScAiQnFrTlCgSuTtXiYvBxKaPaGvUeYfSgHqEaWcHxKpFaSlCxGqAmNeFcIzFcZsBiVoZhUjXaDaIcKoBzYdIlEnKfScRqSkYpPtVsVhXsBwUsUfAqRoCkBxWbHgDiCkRtPvUwVgDjOzObYwNiQwXlGnAqEkHdSqLgUkOdZiWaHqQnOhUnDhIzCiQtVcJlGoRfLuVlFjWqSuMsLgLwOdZvKtWdRuRqDoBoInKqPbJdXpIqLtFlMlDaWgSiKbFpCxOnQeNeQzXeKsBzIjCyPxCmBnYuHzQoYxZgGzSgGtZiTeQmUeWlNzZeKiJbQmEjIiDhPeSyZlNdHpZnIkPdJzSeJpPiXxToKyBjJfPwNzZpWzIzGySqPxLtI"
},
{
"input": "uOoQzIeTwYeKpJtGoUdNiXbPgEwVsZkAnJcArHxIpEnEhZwQhZvAiOuLeMkVqLeDsAyKeYgFxGmRoLaRsZjAeXgNfYhBkHeDrHdPuTuYhKmDlAvYzYxCdYgYfVaYlGeVqTeSfBxQePbQrKsTaIkGzMjFrQlJuYaMxWpQkLdEcDsIiMnHnDtThRvAcKyGwBsHqKdXpJfIeTeZtYjFbMeUoXoXzGrShTwSwBpQlKeDrZdCjRqNtXoTsIzBkWbMsObTtDvYaPhUeLeHqHeMpZmTaCcIqXzAmGnPfNdDaFhOqWqDrWuFiBpRjZrQmAdViOuMbFfRyXyWfHgRkGpPnDrEqQcEmHcKpEvWlBrOtJbUaXbThJaSxCbVoGvTmHvZrHvXpCvLaYbRiHzYuQyX",
"output": "UOoQzIeTwYeKpJtGoUdNiXbPgEwVsZkAnJcArHxIpEnEhZwQhZvAiOuLeMkVqLeDsAyKeYgFxGmRoLaRsZjAeXgNfYhBkHeDrHdPuTuYhKmDlAvYzYxCdYgYfVaYlGeVqTeSfBxQePbQrKsTaIkGzMjFrQlJuYaMxWpQkLdEcDsIiMnHnDtThRvAcKyGwBsHqKdXpJfIeTeZtYjFbMeUoXoXzGrShTwSwBpQlKeDrZdCjRqNtXoTsIzBkWbMsObTtDvYaPhUeLeHqHeMpZmTaCcIqXzAmGnPfNdDaFhOqWqDrWuFiBpRjZrQmAdViOuMbFfRyXyWfHgRkGpPnDrEqQcEmHcKpEvWlBrOtJbUaXbThJaSxCbVoGvTmHvZrHvXpCvLaYbRiHzYuQyX"
},
{
"input": "lZqBqKeGvNdSeYuWxRiVnFtYbKuJwQtUcKnVtQhAlOeUzMaAuTaEnDdPfDcNyHgEoBmYjZyFePeJrRiKyAzFnBfAuGiUyLrIeLrNhBeBdVcEeKgCcBrQzDsPwGcNnZvTsEaYmFfMeOmMdNuZbUtDoQoNcGwDqEkEjIdQaPwAxJbXeNxOgKgXoEbZiIsVkRrNpNyAkLeHkNfEpLuQvEcMbIoGaDzXbEtNsLgGfOkZaFiUsOvEjVeCaMcZqMzKeAdXxJsVeCrZaFpJtZxInQxFaSmGgSsVyGeLlFgFqTpIbAvPkIfJrVcJeBxSdEvPyVwIjHpYrLrKqLnAmCuGmPoZrSbOtGaLaTmBmSuUyAmAsRiMqOtRjJhPhAfXaJnTpLbFqPmJgFcBxImTqIiJ",
"output": "LZqBqKeGvNdSeYuWxRiVnFtYbKuJwQtUcKnVtQhAlOeUzMaAuTaEnDdPfDcNyHgEoBmYjZyFePeJrRiKyAzFnBfAuGiUyLrIeLrNhBeBdVcEeKgCcBrQzDsPwGcNnZvTsEaYmFfMeOmMdNuZbUtDoQoNcGwDqEkEjIdQaPwAxJbXeNxOgKgXoEbZiIsVkRrNpNyAkLeHkNfEpLuQvEcMbIoGaDzXbEtNsLgGfOkZaFiUsOvEjVeCaMcZqMzKeAdXxJsVeCrZaFpJtZxInQxFaSmGgSsVyGeLlFgFqTpIbAvPkIfJrVcJeBxSdEvPyVwIjHpYrLrKqLnAmCuGmPoZrSbOtGaLaTmBmSuUyAmAsRiMqOtRjJhPhAfXaJnTpLbFqPmJgFcBxImTqIiJ"
},
{
"input": "P",
"output": "P"
},
{
"input": "Xyzzy",
"output": "Xyzzy"
},
{
"input": "Zzz",
"output": "Zzz"
},
{
"input": "Zp",
"output": "Zp"
}
] | 1,696,207,015 | 2,147,483,647 |
Python 3
|
OK
|
TESTS
| 25 | 62 | 0 |
word=str(input())
A=str(word[0]).upper()
B=str(word[1:])
print(A+B)
|
Title: Word Capitalization
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Capitalization is writing a word with its first letter as a capital letter. Your task is to capitalize the given word.
Note, that during capitalization all the letters except the first one remains unchanged.
Input Specification:
A single line contains a non-empty word. This word consists of lowercase and uppercase English letters. The length of the word will not exceed 103.
Output Specification:
Output the given word after capitalization.
Demo Input:
['ApPLe\n', 'konjac\n']
Demo Output:
['ApPLe\n', 'Konjac\n']
Note:
none
|
```python
word=str(input())
A=str(word[0]).upper()
B=str(word[1:])
print(A+B)
```
| 3 |
|
71 |
A
|
Way Too Long Words
|
PROGRAMMING
| 800 |
[
"strings"
] |
A. Way Too Long Words
|
1
|
256
|
Sometimes some words like "localization" or "internationalization" are so long that writing them many times in one text is quite tiresome.
Let's consider a word too long, if its length is strictly more than 10 characters. All too long words should be replaced with a special abbreviation.
This abbreviation is made like this: we write down the first and the last letter of a word and between them we write the number of letters between the first and the last letters. That number is in decimal system and doesn't contain any leading zeroes.
Thus, "localization" will be spelt as "l10n", and "internationalization» will be spelt as "i18n".
You are suggested to automatize the process of changing the words with abbreviations. At that all too long words should be replaced by the abbreviation and the words that are not too long should not undergo any changes.
|
The first line contains an integer *n* (1<=≤<=*n*<=≤<=100). Each of the following *n* lines contains one word. All the words consist of lowercase Latin letters and possess the lengths of from 1 to 100 characters.
|
Print *n* lines. The *i*-th line should contain the result of replacing of the *i*-th word from the input data.
|
[
"4\nword\nlocalization\ninternationalization\npneumonoultramicroscopicsilicovolcanoconiosis\n"
] |
[
"word\nl10n\ni18n\np43s\n"
] |
none
| 500 |
[
{
"input": "4\nword\nlocalization\ninternationalization\npneumonoultramicroscopicsilicovolcanoconiosis",
"output": "word\nl10n\ni18n\np43s"
},
{
"input": "5\nabcdefgh\nabcdefghi\nabcdefghij\nabcdefghijk\nabcdefghijklm",
"output": "abcdefgh\nabcdefghi\nabcdefghij\na9k\na11m"
},
{
"input": "3\nnjfngnrurunrgunrunvurn\njfvnjfdnvjdbfvsbdubruvbubvkdb\nksdnvidnviudbvibd",
"output": "n20n\nj27b\nk15d"
},
{
"input": "1\ntcyctkktcctrcyvbyiuhihhhgyvyvyvyvjvytchjckt",
"output": "t41t"
},
{
"input": "24\nyou\nare\nregistered\nfor\npractice\nyou\ncan\nsolve\nproblems\nunofficially\nresults\ncan\nbe\nfound\nin\nthe\ncontest\nstatus\nand\nin\nthe\nbottom\nof\nstandings",
"output": "you\nare\nregistered\nfor\npractice\nyou\ncan\nsolve\nproblems\nu10y\nresults\ncan\nbe\nfound\nin\nthe\ncontest\nstatus\nand\nin\nthe\nbottom\nof\nstandings"
},
{
"input": "1\na",
"output": "a"
},
{
"input": "26\na\nb\nc\nd\ne\nf\ng\nh\ni\nj\nk\nl\nm\nn\no\np\nq\nr\ns\nt\nu\nv\nw\nx\ny\nz",
"output": "a\nb\nc\nd\ne\nf\ng\nh\ni\nj\nk\nl\nm\nn\no\np\nq\nr\ns\nt\nu\nv\nw\nx\ny\nz"
},
{
"input": "1\nabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghij",
"output": "a98j"
},
{
"input": "10\ngyartjdxxlcl\nfzsck\nuidwu\nxbymclornemdmtj\nilppyoapitawgje\ncibzc\ndrgbeu\nhezplmsdekhhbo\nfeuzlrimbqbytdu\nkgdco",
"output": "g10l\nfzsck\nuidwu\nx13j\ni13e\ncibzc\ndrgbeu\nh12o\nf13u\nkgdco"
},
{
"input": "20\nlkpmx\nkovxmxorlgwaomlswjxlpnbvltfv\nhykasjxqyjrmybejnmeumzha\ntuevlumpqbbhbww\nqgqsphvrmupxxc\ntrissbaf\nqfgrlinkzvzqdryckaizutd\nzzqtoaxkvwoscyx\noswytrlnhpjvvnwookx\nlpuzqgec\ngyzqfwxggtvpjhzmzmdw\nrlxjgmvdftvrmvbdwudra\nvsntnjpepnvdaxiporggmglhagv\nxlvcqkqgcrbgtgglj\nlyxwxbiszyhlsrgzeedzprbmcpduvq\nyrmqqvrkqskqukzqrwukpsifgtdc\nxpuohcsjhhuhvr\nvvlfrlxpvqejngwrbfbpmqeirxlw\nsvmasocxdvadmaxtrpakysmeaympy\nyuflqboqfdt",
"output": "lkpmx\nk26v\nh22a\nt13w\nq12c\ntrissbaf\nq21d\nz13x\no17x\nlpuzqgec\ng18w\nr19a\nv25v\nx15j\nl28q\ny26c\nx12r\nv26w\ns27y\ny9t"
},
{
"input": "100\nm\nz\ns\nv\nd\nr\nv\ny\ny\ne\np\nt\nc\na\nn\nm\np\ng\ni\nj\nc\na\nb\nq\ne\nn\nv\no\nk\nx\nf\ni\nl\na\nq\nr\nu\nb\ns\nl\nc\nl\ne\nv\nj\nm\nx\nb\na\nq\nb\na\nf\nj\nv\nm\nq\nc\nt\nt\nn\nx\no\ny\nr\nu\nh\nm\nj\np\nj\nq\nz\ns\nj\no\ng\nc\nm\nn\no\nm\nr\no\ns\nt\nh\nr\np\nk\nb\nz\ng\no\nc\nc\nz\nz\ng\nr",
"output": "m\nz\ns\nv\nd\nr\nv\ny\ny\ne\np\nt\nc\na\nn\nm\np\ng\ni\nj\nc\na\nb\nq\ne\nn\nv\no\nk\nx\nf\ni\nl\na\nq\nr\nu\nb\ns\nl\nc\nl\ne\nv\nj\nm\nx\nb\na\nq\nb\na\nf\nj\nv\nm\nq\nc\nt\nt\nn\nx\no\ny\nr\nu\nh\nm\nj\np\nj\nq\nz\ns\nj\no\ng\nc\nm\nn\no\nm\nr\no\ns\nt\nh\nr\np\nk\nb\nz\ng\no\nc\nc\nz\nz\ng\nr"
}
] | 1,676,086,790 | 2,147,483,647 |
Python 3
|
WRONG_ANSWER
|
TESTS
| 0 | 30 | 0 |
mi_lista=[]
x=int(input("cuantas palabras se van a abrebiar:"))
for y in range(x):
y=input("ingrese la palabra:")
mi_lista.append(y)
for abre in mi_lista:
h=len(abre)
print(f"{abre[0]}{h-2}{abre[h-1]}")
|
Title: Way Too Long Words
Time Limit: 1 seconds
Memory Limit: 256 megabytes
Problem Description:
Sometimes some words like "localization" or "internationalization" are so long that writing them many times in one text is quite tiresome.
Let's consider a word too long, if its length is strictly more than 10 characters. All too long words should be replaced with a special abbreviation.
This abbreviation is made like this: we write down the first and the last letter of a word and between them we write the number of letters between the first and the last letters. That number is in decimal system and doesn't contain any leading zeroes.
Thus, "localization" will be spelt as "l10n", and "internationalization» will be spelt as "i18n".
You are suggested to automatize the process of changing the words with abbreviations. At that all too long words should be replaced by the abbreviation and the words that are not too long should not undergo any changes.
Input Specification:
The first line contains an integer *n* (1<=≤<=*n*<=≤<=100). Each of the following *n* lines contains one word. All the words consist of lowercase Latin letters and possess the lengths of from 1 to 100 characters.
Output Specification:
Print *n* lines. The *i*-th line should contain the result of replacing of the *i*-th word from the input data.
Demo Input:
['4\nword\nlocalization\ninternationalization\npneumonoultramicroscopicsilicovolcanoconiosis\n']
Demo Output:
['word\nl10n\ni18n\np43s\n']
Note:
none
|
```python
mi_lista=[]
x=int(input("cuantas palabras se van a abrebiar:"))
for y in range(x):
y=input("ingrese la palabra:")
mi_lista.append(y)
for abre in mi_lista:
h=len(abre)
print(f"{abre[0]}{h-2}{abre[h-1]}")
```
| 0 |
358 |
C
|
Dima and Containers
|
PROGRAMMING
| 2,000 |
[
"constructive algorithms",
"greedy",
"implementation"
] | null | null |
Dima has a birthday soon! It's a big day! Saryozha's present to Dima is that Seryozha won't be in the room and won't disturb Dima and Inna as they celebrate the birthday. Inna's present to Dima is a stack, a queue and a deck.
Inna wants her present to show Dima how great a programmer he is. For that, she is going to give Dima commands one by one. There are two types of commands:
1. Add a given number into one of containers. For the queue and the stack, you can add elements only to the end. For the deck, you can add elements to the beginning and to the end. 1. Extract a number from each of at most three distinct containers. Tell all extracted numbers to Inna and then empty all containers. In the queue container you can extract numbers only from the beginning. In the stack container you can extract numbers only from the end. In the deck number you can extract numbers from the beginning and from the end. You cannot extract numbers from empty containers.
Every time Dima makes a command of the second type, Inna kisses Dima some (possibly zero) number of times. Dima knows Inna perfectly well, he is sure that this number equals the sum of numbers he extracts from containers during this operation.
As we've said before, Dima knows Inna perfectly well and he knows which commands Inna will give to Dima and the order of the commands. Help Dima find the strategy that lets him give as more kisses as possible for his birthday!
|
The first line contains integer *n* (1<=≤<=*n*<=≤<=105) — the number of Inna's commands. Then *n* lines follow, describing Inna's commands. Each line consists an integer:
1. Integer *a* (1<=≤<=*a*<=≤<=105) means that Inna gives Dima a command to add number *a* into one of containers. 1. Integer 0 shows that Inna asks Dima to make at most three extractions from different containers.
|
Each command of the input must correspond to one line of the output — Dima's action.
For the command of the first type (adding) print one word that corresponds to Dima's choice:
- pushStack — add to the end of the stack; - pushQueue — add to the end of the queue; - pushFront — add to the beginning of the deck; - pushBack — add to the end of the deck.
For a command of the second type first print an integer *k* (0<=≤<=*k*<=≤<=3), that shows the number of extract operations, then print *k* words separated by space. The words can be:
- popStack — extract from the end of the stack; - popQueue — extract from the beginning of the line; - popFront — extract from the beginning from the deck; - popBack — extract from the end of the deck.
The printed operations mustn't extract numbers from empty containers. Also, they must extract numbers from distinct containers.
The printed sequence of actions must lead to the maximum number of kisses. If there are multiple sequences of actions leading to the maximum number of kisses, you are allowed to print any of them.
|
[
"10\n0\n1\n0\n1\n2\n0\n1\n2\n3\n0\n",
"4\n1\n2\n3\n0\n"
] |
[
"0\npushStack\n1 popStack\npushStack\npushQueue\n2 popStack popQueue\npushStack\npushQueue\npushFront\n3 popStack popQueue popFront\n",
"pushStack\npushQueue\npushFront\n3 popStack popQueue popFront\n"
] |
none
| 1,500 |
[
{
"input": "10\n0\n1\n0\n1\n2\n0\n1\n2\n3\n0",
"output": "0\npushStack\n1 popStack\npushStack\npushQueue\n2 popStack popQueue\npushStack\npushQueue\npushFront\n3 popStack popQueue popFront"
},
{
"input": "4\n1\n2\n3\n0",
"output": "pushStack\npushQueue\npushFront\n3 popStack popQueue popFront"
},
{
"input": "2\n0\n1",
"output": "0\npushQueue"
},
{
"input": "5\n1\n1\n1\n2\n1",
"output": "pushQueue\npushQueue\npushQueue\npushQueue\npushQueue"
},
{
"input": "5\n3\n2\n3\n1\n0",
"output": "pushStack\npushQueue\npushFront\npushBack\n3 popStack popQueue popFront"
},
{
"input": "49\n8735\n95244\n50563\n33648\n10711\n30217\n49166\n28240\n0\n97232\n12428\n16180\n58610\n61112\n74423\n56323\n43327\n0\n12549\n48493\n43086\n69266\n27033\n37338\n43900\n5570\n25293\n44517\n7183\n41969\n31944\n32247\n96959\n44890\n98237\n52601\n29081\n93641\n14980\n29539\n84672\n57310\n91014\n31721\n6944\n67672\n22040\n86269\n86709",
"output": "pushBack\npushStack\npushQueue\npushBack\npushBack\npushBack\npushFront\npushBack\n3 popStack popQueue popFront\npushStack\npushBack\npushBack\npushBack\npushQueue\npushFront\npushBack\npushBack\n3 popStack popQueue popFront\npushQueue\npushQueue\npushQueue\npushQueue\npushQueue\npushQueue\npushQueue\npushQueue\npushQueue\npushQueue\npushQueue\npushQueue\npushQueue\npushQueue\npushQueue\npushQueue\npushQueue\npushQueue\npushQueue\npushQueue\npushQueue\npushQueue\npushQueue\npushQueue\npushQueue\npushQueue\n..."
},
{
"input": "55\n73792\n39309\n73808\n47389\n34803\n87947\n32460\n14649\n70151\n35816\n8272\n78886\n71345\n61907\n16977\n85362\n0\n43792\n8118\n83254\n89459\n32230\n87068\n82617\n94847\n83528\n37629\n31438\n97413\n62260\n13651\n47564\n43543\n61292\n51025\n64106\n0\n19282\n35422\n19657\n95170\n10266\n43771\n3190\n93962\n11747\n43021\n91531\n88370\n1760\n10950\n77059\n61741\n52965\n10445",
"output": "pushBack\npushBack\npushBack\npushBack\npushBack\npushStack\npushBack\npushBack\npushBack\npushBack\npushBack\npushQueue\npushBack\npushBack\npushBack\npushFront\n3 popStack popQueue popFront\npushBack\npushBack\npushBack\npushStack\npushBack\npushBack\npushBack\npushQueue\npushBack\npushBack\npushBack\npushFront\npushBack\npushBack\npushBack\npushBack\npushBack\npushBack\npushBack\n3 popStack popQueue popFront\npushQueue\npushQueue\npushQueue\npushQueue\npushQueue\npushQueue\npushQueue\npushQueue\npushQue..."
},
{
"input": "10\n1\n2\n3\n5\n4\n9\n8\n6\n7\n0",
"output": "pushBack\npushBack\npushBack\npushBack\npushBack\npushStack\npushQueue\npushBack\npushFront\n3 popStack popQueue popFront"
},
{
"input": "10\n1\n3\n4\n2\n6\n8\n5\n7\n10\n9",
"output": "pushQueue\npushQueue\npushQueue\npushQueue\npushQueue\npushQueue\npushQueue\npushQueue\npushQueue\npushQueue"
},
{
"input": "1\n0",
"output": "0"
}
] | 1,652,550,104 | 2,147,483,647 |
Python 3
|
WRONG_ANSWER
|
TESTS
| 4 | 46 | 102,400 |
from collections import deque
def main():
stack, queue, deck = deque(), deque(), deque()
most_recent_append = None
number_of_commands = int(input())
for _ in range(number_of_commands):
appended_value = int(input())
if appended_value == 0:
number_of_extractions = 0
extractions = ""
if len(stack) > 0:
stack.pop()
extractions += " popStack"
number_of_extractions += 1
if len(queue) > 0:
queue.popleft()
extractions += " popQueue"
number_of_extractions += 1
if len(deck) > 0:
deck.pop()
extractions += " popBack"
number_of_extractions += 1
print(f"{number_of_extractions}{extractions}")
most_recent_append = None
else:
if most_recent_append in {None, "deck"}:
stack.append(appended_value)
print("pushStack")
most_recent_append = "stack"
elif most_recent_append == "stack":
queue.appendleft(appended_value)
print("pushQueue")
most_recent_append = "queue"
else:
deck.appendleft(appended_value)
print("pushFront")
most_recent_append = "deck"
if __name__ == "__main__":
main()
|
Title: Dima and Containers
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Dima has a birthday soon! It's a big day! Saryozha's present to Dima is that Seryozha won't be in the room and won't disturb Dima and Inna as they celebrate the birthday. Inna's present to Dima is a stack, a queue and a deck.
Inna wants her present to show Dima how great a programmer he is. For that, she is going to give Dima commands one by one. There are two types of commands:
1. Add a given number into one of containers. For the queue and the stack, you can add elements only to the end. For the deck, you can add elements to the beginning and to the end. 1. Extract a number from each of at most three distinct containers. Tell all extracted numbers to Inna and then empty all containers. In the queue container you can extract numbers only from the beginning. In the stack container you can extract numbers only from the end. In the deck number you can extract numbers from the beginning and from the end. You cannot extract numbers from empty containers.
Every time Dima makes a command of the second type, Inna kisses Dima some (possibly zero) number of times. Dima knows Inna perfectly well, he is sure that this number equals the sum of numbers he extracts from containers during this operation.
As we've said before, Dima knows Inna perfectly well and he knows which commands Inna will give to Dima and the order of the commands. Help Dima find the strategy that lets him give as more kisses as possible for his birthday!
Input Specification:
The first line contains integer *n* (1<=≤<=*n*<=≤<=105) — the number of Inna's commands. Then *n* lines follow, describing Inna's commands. Each line consists an integer:
1. Integer *a* (1<=≤<=*a*<=≤<=105) means that Inna gives Dima a command to add number *a* into one of containers. 1. Integer 0 shows that Inna asks Dima to make at most three extractions from different containers.
Output Specification:
Each command of the input must correspond to one line of the output — Dima's action.
For the command of the first type (adding) print one word that corresponds to Dima's choice:
- pushStack — add to the end of the stack; - pushQueue — add to the end of the queue; - pushFront — add to the beginning of the deck; - pushBack — add to the end of the deck.
For a command of the second type first print an integer *k* (0<=≤<=*k*<=≤<=3), that shows the number of extract operations, then print *k* words separated by space. The words can be:
- popStack — extract from the end of the stack; - popQueue — extract from the beginning of the line; - popFront — extract from the beginning from the deck; - popBack — extract from the end of the deck.
The printed operations mustn't extract numbers from empty containers. Also, they must extract numbers from distinct containers.
The printed sequence of actions must lead to the maximum number of kisses. If there are multiple sequences of actions leading to the maximum number of kisses, you are allowed to print any of them.
Demo Input:
['10\n0\n1\n0\n1\n2\n0\n1\n2\n3\n0\n', '4\n1\n2\n3\n0\n']
Demo Output:
['0\npushStack\n1 popStack\npushStack\npushQueue\n2 popStack popQueue\npushStack\npushQueue\npushFront\n3 popStack popQueue popFront\n', 'pushStack\npushQueue\npushFront\n3 popStack popQueue popFront\n']
Note:
none
|
```python
from collections import deque
def main():
stack, queue, deck = deque(), deque(), deque()
most_recent_append = None
number_of_commands = int(input())
for _ in range(number_of_commands):
appended_value = int(input())
if appended_value == 0:
number_of_extractions = 0
extractions = ""
if len(stack) > 0:
stack.pop()
extractions += " popStack"
number_of_extractions += 1
if len(queue) > 0:
queue.popleft()
extractions += " popQueue"
number_of_extractions += 1
if len(deck) > 0:
deck.pop()
extractions += " popBack"
number_of_extractions += 1
print(f"{number_of_extractions}{extractions}")
most_recent_append = None
else:
if most_recent_append in {None, "deck"}:
stack.append(appended_value)
print("pushStack")
most_recent_append = "stack"
elif most_recent_append == "stack":
queue.appendleft(appended_value)
print("pushQueue")
most_recent_append = "queue"
else:
deck.appendleft(appended_value)
print("pushFront")
most_recent_append = "deck"
if __name__ == "__main__":
main()
```
| 0 |
|
629 |
B
|
Far Relative’s Problem
|
PROGRAMMING
| 1,100 |
[
"brute force"
] | null | null |
Famil Door wants to celebrate his birthday with his friends from Far Far Away. He has *n* friends and each of them can come to the party in a specific range of days of the year from *a**i* to *b**i*. Of course, Famil Door wants to have as many friends celebrating together with him as possible.
Far cars are as weird as Far Far Away citizens, so they can only carry two people of opposite gender, that is exactly one male and one female. However, Far is so far from here that no other transportation may be used to get to the party.
Famil Door should select some day of the year and invite some of his friends, such that they all are available at this moment and the number of male friends invited is equal to the number of female friends invited. Find the maximum number of friends that may present at the party.
|
The first line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=5000) — then number of Famil Door's friends.
Then follow *n* lines, that describe the friends. Each line starts with a capital letter 'F' for female friends and with a capital letter 'M' for male friends. Then follow two integers *a**i* and *b**i* (1<=≤<=*a**i*<=≤<=*b**i*<=≤<=366), providing that the *i*-th friend can come to the party from day *a**i* to day *b**i* inclusive.
|
Print the maximum number of people that may come to Famil Door's party.
|
[
"4\nM 151 307\nF 343 352\nF 117 145\nM 24 128\n",
"6\nM 128 130\nF 128 131\nF 131 140\nF 131 141\nM 131 200\nM 140 200\n"
] |
[
"2\n",
"4\n"
] |
In the first sample, friends 3 and 4 can come on any day in range [117, 128].
In the second sample, friends with indices 3, 4, 5 and 6 can come on day 140.
| 1,000 |
[
{
"input": "4\nM 151 307\nF 343 352\nF 117 145\nM 24 128",
"output": "2"
},
{
"input": "6\nM 128 130\nF 128 131\nF 131 140\nF 131 141\nM 131 200\nM 140 200",
"output": "4"
},
{
"input": "1\nF 68 307",
"output": "0"
},
{
"input": "40\nM 55 363\nF 117 252\nM 157 282\nF 322 345\nM 330 363\nF 154 231\nF 216 352\nF 357 365\nM 279 292\nF 353 359\nF 82 183\nM 78 297\nM 231 314\nM 107 264\nF 34 318\nM 44 244\nF 42 339\nM 253 307\nM 128 192\nF 119 328\nM 135 249\nF 303 358\nF 348 352\nF 8 364\nF 126 303\nM 226 346\nF 110 300\nF 47 303\nF 201 311\nF 287 288\nM 270 352\nM 227 351\nF 8 111\nF 39 229\nM 163 315\nF 269 335\nF 147 351\nF 96 143\nM 97 99\nM 177 295",
"output": "22"
},
{
"input": "2\nF 1 1\nM 1 1",
"output": "2"
},
{
"input": "4\nM 1 2\nM 2 3\nF 3 4\nF 4 5",
"output": "2"
},
{
"input": "1\nF 1 2",
"output": "0"
},
{
"input": "18\nF 3 4\nF 3 4\nF 3 4\nF 3 4\nF 5 6\nF 5 6\nM 3 4\nM 3 4\nM 5 6\nM 5 6\nM 5 6\nM 5 6\nF 7 8\nF 7 8\nF 7 8\nM 7 8\nM 7 8\nM 7 8",
"output": "6"
},
{
"input": "2\nM 1 1\nF 1 1",
"output": "2"
},
{
"input": "3\nM 1 1\nF 1 1\nM 1 1",
"output": "2"
}
] | 1,455,990,181 | 4,081 |
Python 3
|
RUNTIME_ERROR
|
PRETESTS
| 2 | 218 | 0 |
n = int(input())
lst = [[0 for x in range(2)] for y in range(366)]
for i in range(n):
temp = input().split()
for i in range(int(temp[1])-1, int(temp[2])):
lst[i][0] += 1
if(temp[0]=='M'):
lst[i][1] += 1
else:
lst[i][1] -= 1
for i in range(n):
lst[i][0] = lst[i][0] - abs(lst[i][1])
ans = max(lst)
print (ans[0])
|
Title: Far Relative’s Problem
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Famil Door wants to celebrate his birthday with his friends from Far Far Away. He has *n* friends and each of them can come to the party in a specific range of days of the year from *a**i* to *b**i*. Of course, Famil Door wants to have as many friends celebrating together with him as possible.
Far cars are as weird as Far Far Away citizens, so they can only carry two people of opposite gender, that is exactly one male and one female. However, Far is so far from here that no other transportation may be used to get to the party.
Famil Door should select some day of the year and invite some of his friends, such that they all are available at this moment and the number of male friends invited is equal to the number of female friends invited. Find the maximum number of friends that may present at the party.
Input Specification:
The first line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=5000) — then number of Famil Door's friends.
Then follow *n* lines, that describe the friends. Each line starts with a capital letter 'F' for female friends and with a capital letter 'M' for male friends. Then follow two integers *a**i* and *b**i* (1<=≤<=*a**i*<=≤<=*b**i*<=≤<=366), providing that the *i*-th friend can come to the party from day *a**i* to day *b**i* inclusive.
Output Specification:
Print the maximum number of people that may come to Famil Door's party.
Demo Input:
['4\nM 151 307\nF 343 352\nF 117 145\nM 24 128\n', '6\nM 128 130\nF 128 131\nF 131 140\nF 131 141\nM 131 200\nM 140 200\n']
Demo Output:
['2\n', '4\n']
Note:
In the first sample, friends 3 and 4 can come on any day in range [117, 128].
In the second sample, friends with indices 3, 4, 5 and 6 can come on day 140.
|
```python
n = int(input())
lst = [[0 for x in range(2)] for y in range(366)]
for i in range(n):
temp = input().split()
for i in range(int(temp[1])-1, int(temp[2])):
lst[i][0] += 1
if(temp[0]=='M'):
lst[i][1] += 1
else:
lst[i][1] -= 1
for i in range(n):
lst[i][0] = lst[i][0] - abs(lst[i][1])
ans = max(lst)
print (ans[0])
```
| -1 |
|
251 |
A
|
Points on Line
|
PROGRAMMING
| 1,300 |
[
"binary search",
"combinatorics",
"two pointers"
] | null | null |
Little Petya likes points a lot. Recently his mom has presented him *n* points lying on the line *OX*. Now Petya is wondering in how many ways he can choose three distinct points so that the distance between the two farthest of them doesn't exceed *d*.
Note that the order of the points inside the group of three chosen points doesn't matter.
|
The first line contains two integers: *n* and *d* (1<=≤<=*n*<=≤<=105; 1<=≤<=*d*<=≤<=109). The next line contains *n* integers *x*1,<=*x*2,<=...,<=*x**n*, their absolute value doesn't exceed 109 — the *x*-coordinates of the points that Petya has got.
It is guaranteed that the coordinates of the points in the input strictly increase.
|
Print a single integer — the number of groups of three points, where the distance between two farthest points doesn't exceed *d*.
Please do not use the %lld specifier to read or write 64-bit integers in С++. It is preferred to use the cin, cout streams or the %I64d specifier.
|
[
"4 3\n1 2 3 4\n",
"4 2\n-3 -2 -1 0\n",
"5 19\n1 10 20 30 50\n"
] |
[
"4\n",
"2\n",
"1\n"
] |
In the first sample any group of three points meets our conditions.
In the seconds sample only 2 groups of three points meet our conditions: {-3, -2, -1} and {-2, -1, 0}.
In the third sample only one group does: {1, 10, 20}.
| 500 |
[
{
"input": "4 3\n1 2 3 4",
"output": "4"
},
{
"input": "4 2\n-3 -2 -1 0",
"output": "2"
},
{
"input": "5 19\n1 10 20 30 50",
"output": "1"
},
{
"input": "10 5\n31 36 43 47 48 50 56 69 71 86",
"output": "2"
},
{
"input": "10 50\n1 4 20 27 65 79 82 83 99 100",
"output": "25"
},
{
"input": "10 90\n24 27 40 41 61 69 73 87 95 97",
"output": "120"
},
{
"input": "100 100\n-98 -97 -96 -93 -92 -91 -90 -87 -86 -84 -81 -80 -79 -78 -76 -75 -73 -71 -69 -67 -65 -64 -63 -62 -61 -54 -51 -50 -49 -48 -46 -45 -44 -37 -36 -33 -30 -28 -27 -16 -15 -13 -12 -10 -9 -7 -6 -5 -4 2 3 5 8 9 10 11 13 14 15 16 17 19 22 24 25 26 27 28 30 31 32 36 40 43 45 46 47 50 51 52 53 58 60 63 69 70 73 78 80 81 82 85 88 89 90 91 95 96 97 99",
"output": "79351"
},
{
"input": "1 14751211\n847188590",
"output": "0"
},
{
"input": "2 1000000000\n-907894512 -289906312",
"output": "0"
},
{
"input": "2 1000000000\n-14348867 1760823",
"output": "0"
},
{
"input": "3 1000000000\n-5 -1 1",
"output": "1"
}
] | 1,541,759,582 | 2,147,483,647 |
Python 3
|
OK
|
TESTS
| 39 | 654 | 8,601,600 |
if __name__ == "__main__":
ans = 0
n, x = map(int, input().split(' '))
lst = list(int(x) for x in input().split(' '))
j = 2
for i in range(0, n-2):
b = 0
for k in range(j, n):
if lst[k] - lst[i] > x:
b = k-1
j = k
break
else:
b = k
j = k
z = b-(i+1)
if b != 0:
ans += (z*(z+1))/2
print(int(ans))
|
Title: Points on Line
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Little Petya likes points a lot. Recently his mom has presented him *n* points lying on the line *OX*. Now Petya is wondering in how many ways he can choose three distinct points so that the distance between the two farthest of them doesn't exceed *d*.
Note that the order of the points inside the group of three chosen points doesn't matter.
Input Specification:
The first line contains two integers: *n* and *d* (1<=≤<=*n*<=≤<=105; 1<=≤<=*d*<=≤<=109). The next line contains *n* integers *x*1,<=*x*2,<=...,<=*x**n*, their absolute value doesn't exceed 109 — the *x*-coordinates of the points that Petya has got.
It is guaranteed that the coordinates of the points in the input strictly increase.
Output Specification:
Print a single integer — the number of groups of three points, where the distance between two farthest points doesn't exceed *d*.
Please do not use the %lld specifier to read or write 64-bit integers in С++. It is preferred to use the cin, cout streams or the %I64d specifier.
Demo Input:
['4 3\n1 2 3 4\n', '4 2\n-3 -2 -1 0\n', '5 19\n1 10 20 30 50\n']
Demo Output:
['4\n', '2\n', '1\n']
Note:
In the first sample any group of three points meets our conditions.
In the seconds sample only 2 groups of three points meet our conditions: {-3, -2, -1} and {-2, -1, 0}.
In the third sample only one group does: {1, 10, 20}.
|
```python
if __name__ == "__main__":
ans = 0
n, x = map(int, input().split(' '))
lst = list(int(x) for x in input().split(' '))
j = 2
for i in range(0, n-2):
b = 0
for k in range(j, n):
if lst[k] - lst[i] > x:
b = k-1
j = k
break
else:
b = k
j = k
z = b-(i+1)
if b != 0:
ans += (z*(z+1))/2
print(int(ans))
```
| 3 |
|
1 |
A
|
Theatre Square
|
PROGRAMMING
| 1,000 |
[
"math"
] |
A. Theatre Square
|
1
|
256
|
Theatre Square in the capital city of Berland has a rectangular shape with the size *n*<=×<=*m* meters. On the occasion of the city's anniversary, a decision was taken to pave the Square with square granite flagstones. Each flagstone is of the size *a*<=×<=*a*.
What is the least number of flagstones needed to pave the Square? It's allowed to cover the surface larger than the Theatre Square, but the Square has to be covered. It's not allowed to break the flagstones. The sides of flagstones should be parallel to the sides of the Square.
|
The input contains three positive integer numbers in the first line: *n*,<=<=*m* and *a* (1<=≤<=<=*n*,<=*m*,<=*a*<=≤<=109).
|
Write the needed number of flagstones.
|
[
"6 6 4\n"
] |
[
"4\n"
] |
none
| 0 |
[
{
"input": "6 6 4",
"output": "4"
},
{
"input": "1 1 1",
"output": "1"
},
{
"input": "2 1 1",
"output": "2"
},
{
"input": "1 2 1",
"output": "2"
},
{
"input": "2 2 1",
"output": "4"
},
{
"input": "2 1 2",
"output": "1"
},
{
"input": "1 1 3",
"output": "1"
},
{
"input": "2 3 4",
"output": "1"
},
{
"input": "1000000000 1000000000 1",
"output": "1000000000000000000"
},
{
"input": "12 13 4",
"output": "12"
},
{
"input": "222 332 5",
"output": "3015"
},
{
"input": "1000 1000 10",
"output": "10000"
},
{
"input": "1001 1000 10",
"output": "10100"
},
{
"input": "100 10001 1000000000",
"output": "1"
},
{
"input": "1000000000 1000000000 1000000000",
"output": "1"
},
{
"input": "1000000000 1000000000 999999999",
"output": "4"
},
{
"input": "1000000000 1000000000 192",
"output": "27126743055556"
},
{
"input": "1000000000 987654321 1",
"output": "987654321000000000"
},
{
"input": "456784567 1000000000 51",
"output": "175618850864484"
},
{
"input": "39916800 134217728 40320",
"output": "3295710"
}
] | 1,691,706,945 | 2,147,483,647 |
PyPy 3-64
|
WRONG_ANSWER
|
TESTS
| 0 | 46 | 614,400 |
from collections import deque
import heapq
from math import gcd, lcm
import os
import sys
LOCAL = True
try:
open(f"{os.path.realpath(os.path.dirname(__file__))}/../generator.py")
except:
LOCAL = False
# MOD = 10 ** 9 + 7
MOD = 998244353
INF = 10 ** 100
def sqrt(n):
if n < 0:
return -1
a = 0
b = n
while a != b:
mid = (a + b) // 2
if mid * mid < n:
a = mid + 1
else:
b = mid
if a * a != n:
return -1
return a
def inv(n):
return pow(n % MOD, MOD - 2, MOD)
fib_mem = [0, 1]
def fib(n, cache=True):
if not cache:
a, b = 0, 1
for _ in range(n):
a, b = b % MOD, (a + b) % MOD
return a
else:
while len(fib_mem) < n + 1:
fib_mem.append((fib_mem[-1] + fib_mem[-2]) % MOD)
return fib_mem[n]
fac_mem = [1]
def fac(n, cache=True):
if not cache:
r = 1
for i in range(1, n + 1):
r = (r * i) % MOD
return r
else:
while len(fac_mem) < n + 1:
fac_mem.append(fac_mem[-1] * len(fac_mem) % MOD)
return fac_mem[n]
def perm(n, k, cache=True):
return fac(n, cache=cache) * inv(fac(k, cache=cache)) % MOD
def comb(n, k, cache=True):
return fac(n, cache=cache) * inv(fac(k, cache=cache) * fac(n - k, cache=cache)) % MOD
def comb_row(n):
yield 1
r = 1
for k in range(1, n + 1):
r = r * (n + 1 - k) * inv(k) % MOD
yield r
def prod(l):
r = 1
for i in l:
r *= i
return r
def is_prime(n):
if n <= 3:
return n >= 2
if n % 2 == 0:
return False
if n % 3 == 0:
return False
d = 5
while d * d <= n:
if n % d == 0:
return False
d += (9 - d % 6) >> 1
return True
def factor(n):
p = []
while n % 2 == 0:
p.append(2)
n >>= 1
while n % 3 == 0:
p.append(3)
n //= 3
d = 5
while d * d <= n:
while n % d == 0:
n //= d
p.append(d)
d += (9 - d % 6) // 2
if n > 1:
p.append(n)
return p
def count(l):
r = {}
for i in l:
r[i] = r.get(i, 0) + 1
return r
def first_such(pred, a=0, b=None):
if b == None:
b = max(1, a)
while not pred(b):
b *= 2
while a < b:
mid = (a + b) // 2
if pred(mid):
b = mid
else:
a = mid + 1
if a > b:
return None
return a
def last_such(pred, a=0, b=None):
if b == None:
b = max(1, a)
while not pred(b):
b *= 2
while a < b:
mid = (a + b + 1) // 2
if pred(mid):
b = mid - 1
else:
a = mid
if a > b:
return None
return a
def halt_and_catch_fire():
[*range(10 ** 18)]
def ints():
return [int(j) for j in input().split()]
def chars():
return list(input())
def deb(*l, **kwargs):
if LOCAL:
print("\033[2m", end="")
print(*l, **kwargs)
print("\033[0m", end="")
def ans(*l, **kwargs):
if LOCAL:
print("\033[32m", end="")
if l and type(l[0]) == bool:
print(["NO", "YES"][l[0]], **kwargs)
else:
print(*l, **kwargs)
if LOCAL:
print("\033[0m", end="")
#####
n, m, a = ints()
deb(((m - 1) // a + 1) * ((n - 1) // a + 1))
|
Title: Theatre Square
Time Limit: 1 seconds
Memory Limit: 256 megabytes
Problem Description:
Theatre Square in the capital city of Berland has a rectangular shape with the size *n*<=×<=*m* meters. On the occasion of the city's anniversary, a decision was taken to pave the Square with square granite flagstones. Each flagstone is of the size *a*<=×<=*a*.
What is the least number of flagstones needed to pave the Square? It's allowed to cover the surface larger than the Theatre Square, but the Square has to be covered. It's not allowed to break the flagstones. The sides of flagstones should be parallel to the sides of the Square.
Input Specification:
The input contains three positive integer numbers in the first line: *n*,<=<=*m* and *a* (1<=≤<=<=*n*,<=*m*,<=*a*<=≤<=109).
Output Specification:
Write the needed number of flagstones.
Demo Input:
['6 6 4\n']
Demo Output:
['4\n']
Note:
none
|
```python
from collections import deque
import heapq
from math import gcd, lcm
import os
import sys
LOCAL = True
try:
open(f"{os.path.realpath(os.path.dirname(__file__))}/../generator.py")
except:
LOCAL = False
# MOD = 10 ** 9 + 7
MOD = 998244353
INF = 10 ** 100
def sqrt(n):
if n < 0:
return -1
a = 0
b = n
while a != b:
mid = (a + b) // 2
if mid * mid < n:
a = mid + 1
else:
b = mid
if a * a != n:
return -1
return a
def inv(n):
return pow(n % MOD, MOD - 2, MOD)
fib_mem = [0, 1]
def fib(n, cache=True):
if not cache:
a, b = 0, 1
for _ in range(n):
a, b = b % MOD, (a + b) % MOD
return a
else:
while len(fib_mem) < n + 1:
fib_mem.append((fib_mem[-1] + fib_mem[-2]) % MOD)
return fib_mem[n]
fac_mem = [1]
def fac(n, cache=True):
if not cache:
r = 1
for i in range(1, n + 1):
r = (r * i) % MOD
return r
else:
while len(fac_mem) < n + 1:
fac_mem.append(fac_mem[-1] * len(fac_mem) % MOD)
return fac_mem[n]
def perm(n, k, cache=True):
return fac(n, cache=cache) * inv(fac(k, cache=cache)) % MOD
def comb(n, k, cache=True):
return fac(n, cache=cache) * inv(fac(k, cache=cache) * fac(n - k, cache=cache)) % MOD
def comb_row(n):
yield 1
r = 1
for k in range(1, n + 1):
r = r * (n + 1 - k) * inv(k) % MOD
yield r
def prod(l):
r = 1
for i in l:
r *= i
return r
def is_prime(n):
if n <= 3:
return n >= 2
if n % 2 == 0:
return False
if n % 3 == 0:
return False
d = 5
while d * d <= n:
if n % d == 0:
return False
d += (9 - d % 6) >> 1
return True
def factor(n):
p = []
while n % 2 == 0:
p.append(2)
n >>= 1
while n % 3 == 0:
p.append(3)
n //= 3
d = 5
while d * d <= n:
while n % d == 0:
n //= d
p.append(d)
d += (9 - d % 6) // 2
if n > 1:
p.append(n)
return p
def count(l):
r = {}
for i in l:
r[i] = r.get(i, 0) + 1
return r
def first_such(pred, a=0, b=None):
if b == None:
b = max(1, a)
while not pred(b):
b *= 2
while a < b:
mid = (a + b) // 2
if pred(mid):
b = mid
else:
a = mid + 1
if a > b:
return None
return a
def last_such(pred, a=0, b=None):
if b == None:
b = max(1, a)
while not pred(b):
b *= 2
while a < b:
mid = (a + b + 1) // 2
if pred(mid):
b = mid - 1
else:
a = mid
if a > b:
return None
return a
def halt_and_catch_fire():
[*range(10 ** 18)]
def ints():
return [int(j) for j in input().split()]
def chars():
return list(input())
def deb(*l, **kwargs):
if LOCAL:
print("\033[2m", end="")
print(*l, **kwargs)
print("\033[0m", end="")
def ans(*l, **kwargs):
if LOCAL:
print("\033[32m", end="")
if l and type(l[0]) == bool:
print(["NO", "YES"][l[0]], **kwargs)
else:
print(*l, **kwargs)
if LOCAL:
print("\033[0m", end="")
#####
n, m, a = ints()
deb(((m - 1) // a + 1) * ((n - 1) // a + 1))
```
| 0 |
535 |
B
|
Tavas and SaDDas
|
PROGRAMMING
| 1,100 |
[
"bitmasks",
"brute force",
"combinatorics",
"implementation"
] | null | null |
Once again Tavas started eating coffee mix without water! Keione told him that it smells awful, but he didn't stop doing that. That's why Keione told his smart friend, SaDDas to punish him! SaDDas took Tavas' headphones and told him: "If you solve the following problem, I'll return it to you."
The problem is:
You are given a lucky number *n*. Lucky numbers are the positive integers whose decimal representations contain only the lucky digits 4 and 7. For example, numbers 47, 744, 4 are lucky and 5, 17, 467 are not.
If we sort all lucky numbers in increasing order, what's the 1-based index of *n*?
Tavas is not as smart as SaDDas, so he asked you to do him a favor and solve this problem so he can have his headphones back.
|
The first and only line of input contains a lucky number *n* (1<=≤<=*n*<=≤<=109).
|
Print the index of *n* among all lucky numbers.
|
[
"4\n",
"7\n",
"77\n"
] |
[
"1\n",
"2\n",
"6\n"
] |
none
| 1,000 |
[
{
"input": "4",
"output": "1"
},
{
"input": "7",
"output": "2"
},
{
"input": "77",
"output": "6"
},
{
"input": "4",
"output": "1"
},
{
"input": "474744",
"output": "83"
},
{
"input": "777774",
"output": "125"
},
{
"input": "447",
"output": "8"
},
{
"input": "774",
"output": "13"
},
{
"input": "4",
"output": "1"
},
{
"input": "4447747",
"output": "140"
},
{
"input": "7747474",
"output": "233"
},
{
"input": "4444",
"output": "15"
},
{
"input": "4447",
"output": "16"
},
{
"input": "7",
"output": "2"
},
{
"input": "4",
"output": "1"
},
{
"input": "4447744",
"output": "139"
},
{
"input": "77474",
"output": "57"
},
{
"input": "7747",
"output": "28"
},
{
"input": "444",
"output": "7"
},
{
"input": "7",
"output": "2"
},
{
"input": "7774477",
"output": "242"
},
{
"input": "4477774",
"output": "157"
},
{
"input": "7444",
"output": "23"
},
{
"input": "7474747",
"output": "212"
},
{
"input": "77",
"output": "6"
},
{
"input": "774477",
"output": "114"
},
{
"input": "7",
"output": "2"
},
{
"input": "47",
"output": "4"
},
{
"input": "747777",
"output": "110"
},
{
"input": "444444444",
"output": "511"
},
{
"input": "777777777",
"output": "1022"
},
{
"input": "477477447",
"output": "728"
},
{
"input": "777744747",
"output": "996"
}
] | 1,596,956,965 | 2,147,483,647 |
Python 3
|
OK
|
TESTS
| 33 | 93 | 6,963,200 |
# Solution for codeforces problem 535-B, problem was completed as part
# of the coding coversations session held on 9th August 2020.
#
# author - atifcppprogrammer
# Generating all possible lucky numbers and sorting them in place.
from itertools import product as prod
luckyNumbers = []
for j in [1,2,3,4,5,6,7,8,9]:
tuples = list(prod(['4','7'], repeat = j))
for element in tuples:
luckyNumbers.append(int(''.join(element)))
luckyNumbers.sort()
# Collecting number from codeforces and determining its 1-based
# index.
number=int(input())
print(1+luckyNumbers.index(number))
|
Title: Tavas and SaDDas
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Once again Tavas started eating coffee mix without water! Keione told him that it smells awful, but he didn't stop doing that. That's why Keione told his smart friend, SaDDas to punish him! SaDDas took Tavas' headphones and told him: "If you solve the following problem, I'll return it to you."
The problem is:
You are given a lucky number *n*. Lucky numbers are the positive integers whose decimal representations contain only the lucky digits 4 and 7. For example, numbers 47, 744, 4 are lucky and 5, 17, 467 are not.
If we sort all lucky numbers in increasing order, what's the 1-based index of *n*?
Tavas is not as smart as SaDDas, so he asked you to do him a favor and solve this problem so he can have his headphones back.
Input Specification:
The first and only line of input contains a lucky number *n* (1<=≤<=*n*<=≤<=109).
Output Specification:
Print the index of *n* among all lucky numbers.
Demo Input:
['4\n', '7\n', '77\n']
Demo Output:
['1\n', '2\n', '6\n']
Note:
none
|
```python
# Solution for codeforces problem 535-B, problem was completed as part
# of the coding coversations session held on 9th August 2020.
#
# author - atifcppprogrammer
# Generating all possible lucky numbers and sorting them in place.
from itertools import product as prod
luckyNumbers = []
for j in [1,2,3,4,5,6,7,8,9]:
tuples = list(prod(['4','7'], repeat = j))
for element in tuples:
luckyNumbers.append(int(''.join(element)))
luckyNumbers.sort()
# Collecting number from codeforces and determining its 1-based
# index.
number=int(input())
print(1+luckyNumbers.index(number))
```
| 3 |
|
729 |
B
|
Spotlights
|
PROGRAMMING
| 1,200 |
[
"dp",
"implementation"
] | null | null |
Theater stage is a rectangular field of size *n*<=×<=*m*. The director gave you the stage's plan which actors will follow. For each cell it is stated in the plan if there would be an actor in this cell or not.
You are to place a spotlight on the stage in some good position. The spotlight will project light in one of the four directions (if you look at the stage from above) — left, right, up or down. Thus, the spotlight's position is a cell it is placed to and a direction it shines.
A position is good if two conditions hold:
- there is no actor in the cell the spotlight is placed to; - there is at least one actor in the direction the spotlight projects.
Count the number of good positions for placing the spotlight. Two positions of spotlight are considered to be different if the location cells or projection direction differ.
|
The first line contains two positive integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=1000) — the number of rows and the number of columns in the plan.
The next *n* lines contain *m* integers, 0 or 1 each — the description of the plan. Integer 1, means there will be an actor in the corresponding cell, while 0 means the cell will remain empty. It is guaranteed that there is at least one actor in the plan.
|
Print one integer — the number of good positions for placing the spotlight.
|
[
"2 4\n0 1 0 0\n1 0 1 0\n",
"4 4\n0 0 0 0\n1 0 0 1\n0 1 1 0\n0 1 0 0\n"
] |
[
"9\n",
"20\n"
] |
In the first example the following positions are good:
1. the (1, 1) cell and right direction; 1. the (1, 1) cell and down direction; 1. the (1, 3) cell and left direction; 1. the (1, 3) cell and down direction; 1. the (1, 4) cell and left direction; 1. the (2, 2) cell and left direction; 1. the (2, 2) cell and up direction; 1. the (2, 2) and right direction; 1. the (2, 4) cell and left direction.
Therefore, there are 9 good positions in this example.
| 1,000 |
[
{
"input": "2 4\n0 1 0 0\n1 0 1 0",
"output": "9"
},
{
"input": "4 4\n0 0 0 0\n1 0 0 1\n0 1 1 0\n0 1 0 0",
"output": "20"
},
{
"input": "1 5\n1 1 0 0 0",
"output": "3"
},
{
"input": "2 10\n0 0 0 0 0 0 0 1 0 0\n1 0 0 0 0 0 0 0 0 0",
"output": "20"
},
{
"input": "3 1\n1\n0\n0",
"output": "2"
},
{
"input": "5 7\n0 0 0 0 0 0 1\n0 0 0 0 0 0 1\n0 0 0 1 0 0 0\n0 0 0 0 0 0 0\n0 0 0 0 0 0 0",
"output": "25"
},
{
"input": "10 20\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1\n1 1 1 1 0 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "4"
},
{
"input": "5 7\n0 0 0 0 0 0 0\n0 1 1 1 1 0 1\n0 1 1 1 1 1 1\n0 0 0 0 0 0 0\n0 1 1 1 1 0 1",
"output": "26"
},
{
"input": "10 20\n0 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1\n0 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1\n0 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0\n0 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0\n0 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1\n0 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0\n0 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "121"
},
{
"input": "1 2\n0 1",
"output": "1"
},
{
"input": "1 2\n1 0",
"output": "1"
},
{
"input": "1 2\n1 1",
"output": "0"
},
{
"input": "2 1\n1\n0",
"output": "1"
},
{
"input": "2 1\n0\n1",
"output": "1"
},
{
"input": "2 1\n1\n1",
"output": "0"
},
{
"input": "1 1\n1",
"output": "0"
},
{
"input": "4 4\n1 1 1 1\n1 0 0 1\n1 0 0 1\n1 1 1 1",
"output": "16"
}
] | 1,479,635,055 | 2,355 |
Python 3
|
TIME_LIMIT_EXCEEDED
|
PRETESTS
| 6 | 1,000 | 6,041,600 |
n,m=list(map(int,input().split()))
p=[list(map(int,input().split())) for j in range(n)]
pos=0
for i in range(n):
for j in range(m):
if p[i][j]==0 :
if i<n-1 :
for z in range(i+1,n):
if p[z][j]==1:pos+=1;break
if i>0 :
for z in range(0,i):
if p[z][j]==1:pos+=1;break
if j>0 and p[i][:j].count(1)>0:pos+=1
if j<m-1 and p[i][j+1:].count(1)>0:pos+=1
print(pos)
|
Title: Spotlights
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Theater stage is a rectangular field of size *n*<=×<=*m*. The director gave you the stage's plan which actors will follow. For each cell it is stated in the plan if there would be an actor in this cell or not.
You are to place a spotlight on the stage in some good position. The spotlight will project light in one of the four directions (if you look at the stage from above) — left, right, up or down. Thus, the spotlight's position is a cell it is placed to and a direction it shines.
A position is good if two conditions hold:
- there is no actor in the cell the spotlight is placed to; - there is at least one actor in the direction the spotlight projects.
Count the number of good positions for placing the spotlight. Two positions of spotlight are considered to be different if the location cells or projection direction differ.
Input Specification:
The first line contains two positive integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=1000) — the number of rows and the number of columns in the plan.
The next *n* lines contain *m* integers, 0 or 1 each — the description of the plan. Integer 1, means there will be an actor in the corresponding cell, while 0 means the cell will remain empty. It is guaranteed that there is at least one actor in the plan.
Output Specification:
Print one integer — the number of good positions for placing the spotlight.
Demo Input:
['2 4\n0 1 0 0\n1 0 1 0\n', '4 4\n0 0 0 0\n1 0 0 1\n0 1 1 0\n0 1 0 0\n']
Demo Output:
['9\n', '20\n']
Note:
In the first example the following positions are good:
1. the (1, 1) cell and right direction; 1. the (1, 1) cell and down direction; 1. the (1, 3) cell and left direction; 1. the (1, 3) cell and down direction; 1. the (1, 4) cell and left direction; 1. the (2, 2) cell and left direction; 1. the (2, 2) cell and up direction; 1. the (2, 2) and right direction; 1. the (2, 4) cell and left direction.
Therefore, there are 9 good positions in this example.
|
```python
n,m=list(map(int,input().split()))
p=[list(map(int,input().split())) for j in range(n)]
pos=0
for i in range(n):
for j in range(m):
if p[i][j]==0 :
if i<n-1 :
for z in range(i+1,n):
if p[z][j]==1:pos+=1;break
if i>0 :
for z in range(0,i):
if p[z][j]==1:pos+=1;break
if j>0 and p[i][:j].count(1)>0:pos+=1
if j<m-1 and p[i][j+1:].count(1)>0:pos+=1
print(pos)
```
| 0 |
|
136 |
A
|
Presents
|
PROGRAMMING
| 800 |
[
"implementation"
] | null | null |
Little Petya very much likes gifts. Recently he has received a new laptop as a New Year gift from his mother. He immediately decided to give it to somebody else as what can be more pleasant than giving somebody gifts. And on this occasion he organized a New Year party at his place and invited *n* his friends there.
If there's one thing Petya likes more that receiving gifts, that's watching others giving gifts to somebody else. Thus, he safely hid the laptop until the next New Year and made up his mind to watch his friends exchanging gifts while he does not participate in the process. He numbered all his friends with integers from 1 to *n*. Petya remembered that a friend number *i* gave a gift to a friend number *p**i*. He also remembered that each of his friends received exactly one gift.
Now Petya wants to know for each friend *i* the number of a friend who has given him a gift.
|
The first line contains one integer *n* (1<=≤<=*n*<=≤<=100) — the quantity of friends Petya invited to the party. The second line contains *n* space-separated integers: the *i*-th number is *p**i* — the number of a friend who gave a gift to friend number *i*. It is guaranteed that each friend received exactly one gift. It is possible that some friends do not share Petya's ideas of giving gifts to somebody else. Those friends gave the gifts to themselves.
|
Print *n* space-separated integers: the *i*-th number should equal the number of the friend who gave a gift to friend number *i*.
|
[
"4\n2 3 4 1\n",
"3\n1 3 2\n",
"2\n1 2\n"
] |
[
"4 1 2 3\n",
"1 3 2\n",
"1 2\n"
] |
none
| 500 |
[
{
"input": "4\n2 3 4 1",
"output": "4 1 2 3"
},
{
"input": "3\n1 3 2",
"output": "1 3 2"
},
{
"input": "2\n1 2",
"output": "1 2"
},
{
"input": "1\n1",
"output": "1"
},
{
"input": "10\n1 3 2 6 4 5 7 9 8 10",
"output": "1 3 2 5 6 4 7 9 8 10"
},
{
"input": "5\n5 4 3 2 1",
"output": "5 4 3 2 1"
},
{
"input": "20\n2 1 4 3 6 5 8 7 10 9 12 11 14 13 16 15 18 17 20 19",
"output": "2 1 4 3 6 5 8 7 10 9 12 11 14 13 16 15 18 17 20 19"
},
{
"input": "21\n3 2 1 6 5 4 9 8 7 12 11 10 15 14 13 18 17 16 21 20 19",
"output": "3 2 1 6 5 4 9 8 7 12 11 10 15 14 13 18 17 16 21 20 19"
},
{
"input": "10\n3 4 5 6 7 8 9 10 1 2",
"output": "9 10 1 2 3 4 5 6 7 8"
},
{
"input": "8\n1 5 3 7 2 6 4 8",
"output": "1 5 3 7 2 6 4 8"
},
{
"input": "50\n49 22 4 2 20 46 7 32 5 19 48 24 26 15 45 21 44 11 50 43 39 17 31 1 42 34 3 27 36 25 12 30 13 33 28 35 18 6 8 37 38 14 10 9 29 16 40 23 41 47",
"output": "24 4 27 3 9 38 7 39 44 43 18 31 33 42 14 46 22 37 10 5 16 2 48 12 30 13 28 35 45 32 23 8 34 26 36 29 40 41 21 47 49 25 20 17 15 6 50 11 1 19"
},
{
"input": "34\n13 20 33 30 15 11 27 4 8 2 29 25 24 7 3 22 18 10 26 16 5 1 32 9 34 6 12 14 28 19 31 21 23 17",
"output": "22 10 15 8 21 26 14 9 24 18 6 27 1 28 5 20 34 17 30 2 32 16 33 13 12 19 7 29 11 4 31 23 3 25"
},
{
"input": "92\n23 1 6 4 84 54 44 76 63 34 61 20 48 13 28 78 26 46 90 72 24 55 91 89 53 38 82 5 79 92 29 32 15 64 11 88 60 70 7 66 18 59 8 57 19 16 42 21 80 71 62 27 75 86 36 9 83 73 74 50 43 31 56 30 17 33 40 81 49 12 10 41 22 77 25 68 51 2 47 3 58 69 87 67 39 37 35 65 14 45 52 85",
"output": "2 78 80 4 28 3 39 43 56 71 35 70 14 89 33 46 65 41 45 12 48 73 1 21 75 17 52 15 31 64 62 32 66 10 87 55 86 26 85 67 72 47 61 7 90 18 79 13 69 60 77 91 25 6 22 63 44 81 42 37 11 51 9 34 88 40 84 76 82 38 50 20 58 59 53 8 74 16 29 49 68 27 57 5 92 54 83 36 24 19 23 30"
},
{
"input": "49\n30 24 33 48 7 3 17 2 8 35 10 39 23 40 46 32 18 21 26 22 1 16 47 45 41 28 31 6 12 43 27 11 13 37 19 15 44 5 29 42 4 38 20 34 14 9 25 36 49",
"output": "21 8 6 41 38 28 5 9 46 11 32 29 33 45 36 22 7 17 35 43 18 20 13 2 47 19 31 26 39 1 27 16 3 44 10 48 34 42 12 14 25 40 30 37 24 15 23 4 49"
},
{
"input": "12\n3 8 7 4 6 5 2 1 11 9 10 12",
"output": "8 7 1 4 6 5 3 2 10 11 9 12"
},
{
"input": "78\n16 56 36 78 21 14 9 77 26 57 70 61 41 47 18 44 5 31 50 74 65 52 6 39 22 62 67 69 43 7 64 29 24 40 48 51 73 54 72 12 19 34 4 25 55 33 17 35 23 53 10 8 27 32 42 68 20 63 3 2 1 71 58 46 13 30 49 11 37 66 38 60 28 75 15 59 45 76",
"output": "61 60 59 43 17 23 30 52 7 51 68 40 65 6 75 1 47 15 41 57 5 25 49 33 44 9 53 73 32 66 18 54 46 42 48 3 69 71 24 34 13 55 29 16 77 64 14 35 67 19 36 22 50 38 45 2 10 63 76 72 12 26 58 31 21 70 27 56 28 11 62 39 37 20 74 78 8 4"
},
{
"input": "64\n64 57 40 3 15 8 62 18 33 59 51 19 22 13 4 37 47 45 50 35 63 11 58 42 46 21 7 2 41 48 32 23 28 38 17 12 24 27 49 31 60 6 30 25 61 52 26 54 9 14 29 20 44 39 55 10 34 16 5 56 1 36 53 43",
"output": "61 28 4 15 59 42 27 6 49 56 22 36 14 50 5 58 35 8 12 52 26 13 32 37 44 47 38 33 51 43 40 31 9 57 20 62 16 34 54 3 29 24 64 53 18 25 17 30 39 19 11 46 63 48 55 60 2 23 10 41 45 7 21 1"
},
{
"input": "49\n38 20 49 32 14 41 39 45 25 48 40 19 26 43 34 12 10 3 35 42 5 7 46 47 4 2 13 22 16 24 33 15 11 18 29 31 23 9 44 36 6 17 37 1 30 28 8 21 27",
"output": "44 26 18 25 21 41 22 47 38 17 33 16 27 5 32 29 42 34 12 2 48 28 37 30 9 13 49 46 35 45 36 4 31 15 19 40 43 1 7 11 6 20 14 39 8 23 24 10 3"
},
{
"input": "78\n17 50 30 48 33 12 42 4 18 53 76 67 38 3 20 72 51 55 60 63 46 10 57 45 54 32 24 62 8 11 35 44 65 74 58 28 2 6 56 52 39 23 47 49 61 1 66 41 15 77 7 27 78 13 14 34 5 31 37 21 40 16 29 69 59 43 64 36 70 19 25 73 71 75 9 68 26 22",
"output": "46 37 14 8 57 38 51 29 75 22 30 6 54 55 49 62 1 9 70 15 60 78 42 27 71 77 52 36 63 3 58 26 5 56 31 68 59 13 41 61 48 7 66 32 24 21 43 4 44 2 17 40 10 25 18 39 23 35 65 19 45 28 20 67 33 47 12 76 64 69 73 16 72 34 74 11 50 53"
},
{
"input": "29\n14 21 27 1 4 18 10 17 20 23 2 24 7 9 28 22 8 25 12 15 11 6 16 29 3 26 19 5 13",
"output": "4 11 25 5 28 22 13 17 14 7 21 19 29 1 20 23 8 6 27 9 2 16 10 12 18 26 3 15 24"
},
{
"input": "82\n6 1 10 75 28 66 61 81 78 63 17 19 58 34 49 12 67 50 41 44 3 15 59 38 51 72 36 11 46 29 18 64 27 23 13 53 56 68 2 25 47 40 69 54 42 5 60 55 4 16 24 79 57 20 7 73 32 80 76 52 82 37 26 31 65 8 39 62 33 71 30 9 77 43 48 74 70 22 14 45 35 21",
"output": "2 39 21 49 46 1 55 66 72 3 28 16 35 79 22 50 11 31 12 54 82 78 34 51 40 63 33 5 30 71 64 57 69 14 81 27 62 24 67 42 19 45 74 20 80 29 41 75 15 18 25 60 36 44 48 37 53 13 23 47 7 68 10 32 65 6 17 38 43 77 70 26 56 76 4 59 73 9 52 58 8 61"
},
{
"input": "82\n74 18 15 69 71 77 19 26 80 20 66 7 30 82 22 48 21 44 52 65 64 61 35 49 12 8 53 81 54 16 11 9 40 46 13 1 29 58 5 41 55 4 78 60 6 51 56 2 38 36 34 62 63 25 17 67 45 14 32 37 75 79 10 47 27 39 31 68 59 24 50 43 72 70 42 28 76 23 57 3 73 33",
"output": "36 48 80 42 39 45 12 26 32 63 31 25 35 58 3 30 55 2 7 10 17 15 78 70 54 8 65 76 37 13 67 59 82 51 23 50 60 49 66 33 40 75 72 18 57 34 64 16 24 71 46 19 27 29 41 47 79 38 69 44 22 52 53 21 20 11 56 68 4 74 5 73 81 1 61 77 6 43 62 9 28 14"
},
{
"input": "45\n2 32 34 13 3 15 16 33 22 12 31 38 42 14 27 7 36 8 4 19 45 41 5 35 10 11 39 20 29 44 17 9 6 40 37 28 25 21 1 30 24 18 43 26 23",
"output": "39 1 5 19 23 33 16 18 32 25 26 10 4 14 6 7 31 42 20 28 38 9 45 41 37 44 15 36 29 40 11 2 8 3 24 17 35 12 27 34 22 13 43 30 21"
},
{
"input": "45\n4 32 33 39 43 21 22 35 45 7 14 5 16 9 42 31 24 36 17 29 41 25 37 34 27 20 11 44 3 13 19 2 1 10 26 30 38 18 6 8 15 23 40 28 12",
"output": "33 32 29 1 12 39 10 40 14 34 27 45 30 11 41 13 19 38 31 26 6 7 42 17 22 35 25 44 20 36 16 2 3 24 8 18 23 37 4 43 21 15 5 28 9"
},
{
"input": "74\n48 72 40 67 17 4 27 53 11 32 25 9 74 2 41 24 56 22 14 21 33 5 18 55 20 7 29 36 69 13 52 19 38 30 68 59 66 34 63 6 47 45 54 44 62 12 50 71 16 10 8 64 57 73 46 26 49 42 3 23 35 1 61 39 70 60 65 43 15 28 37 51 58 31",
"output": "62 14 59 6 22 40 26 51 12 50 9 46 30 19 69 49 5 23 32 25 20 18 60 16 11 56 7 70 27 34 74 10 21 38 61 28 71 33 64 3 15 58 68 44 42 55 41 1 57 47 72 31 8 43 24 17 53 73 36 66 63 45 39 52 67 37 4 35 29 65 48 2 54 13"
},
{
"input": "47\n9 26 27 10 6 34 28 42 39 22 45 21 11 43 14 47 38 15 40 32 46 1 36 29 17 25 2 23 31 5 24 4 7 8 12 19 16 44 37 20 18 33 30 13 35 41 3",
"output": "22 27 47 32 30 5 33 34 1 4 13 35 44 15 18 37 25 41 36 40 12 10 28 31 26 2 3 7 24 43 29 20 42 6 45 23 39 17 9 19 46 8 14 38 11 21 16"
},
{
"input": "49\n14 38 6 29 9 49 36 43 47 3 44 20 34 15 7 11 1 28 12 40 16 37 31 10 42 41 33 21 18 30 5 27 17 35 25 26 45 19 2 13 23 32 4 22 46 48 24 39 8",
"output": "17 39 10 43 31 3 15 49 5 24 16 19 40 1 14 21 33 29 38 12 28 44 41 47 35 36 32 18 4 30 23 42 27 13 34 7 22 2 48 20 26 25 8 11 37 45 9 46 6"
},
{
"input": "100\n78 56 31 91 90 95 16 65 58 77 37 89 33 61 10 76 62 47 35 67 69 7 63 83 22 25 49 8 12 30 39 44 57 64 48 42 32 11 70 43 55 50 99 24 85 73 45 14 54 21 98 84 74 2 26 18 9 36 80 53 75 46 66 86 59 93 87 68 94 13 72 28 79 88 92 29 52 82 34 97 19 38 1 41 27 4 40 5 96 100 51 6 20 23 81 15 17 3 60 71",
"output": "83 54 98 86 88 92 22 28 57 15 38 29 70 48 96 7 97 56 81 93 50 25 94 44 26 55 85 72 76 30 3 37 13 79 19 58 11 82 31 87 84 36 40 32 47 62 18 35 27 42 91 77 60 49 41 2 33 9 65 99 14 17 23 34 8 63 20 68 21 39 100 71 46 53 61 16 10 1 73 59 95 78 24 52 45 64 67 74 12 5 4 75 66 69 6 89 80 51 43 90"
},
{
"input": "22\n12 8 11 2 16 7 13 6 22 21 20 10 4 14 18 1 5 15 3 19 17 9",
"output": "16 4 19 13 17 8 6 2 22 12 3 1 7 14 18 5 21 15 20 11 10 9"
},
{
"input": "72\n16 11 49 51 3 27 60 55 23 40 66 7 53 70 13 5 15 32 18 72 33 30 8 31 46 12 28 67 25 38 50 22 69 34 71 52 58 39 24 35 42 9 41 26 62 1 63 65 36 64 68 61 37 14 45 47 6 57 54 20 17 2 56 59 29 10 4 48 21 43 19 44",
"output": "46 62 5 67 16 57 12 23 42 66 2 26 15 54 17 1 61 19 71 60 69 32 9 39 29 44 6 27 65 22 24 18 21 34 40 49 53 30 38 10 43 41 70 72 55 25 56 68 3 31 4 36 13 59 8 63 58 37 64 7 52 45 47 50 48 11 28 51 33 14 35 20"
},
{
"input": "63\n21 56 11 10 62 24 20 42 28 52 38 2 37 43 48 22 7 8 40 14 13 46 53 1 23 4 60 63 51 36 25 12 39 32 49 16 58 44 31 61 33 50 55 54 45 6 47 41 9 57 30 29 26 18 19 27 15 34 3 35 59 5 17",
"output": "24 12 59 26 62 46 17 18 49 4 3 32 21 20 57 36 63 54 55 7 1 16 25 6 31 53 56 9 52 51 39 34 41 58 60 30 13 11 33 19 48 8 14 38 45 22 47 15 35 42 29 10 23 44 43 2 50 37 61 27 40 5 28"
},
{
"input": "18\n2 16 8 4 18 12 3 6 5 9 10 15 11 17 14 13 1 7",
"output": "17 1 7 4 9 8 18 3 10 11 13 6 16 15 12 2 14 5"
},
{
"input": "47\n6 9 10 41 25 3 4 37 20 1 36 22 29 27 11 24 43 31 12 17 34 42 38 39 13 2 7 21 18 5 15 35 44 26 33 46 19 40 30 14 28 23 47 32 45 8 16",
"output": "10 26 6 7 30 1 27 46 2 3 15 19 25 40 31 47 20 29 37 9 28 12 42 16 5 34 14 41 13 39 18 44 35 21 32 11 8 23 24 38 4 22 17 33 45 36 43"
},
{
"input": "96\n41 91 48 88 29 57 1 19 44 43 37 5 10 75 25 63 30 78 76 53 8 92 18 70 39 17 49 60 9 16 3 34 86 59 23 79 55 45 72 51 28 33 96 40 26 54 6 32 89 61 85 74 7 82 52 31 64 66 94 95 11 22 2 73 35 13 42 71 14 47 84 69 50 67 58 12 77 46 38 68 15 36 20 93 27 90 83 56 87 4 21 24 81 62 80 65",
"output": "7 63 31 90 12 47 53 21 29 13 61 76 66 69 81 30 26 23 8 83 91 62 35 92 15 45 85 41 5 17 56 48 42 32 65 82 11 79 25 44 1 67 10 9 38 78 70 3 27 73 40 55 20 46 37 88 6 75 34 28 50 94 16 57 96 58 74 80 72 24 68 39 64 52 14 19 77 18 36 95 93 54 87 71 51 33 89 4 49 86 2 22 84 59 60 43"
},
{
"input": "73\n67 24 39 22 23 20 48 34 42 40 19 70 65 69 64 21 53 11 59 15 26 10 30 33 72 29 55 25 56 71 8 9 57 49 41 61 13 12 6 27 66 36 47 50 73 60 2 37 7 4 51 17 1 46 14 62 35 3 45 63 43 58 54 32 31 5 28 44 18 52 68 38 16",
"output": "53 47 58 50 66 39 49 31 32 22 18 38 37 55 20 73 52 69 11 6 16 4 5 2 28 21 40 67 26 23 65 64 24 8 57 42 48 72 3 10 35 9 61 68 59 54 43 7 34 44 51 70 17 63 27 29 33 62 19 46 36 56 60 15 13 41 1 71 14 12 30 25 45"
},
{
"input": "81\n25 2 78 40 12 80 69 13 49 43 17 33 23 54 32 61 77 66 27 71 24 26 42 55 60 9 5 30 7 37 45 63 53 11 38 44 68 34 28 52 67 22 57 46 47 50 8 16 79 62 4 36 20 14 73 64 6 76 35 74 58 10 29 81 59 31 19 1 75 39 70 18 41 21 72 65 3 48 15 56 51",
"output": "68 2 77 51 27 57 29 47 26 62 34 5 8 54 79 48 11 72 67 53 74 42 13 21 1 22 19 39 63 28 66 15 12 38 59 52 30 35 70 4 73 23 10 36 31 44 45 78 9 46 81 40 33 14 24 80 43 61 65 25 16 50 32 56 76 18 41 37 7 71 20 75 55 60 69 58 17 3 49 6 64"
},
{
"input": "12\n12 3 1 5 11 6 7 10 2 8 9 4",
"output": "3 9 2 12 4 6 7 10 11 8 5 1"
},
{
"input": "47\n7 21 41 18 40 31 12 28 24 14 43 23 33 10 19 38 26 8 34 15 29 44 5 13 39 25 3 27 20 42 35 9 2 1 30 46 36 32 4 22 37 45 6 47 11 16 17",
"output": "34 33 27 39 23 43 1 18 32 14 45 7 24 10 20 46 47 4 15 29 2 40 12 9 26 17 28 8 21 35 6 38 13 19 31 37 41 16 25 5 3 30 11 22 42 36 44"
},
{
"input": "8\n1 3 5 2 4 8 6 7",
"output": "1 4 2 5 3 7 8 6"
},
{
"input": "38\n28 8 2 33 20 32 26 29 23 31 15 38 11 37 18 21 22 19 4 34 1 35 16 7 17 6 27 30 36 12 9 24 25 13 5 3 10 14",
"output": "21 3 36 19 35 26 24 2 31 37 13 30 34 38 11 23 25 15 18 5 16 17 9 32 33 7 27 1 8 28 10 6 4 20 22 29 14 12"
},
{
"input": "10\n2 9 4 6 10 1 7 5 3 8",
"output": "6 1 9 3 8 4 7 10 2 5"
},
{
"input": "23\n20 11 15 1 5 12 23 9 2 22 13 19 16 14 7 4 8 21 6 17 18 10 3",
"output": "4 9 23 16 5 19 15 17 8 22 2 6 11 14 3 13 20 21 12 1 18 10 7"
},
{
"input": "10\n2 4 9 3 6 8 10 5 1 7",
"output": "9 1 4 2 8 5 10 6 3 7"
},
{
"input": "55\n9 48 23 49 11 24 4 22 34 32 17 45 39 13 14 21 19 25 2 31 37 7 55 36 20 51 5 12 54 10 35 40 43 1 46 18 53 41 38 26 29 50 3 42 52 27 8 28 47 33 6 16 30 44 15",
"output": "34 19 43 7 27 51 22 47 1 30 5 28 14 15 55 52 11 36 17 25 16 8 3 6 18 40 46 48 41 53 20 10 50 9 31 24 21 39 13 32 38 44 33 54 12 35 49 2 4 42 26 45 37 29 23"
},
{
"input": "58\n49 13 12 54 2 38 56 11 33 25 26 19 28 8 23 41 20 36 46 55 15 35 9 7 32 37 58 6 3 14 47 31 40 30 53 44 4 50 29 34 10 43 39 57 5 22 27 45 51 42 24 16 18 21 52 17 48 1",
"output": "58 5 29 37 45 28 24 14 23 41 8 3 2 30 21 52 56 53 12 17 54 46 15 51 10 11 47 13 39 34 32 25 9 40 22 18 26 6 43 33 16 50 42 36 48 19 31 57 1 38 49 55 35 4 20 7 44 27"
},
{
"input": "34\n20 25 2 3 33 29 1 16 14 7 21 9 32 31 6 26 22 4 27 23 24 10 34 12 19 15 5 18 28 17 13 8 11 30",
"output": "7 3 4 18 27 15 10 32 12 22 33 24 31 9 26 8 30 28 25 1 11 17 20 21 2 16 19 29 6 34 14 13 5 23"
},
{
"input": "53\n47 29 46 25 23 13 7 31 33 4 38 11 35 16 42 14 15 43 34 39 28 18 6 45 30 1 40 20 2 37 5 32 24 12 44 26 27 3 19 51 36 21 22 9 10 50 41 48 49 53 8 17 52",
"output": "26 29 38 10 31 23 7 51 44 45 12 34 6 16 17 14 52 22 39 28 42 43 5 33 4 36 37 21 2 25 8 32 9 19 13 41 30 11 20 27 47 15 18 35 24 3 1 48 49 46 40 53 50"
},
{
"input": "99\n77 87 90 48 53 38 68 6 28 57 35 82 63 71 60 41 3 12 86 65 10 59 22 67 33 74 93 27 24 1 61 43 25 4 51 52 15 88 9 31 30 42 89 49 23 21 29 32 46 73 37 16 5 69 56 26 92 64 20 54 75 14 98 13 94 2 95 7 36 66 58 8 50 78 84 45 11 96 76 62 97 80 40 39 47 85 34 79 83 17 91 72 19 44 70 81 55 99 18",
"output": "30 66 17 34 53 8 68 72 39 21 77 18 64 62 37 52 90 99 93 59 46 23 45 29 33 56 28 9 47 41 40 48 25 87 11 69 51 6 84 83 16 42 32 94 76 49 85 4 44 73 35 36 5 60 97 55 10 71 22 15 31 80 13 58 20 70 24 7 54 95 14 92 50 26 61 79 1 74 88 82 96 12 89 75 86 19 2 38 43 3 91 57 27 65 67 78 81 63 98"
},
{
"input": "32\n17 29 2 6 30 8 26 7 1 27 10 9 13 24 31 21 15 19 22 18 4 11 25 28 32 3 23 12 5 14 20 16",
"output": "9 3 26 21 29 4 8 6 12 11 22 28 13 30 17 32 1 20 18 31 16 19 27 14 23 7 10 24 2 5 15 25"
},
{
"input": "65\n18 40 1 60 17 19 4 6 12 49 28 58 2 25 13 14 64 56 61 34 62 30 59 51 26 8 33 63 36 48 46 7 43 21 31 27 11 44 29 5 32 23 35 9 53 57 52 50 15 38 42 3 54 65 55 41 20 24 22 47 45 10 39 16 37",
"output": "3 13 52 7 40 8 32 26 44 62 37 9 15 16 49 64 5 1 6 57 34 59 42 58 14 25 36 11 39 22 35 41 27 20 43 29 65 50 63 2 56 51 33 38 61 31 60 30 10 48 24 47 45 53 55 18 46 12 23 4 19 21 28 17 54"
},
{
"input": "71\n35 50 55 58 25 32 26 40 63 34 44 53 24 18 37 7 64 27 56 65 1 19 2 43 42 14 57 47 22 13 59 61 39 67 30 45 54 38 33 48 6 5 3 69 36 21 41 4 16 46 20 17 15 12 10 70 68 23 60 31 52 29 66 28 51 49 62 11 8 9 71",
"output": "21 23 43 48 42 41 16 69 70 55 68 54 30 26 53 49 52 14 22 51 46 29 58 13 5 7 18 64 62 35 60 6 39 10 1 45 15 38 33 8 47 25 24 11 36 50 28 40 66 2 65 61 12 37 3 19 27 4 31 59 32 67 9 17 20 63 34 57 44 56 71"
},
{
"input": "74\n33 8 42 63 64 61 31 74 11 50 68 14 36 25 57 30 7 44 21 15 6 9 23 59 46 3 73 16 62 51 40 60 41 54 5 39 35 28 48 4 58 12 66 69 13 26 71 1 24 19 29 52 37 2 20 43 18 72 17 56 34 38 65 67 27 10 47 70 53 32 45 55 49 22",
"output": "48 54 26 40 35 21 17 2 22 66 9 42 45 12 20 28 59 57 50 55 19 74 23 49 14 46 65 38 51 16 7 70 1 61 37 13 53 62 36 31 33 3 56 18 71 25 67 39 73 10 30 52 69 34 72 60 15 41 24 32 6 29 4 5 63 43 64 11 44 68 47 58 27 8"
},
{
"input": "96\n78 10 82 46 38 91 77 69 2 27 58 80 79 44 59 41 6 31 76 11 42 48 51 37 19 87 43 25 52 32 1 39 63 29 21 65 53 74 92 16 15 95 90 83 30 73 71 5 50 17 96 33 86 60 67 64 20 26 61 40 55 88 94 93 9 72 47 57 14 45 22 3 54 68 13 24 4 7 56 81 89 70 49 8 84 28 18 62 35 36 75 23 66 85 34 12",
"output": "31 9 72 77 48 17 78 84 65 2 20 96 75 69 41 40 50 87 25 57 35 71 92 76 28 58 10 86 34 45 18 30 52 95 89 90 24 5 32 60 16 21 27 14 70 4 67 22 83 49 23 29 37 73 61 79 68 11 15 54 59 88 33 56 36 93 55 74 8 82 47 66 46 38 91 19 7 1 13 12 80 3 44 85 94 53 26 62 81 43 6 39 64 63 42 51"
},
{
"input": "7\n2 1 5 7 3 4 6",
"output": "2 1 5 6 3 7 4"
},
{
"input": "51\n8 33 37 2 16 22 24 30 4 9 5 15 27 3 18 39 31 26 10 17 46 41 25 14 6 1 29 48 36 20 51 49 21 43 19 13 38 50 47 34 11 23 28 12 42 7 32 40 44 45 35",
"output": "26 4 14 9 11 25 46 1 10 19 41 44 36 24 12 5 20 15 35 30 33 6 42 7 23 18 13 43 27 8 17 47 2 40 51 29 3 37 16 48 22 45 34 49 50 21 39 28 32 38 31"
},
{
"input": "27\n12 14 7 3 20 21 25 13 22 15 23 4 2 24 10 17 19 8 26 11 27 18 9 5 6 1 16",
"output": "26 13 4 12 24 25 3 18 23 15 20 1 8 2 10 27 16 22 17 5 6 9 11 14 7 19 21"
},
{
"input": "71\n51 13 20 48 54 23 24 64 14 62 71 67 57 53 3 30 55 43 33 25 39 40 66 6 46 18 5 19 61 16 32 68 70 41 60 44 29 49 27 69 50 38 10 17 45 56 9 21 26 63 28 35 7 59 1 65 2 15 8 11 12 34 37 47 58 22 31 4 36 42 52",
"output": "55 57 15 68 27 24 53 59 47 43 60 61 2 9 58 30 44 26 28 3 48 66 6 7 20 49 39 51 37 16 67 31 19 62 52 69 63 42 21 22 34 70 18 36 45 25 64 4 38 41 1 71 14 5 17 46 13 65 54 35 29 10 50 8 56 23 12 32 40 33 11"
},
{
"input": "9\n8 5 2 6 1 9 4 7 3",
"output": "5 3 9 7 2 4 8 1 6"
},
{
"input": "29\n10 24 11 5 26 25 2 9 22 15 8 14 29 21 4 1 23 17 3 12 13 16 18 28 19 20 7 6 27",
"output": "16 7 19 15 4 28 27 11 8 1 3 20 21 12 10 22 18 23 25 26 14 9 17 2 6 5 29 24 13"
},
{
"input": "60\n39 25 42 4 55 60 16 18 47 1 11 40 7 50 19 35 49 54 12 3 30 38 2 58 17 26 45 6 33 43 37 32 52 36 15 23 27 59 24 20 28 14 8 9 13 29 44 46 41 21 5 48 51 22 31 56 57 53 10 34",
"output": "10 23 20 4 51 28 13 43 44 59 11 19 45 42 35 7 25 8 15 40 50 54 36 39 2 26 37 41 46 21 55 32 29 60 16 34 31 22 1 12 49 3 30 47 27 48 9 52 17 14 53 33 58 18 5 56 57 24 38 6"
},
{
"input": "50\n37 45 22 5 12 21 28 24 18 47 20 25 8 50 14 2 34 43 11 16 49 41 48 1 19 31 39 46 32 23 15 42 3 35 38 30 44 26 10 9 40 36 7 17 33 4 27 6 13 29",
"output": "24 16 33 46 4 48 43 13 40 39 19 5 49 15 31 20 44 9 25 11 6 3 30 8 12 38 47 7 50 36 26 29 45 17 34 42 1 35 27 41 22 32 18 37 2 28 10 23 21 14"
},
{
"input": "30\n8 29 28 16 17 25 27 15 21 11 6 20 2 13 1 30 5 4 24 10 14 3 23 18 26 9 12 22 19 7",
"output": "15 13 22 18 17 11 30 1 26 20 10 27 14 21 8 4 5 24 29 12 9 28 23 19 6 25 7 3 2 16"
},
{
"input": "46\n15 2 44 43 38 19 31 42 4 37 29 30 24 45 27 41 8 20 33 7 35 3 18 46 36 26 1 28 21 40 16 22 32 11 14 13 12 9 25 39 10 6 23 17 5 34",
"output": "27 2 22 9 45 42 20 17 38 41 34 37 36 35 1 31 44 23 6 18 29 32 43 13 39 26 15 28 11 12 7 33 19 46 21 25 10 5 40 30 16 8 4 3 14 24"
},
{
"input": "9\n4 8 6 5 3 9 2 7 1",
"output": "9 7 5 1 4 3 8 2 6"
},
{
"input": "46\n31 30 33 23 45 7 36 8 11 3 32 39 41 20 1 28 6 27 18 24 17 5 16 37 26 13 22 14 2 38 15 46 9 4 19 21 12 44 10 35 25 34 42 43 40 29",
"output": "15 29 10 34 22 17 6 8 33 39 9 37 26 28 31 23 21 19 35 14 36 27 4 20 41 25 18 16 46 2 1 11 3 42 40 7 24 30 12 45 13 43 44 38 5 32"
},
{
"input": "66\n27 12 37 48 46 21 34 58 38 28 66 2 64 32 44 31 13 36 40 15 19 11 22 5 30 29 6 7 61 39 20 42 23 54 51 33 50 9 60 8 57 45 49 10 62 41 59 3 55 63 52 24 25 26 43 56 65 4 16 14 1 35 18 17 53 47",
"output": "61 12 48 58 24 27 28 40 38 44 22 2 17 60 20 59 64 63 21 31 6 23 33 52 53 54 1 10 26 25 16 14 36 7 62 18 3 9 30 19 46 32 55 15 42 5 66 4 43 37 35 51 65 34 49 56 41 8 47 39 29 45 50 13 57 11"
},
{
"input": "13\n3 12 9 2 8 5 13 4 11 1 10 7 6",
"output": "10 4 1 8 6 13 12 5 3 11 9 2 7"
},
{
"input": "80\n21 25 56 50 20 61 7 74 51 69 8 2 46 57 45 71 14 52 17 43 9 30 70 78 31 10 38 13 23 15 37 79 6 16 77 73 80 4 49 48 18 28 26 58 33 41 64 22 54 72 59 60 40 63 53 27 1 5 75 67 62 34 19 39 68 65 44 55 3 32 11 42 76 12 35 47 66 36 24 29",
"output": "57 12 69 38 58 33 7 11 21 26 71 74 28 17 30 34 19 41 63 5 1 48 29 79 2 43 56 42 80 22 25 70 45 62 75 78 31 27 64 53 46 72 20 67 15 13 76 40 39 4 9 18 55 49 68 3 14 44 51 52 6 61 54 47 66 77 60 65 10 23 16 50 36 8 59 73 35 24 32 37"
},
{
"input": "63\n9 49 53 25 40 46 43 51 54 22 58 16 23 26 10 47 5 27 2 8 61 59 19 35 63 56 28 20 34 4 62 38 6 55 36 31 57 15 29 33 1 48 50 37 7 30 18 42 32 52 12 41 14 21 45 11 24 17 39 13 44 60 3",
"output": "41 19 63 30 17 33 45 20 1 15 56 51 60 53 38 12 58 47 23 28 54 10 13 57 4 14 18 27 39 46 36 49 40 29 24 35 44 32 59 5 52 48 7 61 55 6 16 42 2 43 8 50 3 9 34 26 37 11 22 62 21 31 25"
},
{
"input": "26\n11 4 19 13 17 9 2 24 6 5 22 23 14 15 3 25 16 8 18 10 21 1 12 26 7 20",
"output": "22 7 15 2 10 9 25 18 6 20 1 23 4 13 14 17 5 19 3 26 21 11 12 8 16 24"
},
{
"input": "69\n40 22 11 66 4 27 31 29 64 53 37 55 51 2 7 36 18 52 6 1 30 21 17 20 14 9 59 62 49 68 3 50 65 57 44 5 67 46 33 13 34 15 24 48 63 58 38 25 41 35 16 54 32 10 60 61 39 12 69 8 23 45 26 47 56 43 28 19 42",
"output": "20 14 31 5 36 19 15 60 26 54 3 58 40 25 42 51 23 17 68 24 22 2 61 43 48 63 6 67 8 21 7 53 39 41 50 16 11 47 57 1 49 69 66 35 62 38 64 44 29 32 13 18 10 52 12 65 34 46 27 55 56 28 45 9 33 4 37 30 59"
},
{
"input": "6\n4 3 6 5 1 2",
"output": "5 6 2 1 4 3"
},
{
"input": "9\n7 8 5 3 1 4 2 9 6",
"output": "5 7 4 6 3 9 1 2 8"
},
{
"input": "41\n27 24 16 30 25 8 32 2 26 20 39 33 41 22 40 14 36 9 28 4 34 11 31 23 19 18 17 35 3 10 6 13 5 15 29 38 7 21 1 12 37",
"output": "39 8 29 20 33 31 37 6 18 30 22 40 32 16 34 3 27 26 25 10 38 14 24 2 5 9 1 19 35 4 23 7 12 21 28 17 41 36 11 15 13"
},
{
"input": "1\n1",
"output": "1"
},
{
"input": "20\n2 6 4 18 7 10 17 13 16 8 14 9 20 5 19 12 1 3 15 11",
"output": "17 1 18 3 14 2 5 10 12 6 20 16 8 11 19 9 7 4 15 13"
},
{
"input": "2\n2 1",
"output": "2 1"
},
{
"input": "60\n2 4 31 51 11 7 34 20 3 14 18 23 48 54 15 36 38 60 49 40 5 33 41 26 55 58 10 8 13 9 27 30 37 1 21 59 44 57 35 19 46 43 42 45 12 22 39 32 24 16 6 56 53 52 25 17 47 29 50 28",
"output": "34 1 9 2 21 51 6 28 30 27 5 45 29 10 15 50 56 11 40 8 35 46 12 49 55 24 31 60 58 32 3 48 22 7 39 16 33 17 47 20 23 43 42 37 44 41 57 13 19 59 4 54 53 14 25 52 38 26 36 18"
},
{
"input": "14\n14 6 3 12 11 2 7 1 10 9 8 5 4 13",
"output": "8 6 3 13 12 2 7 11 10 9 5 4 14 1"
},
{
"input": "81\n13 43 79 8 7 21 73 46 63 4 62 78 56 11 70 68 61 53 60 49 16 27 59 47 69 5 22 44 77 57 52 48 1 9 72 81 28 55 58 33 51 18 31 17 41 20 42 3 32 54 19 2 75 34 64 10 65 50 30 29 67 12 71 66 74 15 26 23 6 38 25 35 37 24 80 76 40 45 39 36 14",
"output": "33 52 48 10 26 69 5 4 34 56 14 62 1 81 66 21 44 42 51 46 6 27 68 74 71 67 22 37 60 59 43 49 40 54 72 80 73 70 79 77 45 47 2 28 78 8 24 32 20 58 41 31 18 50 38 13 30 39 23 19 17 11 9 55 57 64 61 16 25 15 63 35 7 65 53 76 29 12 3 75 36"
},
{
"input": "42\n41 11 10 8 21 37 32 19 31 25 1 15 36 5 6 27 4 3 13 7 16 17 2 23 34 24 38 28 12 20 30 42 18 26 39 35 33 40 9 14 22 29",
"output": "11 23 18 17 14 15 20 4 39 3 2 29 19 40 12 21 22 33 8 30 5 41 24 26 10 34 16 28 42 31 9 7 37 25 36 13 6 27 35 38 1 32"
},
{
"input": "97\n20 6 76 42 4 18 35 59 39 63 27 7 66 47 61 52 15 36 88 93 19 33 10 92 1 34 46 86 78 57 51 94 77 29 26 73 41 2 58 97 43 65 17 74 21 49 25 3 91 82 95 12 96 13 84 90 69 24 72 37 16 55 54 71 64 62 48 89 11 70 80 67 30 40 44 85 53 83 79 9 56 45 75 87 22 14 81 68 8 38 60 50 28 23 31 32 5",
"output": "25 38 48 5 97 2 12 89 80 23 69 52 54 86 17 61 43 6 21 1 45 85 94 58 47 35 11 93 34 73 95 96 22 26 7 18 60 90 9 74 37 4 41 75 82 27 14 67 46 92 31 16 77 63 62 81 30 39 8 91 15 66 10 65 42 13 72 88 57 70 64 59 36 44 83 3 33 29 79 71 87 50 78 55 76 28 84 19 68 56 49 24 20 32 51 53 40"
},
{
"input": "62\n15 27 46 6 8 51 14 56 23 48 42 49 52 22 20 31 29 12 47 3 62 34 37 35 32 57 19 25 5 60 61 38 18 10 11 55 45 53 17 30 9 36 4 50 41 16 44 28 40 59 24 1 13 39 26 7 33 58 2 43 21 54",
"output": "52 59 20 43 29 4 56 5 41 34 35 18 53 7 1 46 39 33 27 15 61 14 9 51 28 55 2 48 17 40 16 25 57 22 24 42 23 32 54 49 45 11 60 47 37 3 19 10 12 44 6 13 38 62 36 8 26 58 50 30 31 21"
},
{
"input": "61\n35 27 4 61 52 32 41 46 14 37 17 54 55 31 11 26 44 49 15 30 9 50 45 39 7 38 53 3 58 40 13 56 18 19 28 6 43 5 21 42 20 34 2 25 36 12 33 57 16 60 1 8 59 10 22 23 24 48 51 47 29",
"output": "51 43 28 3 38 36 25 52 21 54 15 46 31 9 19 49 11 33 34 41 39 55 56 57 44 16 2 35 61 20 14 6 47 42 1 45 10 26 24 30 7 40 37 17 23 8 60 58 18 22 59 5 27 12 13 32 48 29 53 50 4"
},
{
"input": "59\n31 26 36 15 17 19 10 53 11 34 13 46 55 9 44 7 8 37 32 52 47 25 51 22 35 39 41 4 43 24 5 27 20 57 6 38 3 28 21 40 50 18 14 56 33 45 12 2 49 59 54 29 16 48 42 58 1 30 23",
"output": "57 48 37 28 31 35 16 17 14 7 9 47 11 43 4 53 5 42 6 33 39 24 59 30 22 2 32 38 52 58 1 19 45 10 25 3 18 36 26 40 27 55 29 15 46 12 21 54 49 41 23 20 8 51 13 44 34 56 50"
},
{
"input": "10\n2 10 7 4 1 5 8 6 3 9",
"output": "5 1 9 4 6 8 3 7 10 2"
},
{
"input": "14\n14 2 1 8 6 12 11 10 9 7 3 4 5 13",
"output": "3 2 11 12 13 5 10 4 9 8 7 6 14 1"
},
{
"input": "43\n28 38 15 14 31 42 27 30 19 33 43 26 22 29 18 32 3 13 1 8 35 34 4 12 11 17 41 21 5 25 39 37 20 23 7 24 16 10 40 9 6 36 2",
"output": "19 43 17 23 29 41 35 20 40 38 25 24 18 4 3 37 26 15 9 33 28 13 34 36 30 12 7 1 14 8 5 16 10 22 21 42 32 2 31 39 27 6 11"
},
{
"input": "86\n39 11 20 31 28 76 29 64 35 21 41 71 12 82 5 37 80 73 38 26 79 75 23 15 59 45 47 6 3 62 50 49 51 22 2 65 86 60 70 42 74 17 1 30 55 44 8 66 81 27 57 77 43 13 54 32 72 46 48 56 14 34 78 52 36 85 24 19 69 83 25 61 7 4 84 33 63 58 18 40 68 10 67 9 16 53",
"output": "43 35 29 74 15 28 73 47 84 82 2 13 54 61 24 85 42 79 68 3 10 34 23 67 71 20 50 5 7 44 4 56 76 62 9 65 16 19 1 80 11 40 53 46 26 58 27 59 32 31 33 64 86 55 45 60 51 78 25 38 72 30 77 8 36 48 83 81 69 39 12 57 18 41 22 6 52 63 21 17 49 14 70 75 66 37"
},
{
"input": "99\n65 78 56 98 33 24 61 40 29 93 1 64 57 22 25 52 67 95 50 3 31 15 90 68 71 83 38 36 6 46 89 26 4 87 14 88 72 37 23 43 63 12 80 96 5 34 73 86 9 48 92 62 99 10 16 20 66 27 28 2 82 70 30 94 49 8 84 69 18 60 58 59 44 39 21 7 91 76 54 19 75 85 74 47 55 32 97 77 51 13 35 79 45 42 11 41 17 81 53",
"output": "11 60 20 33 45 29 76 66 49 54 95 42 90 35 22 55 97 69 80 56 75 14 39 6 15 32 58 59 9 63 21 86 5 46 91 28 38 27 74 8 96 94 40 73 93 30 84 50 65 19 89 16 99 79 85 3 13 71 72 70 7 52 41 12 1 57 17 24 68 62 25 37 47 83 81 78 88 2 92 43 98 61 26 67 82 48 34 36 31 23 77 51 10 64 18 44 87 4 53"
},
{
"input": "100\n42 23 48 88 36 6 18 70 96 1 34 40 46 22 39 55 85 93 45 67 71 75 59 9 21 3 86 63 65 68 20 38 73 31 84 90 50 51 56 95 72 33 49 19 83 76 54 74 100 30 17 98 15 94 4 97 5 99 81 27 92 32 89 12 13 91 87 29 60 11 52 43 35 58 10 25 16 80 28 2 44 61 8 82 66 69 41 24 57 62 78 37 79 77 53 7 14 47 26 64",
"output": "10 80 26 55 57 6 96 83 24 75 70 64 65 97 53 77 51 7 44 31 25 14 2 88 76 99 60 79 68 50 34 62 42 11 73 5 92 32 15 12 87 1 72 81 19 13 98 3 43 37 38 71 95 47 16 39 89 74 23 69 82 90 28 100 29 85 20 30 86 8 21 41 33 48 22 46 94 91 93 78 59 84 45 35 17 27 67 4 63 36 66 61 18 54 40 9 56 52 58 49"
},
{
"input": "99\n8 68 94 75 71 60 57 58 6 11 5 48 65 41 49 12 46 72 95 59 13 70 74 7 84 62 17 36 55 76 38 79 2 85 23 10 32 99 87 50 83 28 54 91 53 51 1 3 97 81 21 89 93 78 61 26 82 96 4 98 25 40 31 44 24 47 30 52 14 16 39 27 9 29 45 18 67 63 37 43 90 66 19 69 88 22 92 77 34 42 73 80 56 64 20 35 15 33 86",
"output": "47 33 48 59 11 9 24 1 73 36 10 16 21 69 97 70 27 76 83 95 51 86 35 65 61 56 72 42 74 67 63 37 98 89 96 28 79 31 71 62 14 90 80 64 75 17 66 12 15 40 46 68 45 43 29 93 7 8 20 6 55 26 78 94 13 82 77 2 84 22 5 18 91 23 4 30 88 54 32 92 50 57 41 25 34 99 39 85 52 81 44 87 53 3 19 58 49 60 38"
},
{
"input": "99\n12 99 88 13 7 19 74 47 23 90 16 29 26 11 58 60 64 98 37 18 82 67 72 46 51 85 17 92 87 20 77 36 78 71 57 35 80 54 73 15 14 62 97 45 31 79 94 56 76 96 28 63 8 44 38 86 49 2 52 66 61 59 10 43 55 50 22 34 83 53 95 40 81 21 30 42 27 3 5 41 1 70 69 25 93 48 65 6 24 89 91 33 39 68 9 4 32 84 75",
"output": "81 58 78 96 79 88 5 53 95 63 14 1 4 41 40 11 27 20 6 30 74 67 9 89 84 13 77 51 12 75 45 97 92 68 36 32 19 55 93 72 80 76 64 54 44 24 8 86 57 66 25 59 70 38 65 48 35 15 62 16 61 42 52 17 87 60 22 94 83 82 34 23 39 7 99 49 31 33 46 37 73 21 69 98 26 56 29 3 90 10 91 28 85 47 71 50 43 18 2"
},
{
"input": "99\n20 79 26 75 99 69 98 47 93 62 18 42 43 38 90 66 67 8 13 84 76 58 81 60 64 46 56 23 78 17 86 36 19 52 85 39 48 27 96 49 37 95 5 31 10 24 12 1 80 35 92 33 16 68 57 54 32 29 45 88 72 77 4 87 97 89 59 3 21 22 61 94 83 15 44 34 70 91 55 9 51 50 73 11 14 6 40 7 63 25 2 82 41 65 28 74 71 30 53",
"output": "48 91 68 63 43 86 88 18 80 45 84 47 19 85 74 53 30 11 33 1 69 70 28 46 90 3 38 95 58 98 44 57 52 76 50 32 41 14 36 87 93 12 13 75 59 26 8 37 40 82 81 34 99 56 79 27 55 22 67 24 71 10 89 25 94 16 17 54 6 77 97 61 83 96 4 21 62 29 2 49 23 92 73 20 35 31 64 60 66 15 78 51 9 72 42 39 65 7 5"
},
{
"input": "99\n74 20 9 1 60 85 65 13 4 25 40 99 5 53 64 3 36 31 73 44 55 50 45 63 98 51 68 6 47 37 71 82 88 34 84 18 19 12 93 58 86 7 11 46 90 17 33 27 81 69 42 59 56 32 95 52 76 61 96 62 78 43 66 21 49 97 75 14 41 72 89 16 30 79 22 23 15 83 91 38 48 2 87 26 28 80 94 70 54 92 57 10 8 35 67 77 29 24 39",
"output": "4 82 16 9 13 28 42 93 3 92 43 38 8 68 77 72 46 36 37 2 64 75 76 98 10 84 48 85 97 73 18 54 47 34 94 17 30 80 99 11 69 51 62 20 23 44 29 81 65 22 26 56 14 89 21 53 91 40 52 5 58 60 24 15 7 63 95 27 50 88 31 70 19 1 67 57 96 61 74 86 49 32 78 35 6 41 83 33 71 45 79 90 39 87 55 59 66 25 12"
},
{
"input": "99\n50 94 2 18 69 90 59 83 75 68 77 97 39 78 25 7 16 9 49 4 42 89 44 48 17 96 61 70 3 10 5 81 56 57 88 6 98 1 46 67 92 37 11 30 85 41 8 36 51 29 20 71 19 79 74 93 43 34 55 40 38 21 64 63 32 24 72 14 12 86 82 15 65 23 66 22 28 53 13 26 95 99 91 52 76 27 60 45 47 33 73 84 31 35 54 80 58 62 87",
"output": "38 3 29 20 31 36 16 47 18 30 43 69 79 68 72 17 25 4 53 51 62 76 74 66 15 80 86 77 50 44 93 65 90 58 94 48 42 61 13 60 46 21 57 23 88 39 89 24 19 1 49 84 78 95 59 33 34 97 7 87 27 98 64 63 73 75 40 10 5 28 52 67 91 55 9 85 11 14 54 96 32 71 8 92 45 70 99 35 22 6 83 41 56 2 81 26 12 37 82"
},
{
"input": "99\n19 93 14 34 39 37 33 15 52 88 7 43 69 27 9 77 94 31 48 22 63 70 79 17 50 6 81 8 76 58 23 74 86 11 57 62 41 87 75 51 12 18 68 56 95 3 80 83 84 29 24 61 71 78 59 96 20 85 90 28 45 36 38 97 1 49 40 98 44 67 13 73 72 91 47 10 30 54 35 42 4 2 92 26 64 60 53 21 5 82 46 32 55 66 16 89 99 65 25",
"output": "65 82 46 81 89 26 11 28 15 76 34 41 71 3 8 95 24 42 1 57 88 20 31 51 99 84 14 60 50 77 18 92 7 4 79 62 6 63 5 67 37 80 12 69 61 91 75 19 66 25 40 9 87 78 93 44 35 30 55 86 52 36 21 85 98 94 70 43 13 22 53 73 72 32 39 29 16 54 23 47 27 90 48 49 58 33 38 10 96 59 74 83 2 17 45 56 64 68 97"
},
{
"input": "99\n86 25 50 51 62 39 41 67 44 20 45 14 80 88 66 7 36 59 13 84 78 58 96 75 2 43 48 47 69 12 19 98 22 38 28 55 11 76 68 46 53 70 85 34 16 33 91 30 8 40 74 60 94 82 87 32 37 4 5 10 89 73 90 29 35 26 23 57 27 65 24 3 9 83 77 72 6 31 15 92 93 79 64 18 63 42 56 1 52 97 17 81 71 21 49 99 54 95 61",
"output": "88 25 72 58 59 77 16 49 73 60 37 30 19 12 79 45 91 84 31 10 94 33 67 71 2 66 69 35 64 48 78 56 46 44 65 17 57 34 6 50 7 86 26 9 11 40 28 27 95 3 4 89 41 97 36 87 68 22 18 52 99 5 85 83 70 15 8 39 29 42 93 76 62 51 24 38 75 21 82 13 92 54 74 20 43 1 55 14 61 63 47 80 81 53 98 23 90 32 96"
},
{
"input": "100\n66 44 99 15 43 79 28 33 88 90 49 68 82 38 9 74 4 58 29 81 31 94 10 42 89 21 63 40 62 61 18 6 84 72 48 25 67 69 71 85 98 34 83 70 65 78 91 77 93 41 23 24 87 11 55 12 59 73 36 97 7 14 26 39 30 27 45 20 50 17 53 2 57 47 95 56 75 19 37 96 16 35 8 3 76 60 13 86 5 32 64 80 46 51 54 100 1 22 52 92",
"output": "97 72 84 17 89 32 61 83 15 23 54 56 87 62 4 81 70 31 78 68 26 98 51 52 36 63 66 7 19 65 21 90 8 42 82 59 79 14 64 28 50 24 5 2 67 93 74 35 11 69 94 99 71 95 55 76 73 18 57 86 30 29 27 91 45 1 37 12 38 44 39 34 58 16 77 85 48 46 6 92 20 13 43 33 40 88 53 9 25 10 47 100 49 22 75 80 60 41 3 96"
},
{
"input": "99\n3 73 32 37 25 15 93 63 85 8 91 78 80 5 39 48 46 7 83 70 23 96 9 29 77 53 30 20 56 50 13 45 21 76 87 99 65 31 16 18 14 72 51 28 43 2 81 34 38 40 66 54 74 26 71 4 61 17 58 24 22 33 49 36 42 11 12 55 60 27 62 90 79 92 94 68 1 52 84 41 86 35 69 75 47 10 64 88 97 98 67 19 89 95 59 82 57 44 6",
"output": "77 46 1 56 14 99 18 10 23 86 66 67 31 41 6 39 58 40 92 28 33 61 21 60 5 54 70 44 24 27 38 3 62 48 82 64 4 49 15 50 80 65 45 98 32 17 85 16 63 30 43 78 26 52 68 29 97 59 95 69 57 71 8 87 37 51 91 76 83 20 55 42 2 53 84 34 25 12 73 13 47 96 19 79 9 81 35 88 93 72 11 74 7 75 94 22 89 90 36"
},
{
"input": "100\n100 99 98 97 96 95 94 93 92 91 90 89 88 87 86 85 84 83 82 81 80 79 78 77 76 75 74 73 72 71 70 69 68 67 66 65 64 63 62 61 60 59 58 57 56 55 54 53 52 51 50 49 48 47 46 45 44 43 42 41 40 39 38 37 36 35 34 33 32 31 30 29 28 27 26 25 24 23 22 21 20 19 18 17 16 15 14 13 12 11 10 9 8 7 6 5 4 3 2 1",
"output": "100 99 98 97 96 95 94 93 92 91 90 89 88 87 86 85 84 83 82 81 80 79 78 77 76 75 74 73 72 71 70 69 68 67 66 65 64 63 62 61 60 59 58 57 56 55 54 53 52 51 50 49 48 47 46 45 44 43 42 41 40 39 38 37 36 35 34 33 32 31 30 29 28 27 26 25 24 23 22 21 20 19 18 17 16 15 14 13 12 11 10 9 8 7 6 5 4 3 2 1"
}
] | 1,687,397,266 | 2,147,483,647 |
Python 3
|
OK
|
TESTS
| 101 | 92 | 0 |
from sys import stdin,stdout
n = int(input())
a = list(map(int,stdin.readline().split()))
b = [0]*n
for i in range(n):
b[a[i]-1] = i+1
for i in b:
print(i,end=" ")
|
Title: Presents
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Little Petya very much likes gifts. Recently he has received a new laptop as a New Year gift from his mother. He immediately decided to give it to somebody else as what can be more pleasant than giving somebody gifts. And on this occasion he organized a New Year party at his place and invited *n* his friends there.
If there's one thing Petya likes more that receiving gifts, that's watching others giving gifts to somebody else. Thus, he safely hid the laptop until the next New Year and made up his mind to watch his friends exchanging gifts while he does not participate in the process. He numbered all his friends with integers from 1 to *n*. Petya remembered that a friend number *i* gave a gift to a friend number *p**i*. He also remembered that each of his friends received exactly one gift.
Now Petya wants to know for each friend *i* the number of a friend who has given him a gift.
Input Specification:
The first line contains one integer *n* (1<=≤<=*n*<=≤<=100) — the quantity of friends Petya invited to the party. The second line contains *n* space-separated integers: the *i*-th number is *p**i* — the number of a friend who gave a gift to friend number *i*. It is guaranteed that each friend received exactly one gift. It is possible that some friends do not share Petya's ideas of giving gifts to somebody else. Those friends gave the gifts to themselves.
Output Specification:
Print *n* space-separated integers: the *i*-th number should equal the number of the friend who gave a gift to friend number *i*.
Demo Input:
['4\n2 3 4 1\n', '3\n1 3 2\n', '2\n1 2\n']
Demo Output:
['4 1 2 3\n', '1 3 2\n', '1 2\n']
Note:
none
|
```python
from sys import stdin,stdout
n = int(input())
a = list(map(int,stdin.readline().split()))
b = [0]*n
for i in range(n):
b[a[i]-1] = i+1
for i in b:
print(i,end=" ")
```
| 3 |
|
508 |
B
|
Anton and currency you all know
|
PROGRAMMING
| 1,300 |
[
"greedy",
"math",
"strings"
] | null | null |
Berland, 2016. The exchange rate of currency you all know against the burle has increased so much that to simplify the calculations, its fractional part was neglected and the exchange rate is now assumed to be an integer.
Reliable sources have informed the financier Anton of some information about the exchange rate of currency you all know against the burle for tomorrow. Now Anton knows that tomorrow the exchange rate will be an even number, which can be obtained from the present rate by swapping exactly two distinct digits in it. Of all the possible values that meet these conditions, the exchange rate for tomorrow will be the maximum possible. It is guaranteed that today the exchange rate is an odd positive integer *n*. Help Anton to determine the exchange rate of currency you all know for tomorrow!
|
The first line contains an odd positive integer *n* — the exchange rate of currency you all know for today. The length of number *n*'s representation is within range from 2 to 105, inclusive. The representation of *n* doesn't contain any leading zeroes.
|
If the information about tomorrow's exchange rate is inconsistent, that is, there is no integer that meets the condition, print <=-<=1.
Otherwise, print the exchange rate of currency you all know against the burle for tomorrow. This should be the maximum possible number of those that are even and that are obtained from today's exchange rate by swapping exactly two digits. Exchange rate representation should not contain leading zeroes.
|
[
"527\n",
"4573\n",
"1357997531\n"
] |
[
"572\n",
"3574\n",
"-1\n"
] |
none
| 1,000 |
[
{
"input": "527",
"output": "572"
},
{
"input": "4573",
"output": "3574"
},
{
"input": "1357997531",
"output": "-1"
},
{
"input": "444443",
"output": "444434"
},
{
"input": "22227",
"output": "72222"
},
{
"input": "24683",
"output": "34682"
},
{
"input": "11",
"output": "-1"
},
{
"input": "1435678543",
"output": "1435678534"
},
{
"input": "4250769",
"output": "9250764"
},
{
"input": "4052769",
"output": "9052764"
},
{
"input": "5685341",
"output": "5685314"
},
{
"input": "1111111111111111231",
"output": "1111111111111111132"
},
{
"input": "333333332379",
"output": "333333339372"
},
{
"input": "85",
"output": "58"
},
{
"input": "7700016673",
"output": "7730016670"
},
{
"input": "35451519805848712272404365322858764249299938505103",
"output": "35451519835848712272404365322858764249299938505100"
},
{
"input": "4314752277691991627730686134692292422155753465948025897701703862445837045929984759093775762579123919",
"output": "9314752277691991627730686134692292422155753465948025897701703862445837045929984759093775762579123914"
},
{
"input": "21",
"output": "12"
},
{
"input": "101",
"output": "110"
},
{
"input": "503147",
"output": "573140"
},
{
"input": "333333333333333333333",
"output": "-1"
},
{
"input": "55555555555555555555555",
"output": "-1"
},
{
"input": "99",
"output": "-1"
},
{
"input": "23759",
"output": "93752"
},
{
"input": "235749",
"output": "935742"
},
{
"input": "435729",
"output": "935724"
},
{
"input": "8623",
"output": "8632"
},
{
"input": "109",
"output": "190"
},
{
"input": "20000000000000000000001",
"output": "21000000000000000000000"
},
{
"input": "1001",
"output": "1100"
}
] | 1,689,804,016 | 2,147,483,647 |
Python 3
|
WRONG_ANSWER
|
TESTS
| 4 | 31 | 102,400 |
entrada=input()
pares_posicion=[]
registro=[]
numero=[]
i=0
for escaner in entrada:
if int(escaner)%2==0:
numero.append(int(escaner))
pares_posicion.append(int(escaner))
pares_posicion.append(i)
registro.append(pares_posicion)
pares_posicion=[]
i+=1
else:
numero.append(int(escaner))
i+=1
if registro==[]:
print("-1")
else:
registro.sort()
registro.reverse()
super_general=[]
temporal=[]
dejar=[]
for mirar in registro:
dejar=numero
cambio=dejar[-1]
seleccionado= mirar[0]
dejar[mirar[1]]=cambio
dejar[-1]=seleccionado
finalista=""
contador=0
while contador<=len(dejar)-1:
finalista= finalista + str(dejar[contador])
contador+=1
temporal.append(int(finalista))
temporal.append(int(mirar[1]))
super_general.append(temporal)
temporal=[]
super_general.sort()
unico=[]
final_registro=[]
veces=0
for seleccion in super_general:
if seleccion[0]==super_general[0][0]:
unico.append(seleccion[1])
unico.append(seleccion[0])
final_registro.append(unico)
unico=[]
veces+=1
if veces >1:
final_registro.sort()
maximo_par=final_registro[0][1]
print(maximo_par)
else:
final_registro.sort()
maximo_par = final_registro[0][1]
print(maximo_par)
|
Title: Anton and currency you all know
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Berland, 2016. The exchange rate of currency you all know against the burle has increased so much that to simplify the calculations, its fractional part was neglected and the exchange rate is now assumed to be an integer.
Reliable sources have informed the financier Anton of some information about the exchange rate of currency you all know against the burle for tomorrow. Now Anton knows that tomorrow the exchange rate will be an even number, which can be obtained from the present rate by swapping exactly two distinct digits in it. Of all the possible values that meet these conditions, the exchange rate for tomorrow will be the maximum possible. It is guaranteed that today the exchange rate is an odd positive integer *n*. Help Anton to determine the exchange rate of currency you all know for tomorrow!
Input Specification:
The first line contains an odd positive integer *n* — the exchange rate of currency you all know for today. The length of number *n*'s representation is within range from 2 to 105, inclusive. The representation of *n* doesn't contain any leading zeroes.
Output Specification:
If the information about tomorrow's exchange rate is inconsistent, that is, there is no integer that meets the condition, print <=-<=1.
Otherwise, print the exchange rate of currency you all know against the burle for tomorrow. This should be the maximum possible number of those that are even and that are obtained from today's exchange rate by swapping exactly two digits. Exchange rate representation should not contain leading zeroes.
Demo Input:
['527\n', '4573\n', '1357997531\n']
Demo Output:
['572\n', '3574\n', '-1\n']
Note:
none
|
```python
entrada=input()
pares_posicion=[]
registro=[]
numero=[]
i=0
for escaner in entrada:
if int(escaner)%2==0:
numero.append(int(escaner))
pares_posicion.append(int(escaner))
pares_posicion.append(i)
registro.append(pares_posicion)
pares_posicion=[]
i+=1
else:
numero.append(int(escaner))
i+=1
if registro==[]:
print("-1")
else:
registro.sort()
registro.reverse()
super_general=[]
temporal=[]
dejar=[]
for mirar in registro:
dejar=numero
cambio=dejar[-1]
seleccionado= mirar[0]
dejar[mirar[1]]=cambio
dejar[-1]=seleccionado
finalista=""
contador=0
while contador<=len(dejar)-1:
finalista= finalista + str(dejar[contador])
contador+=1
temporal.append(int(finalista))
temporal.append(int(mirar[1]))
super_general.append(temporal)
temporal=[]
super_general.sort()
unico=[]
final_registro=[]
veces=0
for seleccion in super_general:
if seleccion[0]==super_general[0][0]:
unico.append(seleccion[1])
unico.append(seleccion[0])
final_registro.append(unico)
unico=[]
veces+=1
if veces >1:
final_registro.sort()
maximo_par=final_registro[0][1]
print(maximo_par)
else:
final_registro.sort()
maximo_par = final_registro[0][1]
print(maximo_par)
```
| 0 |
|
250 |
D
|
Building Bridge
|
PROGRAMMING
| 1,900 |
[
"geometry",
"ternary search",
"two pointers"
] | null | null |
Two villages are separated by a river that flows from the north to the south. The villagers want to build a bridge across the river to make it easier to move across the villages.
The river banks can be assumed to be vertical straight lines *x*<==<=*a* and *x*<==<=*b* (0<=<<=*a*<=<<=*b*).
The west village lies in a steppe at point *O*<==<=(0,<=0). There are *n* pathways leading from the village to the river, they end at points *A**i*<==<=(*a*,<=*y**i*). The villagers there are plain and simple, so their pathways are straight segments as well.
The east village has reserved and cunning people. Their village is in the forest on the east bank of the river, but its exact position is not clear. There are *m* twisted paths leading from this village to the river and ending at points *B**i*<==<=(*b*,<=*y*'*i*). The lengths of all these paths are known, the length of the path that leads from the eastern village to point *B**i*, equals *l**i*.
The villagers want to choose exactly one point on the left bank of river *A**i*, exactly one point on the right bank *B**j* and connect them by a straight-line bridge so as to make the total distance between the villages (the sum of |*OA**i*|<=+<=|*A**i**B**j*|<=+<=*l**j*, where |*XY*| is the Euclidean distance between points *X* and *Y*) were minimum. The Euclidean distance between points (*x*1,<=*y*1) and (*x*2,<=*y*2) equals .
Help them and find the required pair of points.
|
The first line contains integers *n*, *m*, *a*, *b* (1<=≤<=*n*,<=*m*<=≤<=105, 0<=<<=*a*<=<<=*b*<=<<=106).
The second line contains *n* integers in the ascending order: the *i*-th integer determines the coordinate of point *A**i* and equals *y**i* (|*y**i*|<=≤<=106).
The third line contains *m* integers in the ascending order: the *i*-th integer determines the coordinate of point *B**i* and equals *y*'*i* (|*y*'*i*|<=≤<=106).
The fourth line contains *m* more integers: the *i*-th of them determines the length of the path that connects the eastern village and point *B**i*, and equals *l**i* (1<=≤<=*l**i*<=≤<=106).
It is guaranteed, that there is such a point *C* with abscissa at least *b*, that |*B**i**C*|<=≤<=*l**i* for all *i* (1<=≤<=*i*<=≤<=*m*). It is guaranteed that no two points *A**i* coincide. It is guaranteed that no two points *B**i* coincide.
|
Print two integers — the numbers of points on the left (west) and right (east) banks, respectively, between which you need to build a bridge. You can assume that the points on the west bank are numbered from 1 to *n*, in the order in which they are given in the input. Similarly, the points on the east bank are numbered from 1 to *m* in the order in which they are given in the input.
If there are multiple solutions, print any of them. The solution will be accepted if the final length of the path will differ from the answer of the jury by no more than 10<=-<=6 in absolute or relative value.
|
[
"3 2 3 5\n-2 -1 4\n-1 2\n7 3\n"
] |
[
"2 2"
] |
none
| 1,500 |
[
{
"input": "3 2 3 5\n-2 -1 4\n-1 2\n7 3",
"output": "2 2"
},
{
"input": "1 1 10 20\n5\n-5\n1",
"output": "1 1"
},
{
"input": "2 2 1 2\n-1 10\n8 9\n3 7",
"output": "1 1"
},
{
"input": "10 20 50 60\n-96 -75 32 37 42 43 44 57 61 65\n-95 -90 -86 -79 -65 -62 -47 -11 -8 -6 1 8 23 25 32 51 73 88 94 100\n138 75 132 116 49 43 96 166 96 161 146 112 195 192 201 186 251 254 220 227",
"output": "2 6"
}
] | 1,445,798,714 | 2,147,483,647 |
Python 3
|
OK
|
TESTS
| 33 | 1,122 | 11,878,400 |
from math import sqrt,fabs
def dist(x1, y1, x2, y2):
return sqrt(pow(abs(x1 - x2), 2) + pow(abs(y1 - y2), 2))
def calcOptimumRightPoint(startX, startY):
l = float("inf")
idx = -1
for i in range(len(B)):
d = dist(startX, startY, b, B[i]) + L[i]
if d <= l:
l = d
idx = i
return idx
n,m,a,b = [int(x) for x in input().split()]
A = [int(x) for x in input().split()]
B = [int(x) for x in input().split()]
L = [int(x) for x in input().split()]
optimumRightPoint = calcOptimumRightPoint(0,0)
intersectLeft = (a * B[optimumRightPoint]) / b
l = float("inf")
optimumLeftPoint = -1
for i in range(len(A)):
if fabs(intersectLeft-A[i]) < l:
l = fabs(intersectLeft-A[i])
optimumLeftPoint = i
optimumRightPoint = calcOptimumRightPoint(a, A[optimumLeftPoint])
print(optimumLeftPoint + 1, optimumRightPoint + 1)
|
Title: Building Bridge
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Two villages are separated by a river that flows from the north to the south. The villagers want to build a bridge across the river to make it easier to move across the villages.
The river banks can be assumed to be vertical straight lines *x*<==<=*a* and *x*<==<=*b* (0<=<<=*a*<=<<=*b*).
The west village lies in a steppe at point *O*<==<=(0,<=0). There are *n* pathways leading from the village to the river, they end at points *A**i*<==<=(*a*,<=*y**i*). The villagers there are plain and simple, so their pathways are straight segments as well.
The east village has reserved and cunning people. Their village is in the forest on the east bank of the river, but its exact position is not clear. There are *m* twisted paths leading from this village to the river and ending at points *B**i*<==<=(*b*,<=*y*'*i*). The lengths of all these paths are known, the length of the path that leads from the eastern village to point *B**i*, equals *l**i*.
The villagers want to choose exactly one point on the left bank of river *A**i*, exactly one point on the right bank *B**j* and connect them by a straight-line bridge so as to make the total distance between the villages (the sum of |*OA**i*|<=+<=|*A**i**B**j*|<=+<=*l**j*, where |*XY*| is the Euclidean distance between points *X* and *Y*) were minimum. The Euclidean distance between points (*x*1,<=*y*1) and (*x*2,<=*y*2) equals .
Help them and find the required pair of points.
Input Specification:
The first line contains integers *n*, *m*, *a*, *b* (1<=≤<=*n*,<=*m*<=≤<=105, 0<=<<=*a*<=<<=*b*<=<<=106).
The second line contains *n* integers in the ascending order: the *i*-th integer determines the coordinate of point *A**i* and equals *y**i* (|*y**i*|<=≤<=106).
The third line contains *m* integers in the ascending order: the *i*-th integer determines the coordinate of point *B**i* and equals *y*'*i* (|*y*'*i*|<=≤<=106).
The fourth line contains *m* more integers: the *i*-th of them determines the length of the path that connects the eastern village and point *B**i*, and equals *l**i* (1<=≤<=*l**i*<=≤<=106).
It is guaranteed, that there is such a point *C* with abscissa at least *b*, that |*B**i**C*|<=≤<=*l**i* for all *i* (1<=≤<=*i*<=≤<=*m*). It is guaranteed that no two points *A**i* coincide. It is guaranteed that no two points *B**i* coincide.
Output Specification:
Print two integers — the numbers of points on the left (west) and right (east) banks, respectively, between which you need to build a bridge. You can assume that the points on the west bank are numbered from 1 to *n*, in the order in which they are given in the input. Similarly, the points on the east bank are numbered from 1 to *m* in the order in which they are given in the input.
If there are multiple solutions, print any of them. The solution will be accepted if the final length of the path will differ from the answer of the jury by no more than 10<=-<=6 in absolute or relative value.
Demo Input:
['3 2 3 5\n-2 -1 4\n-1 2\n7 3\n']
Demo Output:
['2 2']
Note:
none
|
```python
from math import sqrt,fabs
def dist(x1, y1, x2, y2):
return sqrt(pow(abs(x1 - x2), 2) + pow(abs(y1 - y2), 2))
def calcOptimumRightPoint(startX, startY):
l = float("inf")
idx = -1
for i in range(len(B)):
d = dist(startX, startY, b, B[i]) + L[i]
if d <= l:
l = d
idx = i
return idx
n,m,a,b = [int(x) for x in input().split()]
A = [int(x) for x in input().split()]
B = [int(x) for x in input().split()]
L = [int(x) for x in input().split()]
optimumRightPoint = calcOptimumRightPoint(0,0)
intersectLeft = (a * B[optimumRightPoint]) / b
l = float("inf")
optimumLeftPoint = -1
for i in range(len(A)):
if fabs(intersectLeft-A[i]) < l:
l = fabs(intersectLeft-A[i])
optimumLeftPoint = i
optimumRightPoint = calcOptimumRightPoint(a, A[optimumLeftPoint])
print(optimumLeftPoint + 1, optimumRightPoint + 1)
```
| 3 |
|
22 |
A
|
Second Order Statistics
|
PROGRAMMING
| 800 |
[
"brute force"
] |
A. Second Order Statistics
|
2
|
256
|
Once Bob needed to find the second order statistics of a sequence of integer numbers. Lets choose each number from the sequence exactly once and sort them. The value on the second position is the second order statistics of the given sequence. In other words it is the smallest element strictly greater than the minimum. Help Bob solve this problem.
|
The first input line contains integer *n* (1<=≤<=*n*<=≤<=100) — amount of numbers in the sequence. The second line contains *n* space-separated integer numbers — elements of the sequence. These numbers don't exceed 100 in absolute value.
|
If the given sequence has the second order statistics, output this order statistics, otherwise output NO.
|
[
"4\n1 2 2 -4\n",
"5\n1 2 3 1 1\n"
] |
[
"1\n",
"2\n"
] |
none
| 0 |
[
{
"input": "4\n1 2 2 -4",
"output": "1"
},
{
"input": "5\n1 2 3 1 1",
"output": "2"
},
{
"input": "1\n28",
"output": "NO"
},
{
"input": "2\n-28 12",
"output": "12"
},
{
"input": "3\n-83 40 -80",
"output": "-80"
},
{
"input": "8\n93 77 -92 26 21 -48 53 91",
"output": "-48"
},
{
"input": "20\n-72 -9 -86 80 7 -10 40 -27 -94 92 96 56 28 -19 79 36 -3 -73 -63 -49",
"output": "-86"
},
{
"input": "49\n-74 -100 -80 23 -8 -83 -41 -20 48 17 46 -73 -55 67 85 4 40 -60 -69 -75 56 -74 -42 93 74 -95 64 -46 97 -47 55 0 -78 -34 -31 40 -63 -49 -76 48 21 -1 -49 -29 -98 -11 76 26 94",
"output": "-98"
},
{
"input": "88\n63 48 1 -53 -89 -49 64 -70 -49 71 -17 -16 76 81 -26 -50 67 -59 -56 97 2 100 14 18 -91 -80 42 92 -25 -88 59 8 -56 38 48 -71 -78 24 -14 48 -1 69 73 -76 54 16 -92 44 47 33 -34 -17 -81 21 -59 -61 53 26 10 -76 67 35 -29 70 65 -13 -29 81 80 32 74 -6 34 46 57 1 -45 -55 69 79 -58 11 -2 22 -18 -16 -89 -46",
"output": "-91"
},
{
"input": "100\n34 32 88 20 76 53 -71 -39 -98 -10 57 37 63 -3 -54 -64 -78 -82 73 20 -30 -4 22 75 51 -64 -91 29 -52 -48 83 19 18 -47 46 57 -44 95 89 89 -30 84 -83 67 58 -99 -90 -53 92 -60 -5 -56 -61 27 68 -48 52 -95 64 -48 -30 -67 66 89 14 -33 -31 -91 39 7 -94 -54 92 -96 -99 -83 -16 91 -28 -66 81 44 14 -85 -21 18 40 16 -13 -82 -33 47 -10 -40 -19 10 25 60 -34 -89",
"output": "-98"
},
{
"input": "2\n-1 -1",
"output": "NO"
},
{
"input": "3\n-2 -2 -2",
"output": "NO"
},
{
"input": "100\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0",
"output": "NO"
},
{
"input": "100\n100 100 100 100 100 100 100 100 100 100 100 100 -100 100 100 100 100 100 100 100 100 100 100 100 -100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 -100 100 100 100 100 100 100 100 100 100 100 -100 100 100 100 100 -100 100 100 100 100 100 100 100 100 100 100 100",
"output": "100"
},
{
"input": "10\n40 71 -85 -85 40 -85 -85 64 -85 47",
"output": "40"
},
{
"input": "23\n-90 -90 -41 -64 -64 -90 -15 10 -43 -90 -64 -64 89 -64 36 47 38 -90 -64 -90 -90 68 -90",
"output": "-64"
},
{
"input": "39\n-97 -93 -42 -93 -97 -93 56 -97 -97 -97 76 -33 -60 91 7 82 17 47 -97 -97 -93 73 -97 12 -97 -97 -97 -97 56 -92 -83 -93 -93 49 -93 -97 -97 -17 -93",
"output": "-93"
},
{
"input": "51\n-21 6 -35 -98 -86 -98 -86 -43 -65 32 -98 -40 96 -98 -98 -98 -98 -86 -86 -98 56 -86 -98 -98 -30 -98 -86 -31 -98 -86 -86 -86 -86 -30 96 -86 -86 -86 -60 25 88 -86 -86 58 31 -47 57 -86 37 44 -83",
"output": "-86"
},
{
"input": "66\n-14 -95 65 -95 -95 -97 -90 -71 -97 -97 70 -95 -95 -97 -95 -27 35 -87 -95 -5 -97 -97 87 34 -49 -95 -97 -95 -97 -95 -30 -95 -97 47 -95 -17 -97 -95 -97 -69 51 -97 -97 -95 -75 87 59 21 63 56 76 -91 98 -97 6 -97 -95 -95 -97 -73 11 -97 -35 -95 -95 -43",
"output": "-95"
},
{
"input": "77\n-67 -93 -93 -92 97 29 93 -93 -93 -5 -93 -7 60 -92 -93 44 -84 68 -92 -93 69 -92 -37 56 43 -93 35 -92 -93 19 -79 18 -92 -93 -93 -37 -93 -47 -93 -92 -92 74 67 19 40 -92 -92 -92 -92 -93 -93 -41 -93 -92 -93 -93 -92 -93 51 -80 6 -42 -92 -92 -66 -12 -92 -92 -3 93 -92 -49 -93 40 62 -92 -92",
"output": "-92"
},
{
"input": "89\n-98 40 16 -87 -98 63 -100 55 -96 -98 -21 -100 -93 26 -98 -98 -100 -89 -98 -5 -65 -28 -100 -6 -66 67 -100 -98 -98 10 -98 -98 -70 7 -98 2 -100 -100 -98 25 -100 -100 -98 23 -68 -100 -98 3 98 -100 -98 -98 -98 -98 -24 -100 -100 -9 -98 35 -100 99 -5 -98 -100 -100 37 -100 -84 57 -98 40 -47 -100 -1 -92 -76 -98 -98 -100 -100 -100 -63 30 21 -100 -100 -100 -12",
"output": "-98"
},
{
"input": "99\n10 -84 -100 -100 73 -64 -100 -94 33 -100 -100 -100 -100 71 64 24 7 -100 -32 -100 -100 77 -100 62 -12 55 45 -100 -100 -80 -100 -100 -100 -100 -100 -100 -100 -100 -100 -39 -48 -100 -34 47 -100 -100 -100 -100 -100 -77 -100 -100 -100 -100 -100 -100 -52 40 -55 -100 -44 -100 72 33 70 -100 -100 -78 -100 -3 100 -77 22 -100 95 -30 -100 10 -69 -100 -100 -100 -100 52 -39 -100 -100 -100 7 -100 -98 -66 95 -17 -100 52 -100 68 -100",
"output": "-98"
},
{
"input": "100\n-99 -98 -64 89 53 57 -99 29 -78 18 -3 -54 76 -98 -99 -98 37 -98 19 -47 89 73 -98 -91 -99 -99 -98 -48 -99 22 -99 -98 -99 -99 -98 -60 84 67 -99 -98 20 -98 88 -98 46 -98 -99 -98 -99 -71 -99 -98 -98 -39 83 95 -98 63 -98 -99 32 -98 -99 -64 57 -30 -53 -83 -4 -99 58 20 -98 -10 -99 -44 -99 -99 -99 -99 75 34 -98 -52 -98 -30 -98 -99 -98 -98 51 -99 -99 -99 -98 -99 -99 -82 -90 92",
"output": "-98"
},
{
"input": "3\n1 2 3",
"output": "2"
},
{
"input": "3\n1 3 2",
"output": "2"
},
{
"input": "3\n2 1 3",
"output": "2"
},
{
"input": "3\n2 3 1",
"output": "2"
},
{
"input": "3\n3 1 2",
"output": "2"
},
{
"input": "3\n3 2 1",
"output": "2"
},
{
"input": "9\n99 99 99 99 100 100 100 100 100",
"output": "100"
},
{
"input": "5\n-100 -100 -100 -100 -100",
"output": "NO"
}
] | 1,656,505,965 | 2,147,483,647 |
Python 3
|
WRONG_ANSWER
|
TESTS
| 0 | 30 | 0 |
n = int(input())
l = sorted(list(map(int, input().split())))
m = min(l)
for i in l:
if l[n-1] == m:
print("NO")
break
elif i != m:
print(i)
|
Title: Second Order Statistics
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Once Bob needed to find the second order statistics of a sequence of integer numbers. Lets choose each number from the sequence exactly once and sort them. The value on the second position is the second order statistics of the given sequence. In other words it is the smallest element strictly greater than the minimum. Help Bob solve this problem.
Input Specification:
The first input line contains integer *n* (1<=≤<=*n*<=≤<=100) — amount of numbers in the sequence. The second line contains *n* space-separated integer numbers — elements of the sequence. These numbers don't exceed 100 in absolute value.
Output Specification:
If the given sequence has the second order statistics, output this order statistics, otherwise output NO.
Demo Input:
['4\n1 2 2 -4\n', '5\n1 2 3 1 1\n']
Demo Output:
['1\n', '2\n']
Note:
none
|
```python
n = int(input())
l = sorted(list(map(int, input().split())))
m = min(l)
for i in l:
if l[n-1] == m:
print("NO")
break
elif i != m:
print(i)
```
| 0 |
304 |
B
|
Calendar
|
PROGRAMMING
| 1,300 |
[
"brute force",
"implementation"
] | null | null |
Calendars in widespread use today include the Gregorian calendar, which is the de facto international standard, and is used almost everywhere in the world for civil purposes. The Gregorian reform modified the Julian calendar's scheme of leap years as follows:
Every year that is exactly divisible by four is a leap year, except for years that are exactly divisible by 100; the centurial years that are exactly divisible by 400 are still leap years. For example, the year 1900 is not a leap year; the year 2000 is a leap year.
In this problem, you have been given two dates and your task is to calculate how many days are between them. Note, that leap years have unusual number of days in February.
Look at the sample to understand what borders are included in the aswer.
|
The first two lines contain two dates, each date is in the format yyyy:mm:dd (1900<=≤<=*yyyy*<=≤<=2038 and yyyy:mm:dd is a legal date).
|
Print a single integer — the answer to the problem.
|
[
"1900:01:01\n2038:12:31\n",
"1996:03:09\n1991:11:12\n"
] |
[
"50768\n",
"1579\n"
] |
none
| 1,000 |
[
{
"input": "1900:01:01\n2038:12:31",
"output": "50768"
},
{
"input": "1996:03:09\n1991:11:12",
"output": "1579"
},
{
"input": "1999:12:31\n2000:02:29",
"output": "60"
},
{
"input": "1903:09:27\n1988:06:15",
"output": "30943"
},
{
"input": "1913:11:14\n1901:05:11",
"output": "4570"
},
{
"input": "1915:01:01\n2007:07:01",
"output": "33784"
},
{
"input": "1925:07:15\n2010:06:22",
"output": "31023"
},
{
"input": "1935:10:08\n1923:01:07",
"output": "4657"
},
{
"input": "1986:08:24\n1926:04:13",
"output": "22048"
},
{
"input": "1932:11:18\n2028:09:25",
"output": "35010"
},
{
"input": "1942:06:04\n1982:12:29",
"output": "14818"
},
{
"input": "1993:08:25\n1985:02:16",
"output": "3112"
},
{
"input": "1954:06:30\n1911:05:04",
"output": "15763"
},
{
"input": "2005:08:01\n1963:08:23",
"output": "15319"
},
{
"input": "2015:10:17\n1966:07:12",
"output": "17994"
},
{
"input": "2025:08:10\n2018:09:03",
"output": "2533"
},
{
"input": "2027:07:31\n1945:04:06",
"output": "30066"
},
{
"input": "2037:05:16\n1996:03:11",
"output": "15041"
},
{
"input": "1949:07:09\n1901:10:24",
"output": "17425"
},
{
"input": "2028:04:11\n1931:09:01",
"output": "35287"
},
{
"input": "1900:02:06\n1997:12:07",
"output": "35733"
},
{
"input": "1902:09:06\n1951:03:31",
"output": "17738"
},
{
"input": "1912:03:09\n1954:06:17",
"output": "15440"
},
{
"input": "1963:05:02\n2005:08:02",
"output": "15433"
},
{
"input": "1973:03:18\n1932:11:07",
"output": "14741"
},
{
"input": "1934:01:09\n1935:02:22",
"output": "409"
},
{
"input": "1985:08:24\n1987:05:01",
"output": "615"
},
{
"input": "1995:06:03\n1990:07:22",
"output": "1777"
},
{
"input": "1907:04:04\n1902:10:01",
"output": "1646"
},
{
"input": "1910:01:11\n1987:02:08",
"output": "28152"
},
{
"input": "1996:03:09\n1996:03:09",
"output": "0"
},
{
"input": "1900:03:02\n2038:03:01",
"output": "50403"
},
{
"input": "2000:01:02\n2000:02:02",
"output": "31"
},
{
"input": "1999:04:08\n1999:02:04",
"output": "63"
},
{
"input": "1999:01:01\n1999:01:10",
"output": "9"
},
{
"input": "2012:05:29\n2012:02:29",
"output": "90"
},
{
"input": "1900:01:01\n1900:01:01",
"output": "0"
},
{
"input": "1996:02:01\n1996:01:27",
"output": "5"
},
{
"input": "1901:12:31\n1901:12:31",
"output": "0"
},
{
"input": "2000:02:28\n2000:02:28",
"output": "0"
}
] | 1,512,386,946 | 2,147,483,647 |
Python 3
|
WRONG_ANSWER
|
TESTS
| 9 | 124 | 5,529,600 |
year1,month1,day1 = map(int,input().split(':'))
year2,month2,day2 = map(int,input().split(':'))
if(year2 < year1):
year1,year2 = year2,year1
month1,month2 = month2,month1
day1,day2 = day2,day1
#dim = {1:31,2:28,3:31,4:30,5:31,6:30,7:31,8:31,9:30,10:31,11:30,12:31}
dim =[31,28,31,30,31,30,31,31,30,31,30,31]
years = 0
leapdays = 0
for i in range(year1+1,year2) :
years += 1
if (i % 100 == 0) :
if(i % 400 == 0 ) :
leapdays += 1
else :
if(i%4 == 0):
leapdays += 1
days = leapdays+(years*365)
for i in range(month1+1,13) :
days = (days+ dim[i-1])
for i in range(1,month2):
days = (days + dim[i-1])
eday1 = 1+(dim[month1-1]-day1)
days = days + eday1+day2
if(month1 >= 2) :
if(year1 % 100== 0) :
if(year1 % 400==0) :
days += 1
else :
if (year1 % 4 == 0) :
days += 1
if(month2>=3):
if(year2 % 100== 0) :
if(year2 % 400==0) :
days += 1
else :
if year2 % 4 == 0:
days += 1
print (days-1)
|
Title: Calendar
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Calendars in widespread use today include the Gregorian calendar, which is the de facto international standard, and is used almost everywhere in the world for civil purposes. The Gregorian reform modified the Julian calendar's scheme of leap years as follows:
Every year that is exactly divisible by four is a leap year, except for years that are exactly divisible by 100; the centurial years that are exactly divisible by 400 are still leap years. For example, the year 1900 is not a leap year; the year 2000 is a leap year.
In this problem, you have been given two dates and your task is to calculate how many days are between them. Note, that leap years have unusual number of days in February.
Look at the sample to understand what borders are included in the aswer.
Input Specification:
The first two lines contain two dates, each date is in the format yyyy:mm:dd (1900<=≤<=*yyyy*<=≤<=2038 and yyyy:mm:dd is a legal date).
Output Specification:
Print a single integer — the answer to the problem.
Demo Input:
['1900:01:01\n2038:12:31\n', '1996:03:09\n1991:11:12\n']
Demo Output:
['50768\n', '1579\n']
Note:
none
|
```python
year1,month1,day1 = map(int,input().split(':'))
year2,month2,day2 = map(int,input().split(':'))
if(year2 < year1):
year1,year2 = year2,year1
month1,month2 = month2,month1
day1,day2 = day2,day1
#dim = {1:31,2:28,3:31,4:30,5:31,6:30,7:31,8:31,9:30,10:31,11:30,12:31}
dim =[31,28,31,30,31,30,31,31,30,31,30,31]
years = 0
leapdays = 0
for i in range(year1+1,year2) :
years += 1
if (i % 100 == 0) :
if(i % 400 == 0 ) :
leapdays += 1
else :
if(i%4 == 0):
leapdays += 1
days = leapdays+(years*365)
for i in range(month1+1,13) :
days = (days+ dim[i-1])
for i in range(1,month2):
days = (days + dim[i-1])
eday1 = 1+(dim[month1-1]-day1)
days = days + eday1+day2
if(month1 >= 2) :
if(year1 % 100== 0) :
if(year1 % 400==0) :
days += 1
else :
if (year1 % 4 == 0) :
days += 1
if(month2>=3):
if(year2 % 100== 0) :
if(year2 % 400==0) :
days += 1
else :
if year2 % 4 == 0:
days += 1
print (days-1)
```
| 0 |
|
116 |
A
|
Tram
|
PROGRAMMING
| 800 |
[
"implementation"
] | null | null |
Linear Kingdom has exactly one tram line. It has *n* stops, numbered from 1 to *n* in the order of tram's movement. At the *i*-th stop *a**i* passengers exit the tram, while *b**i* passengers enter it. The tram is empty before it arrives at the first stop. Also, when the tram arrives at the last stop, all passengers exit so that it becomes empty.
Your task is to calculate the tram's minimum capacity such that the number of people inside the tram at any time never exceeds this capacity. Note that at each stop all exiting passengers exit before any entering passenger enters the tram.
|
The first line contains a single number *n* (2<=≤<=*n*<=≤<=1000) — the number of the tram's stops.
Then *n* lines follow, each contains two integers *a**i* and *b**i* (0<=≤<=*a**i*,<=*b**i*<=≤<=1000) — the number of passengers that exits the tram at the *i*-th stop, and the number of passengers that enter the tram at the *i*-th stop. The stops are given from the first to the last stop in the order of tram's movement.
- The number of people who exit at a given stop does not exceed the total number of people in the tram immediately before it arrives at the stop. More formally, . This particularly means that *a*1<==<=0. - At the last stop, all the passengers exit the tram and it becomes empty. More formally, . - No passenger will enter the train at the last stop. That is, *b**n*<==<=0.
|
Print a single integer denoting the minimum possible capacity of the tram (0 is allowed).
|
[
"4\n0 3\n2 5\n4 2\n4 0\n"
] |
[
"6\n"
] |
For the first example, a capacity of 6 is sufficient:
- At the first stop, the number of passengers inside the tram before arriving is 0. Then, 3 passengers enter the tram, and the number of passengers inside the tram becomes 3. - At the second stop, 2 passengers exit the tram (1 passenger remains inside). Then, 5 passengers enter the tram. There are 6 passengers inside the tram now. - At the third stop, 4 passengers exit the tram (2 passengers remain inside). Then, 2 passengers enter the tram. There are 4 passengers inside the tram now. - Finally, all the remaining passengers inside the tram exit the tram at the last stop. There are no passenger inside the tram now, which is in line with the constraints.
Since the number of passengers inside the tram never exceeds 6, a capacity of 6 is sufficient. Furthermore it is not possible for the tram to have a capacity less than 6. Hence, 6 is the correct answer.
| 500 |
[
{
"input": "4\n0 3\n2 5\n4 2\n4 0",
"output": "6"
},
{
"input": "5\n0 4\n4 6\n6 5\n5 4\n4 0",
"output": "6"
},
{
"input": "10\n0 5\n1 7\n10 8\n5 3\n0 5\n3 3\n8 8\n0 6\n10 1\n9 0",
"output": "18"
},
{
"input": "3\n0 1\n1 1\n1 0",
"output": "1"
},
{
"input": "4\n0 1\n0 1\n1 0\n1 0",
"output": "2"
},
{
"input": "3\n0 0\n0 0\n0 0",
"output": "0"
},
{
"input": "3\n0 1000\n1000 1000\n1000 0",
"output": "1000"
},
{
"input": "5\n0 73\n73 189\n189 766\n766 0\n0 0",
"output": "766"
},
{
"input": "5\n0 0\n0 0\n0 0\n0 1\n1 0",
"output": "1"
},
{
"input": "5\n0 917\n917 923\n904 992\n1000 0\n11 0",
"output": "1011"
},
{
"input": "5\n0 1\n1 2\n2 1\n1 2\n2 0",
"output": "2"
},
{
"input": "5\n0 0\n0 0\n0 0\n0 0\n0 0",
"output": "0"
},
{
"input": "20\n0 7\n2 1\n2 2\n5 7\n2 6\n6 10\n2 4\n0 4\n7 4\n8 0\n10 6\n2 1\n6 1\n1 7\n0 3\n8 7\n6 3\n6 3\n1 1\n3 0",
"output": "22"
},
{
"input": "5\n0 1000\n1000 1000\n1000 1000\n1000 1000\n1000 0",
"output": "1000"
},
{
"input": "10\n0 592\n258 598\n389 203\n249 836\n196 635\n478 482\n994 987\n1000 0\n769 0\n0 0",
"output": "1776"
},
{
"input": "10\n0 1\n1 0\n0 0\n0 0\n0 0\n0 1\n1 1\n0 1\n1 0\n1 0",
"output": "2"
},
{
"input": "10\n0 926\n926 938\n938 931\n931 964\n937 989\n983 936\n908 949\n997 932\n945 988\n988 0",
"output": "1016"
},
{
"input": "10\n0 1\n1 2\n1 2\n2 2\n2 2\n2 2\n1 1\n1 1\n2 1\n2 0",
"output": "3"
},
{
"input": "10\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0",
"output": "0"
},
{
"input": "10\n0 1000\n1000 1000\n1000 1000\n1000 1000\n1000 1000\n1000 1000\n1000 1000\n1000 1000\n1000 1000\n1000 0",
"output": "1000"
},
{
"input": "50\n0 332\n332 268\n268 56\n56 711\n420 180\n160 834\n149 341\n373 777\n763 93\n994 407\n86 803\n700 132\n471 608\n429 467\n75 5\n638 305\n405 853\n316 478\n643 163\n18 131\n648 241\n241 766\n316 847\n640 380\n923 759\n789 41\n125 421\n421 9\n9 388\n388 829\n408 108\n462 856\n816 411\n518 688\n290 7\n405 912\n397 772\n396 652\n394 146\n27 648\n462 617\n514 433\n780 35\n710 705\n460 390\n194 508\n643 56\n172 469\n1000 0\n194 0",
"output": "2071"
},
{
"input": "50\n0 0\n0 1\n1 1\n0 1\n0 0\n1 0\n0 0\n1 0\n0 0\n0 0\n0 0\n0 0\n0 1\n0 0\n0 0\n0 1\n1 0\n0 1\n0 0\n1 1\n1 0\n0 1\n0 0\n1 1\n0 1\n1 0\n1 1\n1 0\n0 0\n1 1\n1 0\n0 1\n0 0\n0 1\n1 1\n1 1\n1 1\n1 0\n1 1\n1 0\n0 1\n1 0\n0 0\n0 1\n1 1\n1 1\n0 1\n0 0\n1 0\n1 0",
"output": "3"
},
{
"input": "50\n0 926\n926 971\n915 980\n920 965\n954 944\n928 952\n955 980\n916 980\n906 935\n944 913\n905 923\n912 922\n965 934\n912 900\n946 930\n931 983\n979 905\n925 969\n924 926\n910 914\n921 977\n934 979\n962 986\n942 909\n976 903\n982 982\n991 941\n954 929\n902 980\n947 983\n919 924\n917 943\n916 905\n907 913\n964 977\n984 904\n905 999\n950 970\n986 906\n993 970\n960 994\n963 983\n918 986\n980 900\n931 986\n993 997\n941 909\n907 909\n1000 0\n278 0",
"output": "1329"
},
{
"input": "2\n0 863\n863 0",
"output": "863"
},
{
"input": "50\n0 1\n1 2\n2 2\n1 1\n1 1\n1 2\n1 2\n1 1\n1 2\n1 1\n1 1\n1 2\n1 2\n1 1\n2 1\n2 2\n1 2\n2 2\n1 2\n2 1\n2 1\n2 2\n2 1\n1 2\n1 2\n2 1\n1 1\n2 2\n1 1\n2 1\n2 2\n2 1\n1 2\n2 2\n1 2\n1 1\n1 1\n2 1\n2 1\n2 2\n2 1\n2 1\n1 2\n1 2\n1 2\n1 2\n2 0\n2 0\n2 0\n0 0",
"output": "8"
},
{
"input": "50\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0",
"output": "0"
},
{
"input": "100\n0 1\n0 0\n0 0\n1 0\n0 0\n0 1\n0 1\n1 1\n0 0\n0 0\n1 1\n0 0\n1 1\n0 1\n1 1\n0 1\n1 1\n1 0\n1 0\n0 0\n1 0\n0 1\n1 0\n0 0\n0 0\n1 1\n1 1\n0 1\n0 0\n1 0\n1 1\n0 1\n1 0\n1 1\n0 1\n1 1\n1 0\n0 0\n0 0\n0 1\n0 0\n0 1\n1 1\n0 0\n1 1\n1 1\n0 0\n0 1\n1 0\n0 1\n0 0\n0 1\n0 1\n1 1\n1 1\n1 1\n0 0\n0 0\n1 1\n0 1\n0 1\n1 0\n0 0\n0 0\n1 1\n0 1\n0 1\n1 1\n1 1\n0 1\n1 1\n1 1\n0 0\n1 0\n0 1\n0 0\n0 0\n1 1\n1 1\n1 1\n1 1\n0 1\n1 0\n1 0\n1 0\n1 0\n1 0\n0 0\n1 0\n1 0\n0 0\n1 0\n0 0\n0 1\n1 0\n0 1\n1 0\n1 0\n1 0\n1 0",
"output": "11"
},
{
"input": "100\n0 2\n1 2\n2 1\n1 2\n1 2\n2 1\n2 2\n1 1\n1 1\n2 1\n1 2\n2 1\n1 2\n2 2\n2 2\n2 2\n1 2\n2 2\n2 1\n1 1\n1 1\n1 1\n2 2\n1 2\n2 2\n1 1\n1 1\n1 1\n1 1\n2 2\n1 2\n2 1\n1 1\n2 2\n1 1\n2 1\n1 1\n2 2\n2 1\n1 2\n1 1\n1 2\n2 1\n2 2\n1 1\n2 1\n1 1\n2 1\n1 1\n1 2\n2 2\n2 2\n1 1\n2 2\n1 2\n2 1\n2 1\n1 1\n1 1\n1 2\n1 2\n1 1\n1 1\n2 1\n1 2\n1 2\n2 1\n2 2\n2 2\n2 2\n2 1\n2 2\n1 1\n1 2\n1 2\n1 1\n2 2\n2 2\n1 1\n2 1\n1 1\n1 2\n1 2\n1 2\n1 1\n1 1\n2 2\n1 2\n2 1\n2 1\n2 1\n1 2\n1 2\n1 1\n2 2\n1 2\n2 0\n2 0\n2 0\n1 0",
"output": "7"
},
{
"input": "100\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0",
"output": "0"
},
{
"input": "2\n0 1\n1 0",
"output": "1"
},
{
"input": "2\n0 900\n900 0",
"output": "900"
},
{
"input": "2\n0 1\n1 0",
"output": "1"
},
{
"input": "2\n0 0\n0 0",
"output": "0"
},
{
"input": "2\n0 1000\n1000 0",
"output": "1000"
},
{
"input": "3\n0 802\n175 188\n815 0",
"output": "815"
},
{
"input": "3\n0 910\n910 976\n976 0",
"output": "976"
},
{
"input": "3\n0 2\n2 1\n1 0",
"output": "2"
}
] | 1,695,120,110 | 2,147,483,647 |
Python 3
|
OK
|
TESTS
| 71 | 92 | 0 |
n=int(input())
s=0
m=0
for i in range(n):
a,b=map(int,input().split())
s=s-a+b
m=max(m,s)
print(m)
|
Title: Tram
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Linear Kingdom has exactly one tram line. It has *n* stops, numbered from 1 to *n* in the order of tram's movement. At the *i*-th stop *a**i* passengers exit the tram, while *b**i* passengers enter it. The tram is empty before it arrives at the first stop. Also, when the tram arrives at the last stop, all passengers exit so that it becomes empty.
Your task is to calculate the tram's minimum capacity such that the number of people inside the tram at any time never exceeds this capacity. Note that at each stop all exiting passengers exit before any entering passenger enters the tram.
Input Specification:
The first line contains a single number *n* (2<=≤<=*n*<=≤<=1000) — the number of the tram's stops.
Then *n* lines follow, each contains two integers *a**i* and *b**i* (0<=≤<=*a**i*,<=*b**i*<=≤<=1000) — the number of passengers that exits the tram at the *i*-th stop, and the number of passengers that enter the tram at the *i*-th stop. The stops are given from the first to the last stop in the order of tram's movement.
- The number of people who exit at a given stop does not exceed the total number of people in the tram immediately before it arrives at the stop. More formally, . This particularly means that *a*1<==<=0. - At the last stop, all the passengers exit the tram and it becomes empty. More formally, . - No passenger will enter the train at the last stop. That is, *b**n*<==<=0.
Output Specification:
Print a single integer denoting the minimum possible capacity of the tram (0 is allowed).
Demo Input:
['4\n0 3\n2 5\n4 2\n4 0\n']
Demo Output:
['6\n']
Note:
For the first example, a capacity of 6 is sufficient:
- At the first stop, the number of passengers inside the tram before arriving is 0. Then, 3 passengers enter the tram, and the number of passengers inside the tram becomes 3. - At the second stop, 2 passengers exit the tram (1 passenger remains inside). Then, 5 passengers enter the tram. There are 6 passengers inside the tram now. - At the third stop, 4 passengers exit the tram (2 passengers remain inside). Then, 2 passengers enter the tram. There are 4 passengers inside the tram now. - Finally, all the remaining passengers inside the tram exit the tram at the last stop. There are no passenger inside the tram now, which is in line with the constraints.
Since the number of passengers inside the tram never exceeds 6, a capacity of 6 is sufficient. Furthermore it is not possible for the tram to have a capacity less than 6. Hence, 6 is the correct answer.
|
```python
n=int(input())
s=0
m=0
for i in range(n):
a,b=map(int,input().split())
s=s-a+b
m=max(m,s)
print(m)
```
| 3 |
|
439 |
D
|
Devu and his Brother
|
PROGRAMMING
| 1,700 |
[
"binary search",
"sortings",
"ternary search",
"two pointers"
] | null | null |
Devu and his brother love each other a lot. As they are super geeks, they only like to play with arrays. They are given two arrays *a* and *b* by their father. The array *a* is given to Devu and *b* to his brother.
As Devu is really a naughty kid, he wants the minimum value of his array *a* should be at least as much as the maximum value of his brother's array *b*.
Now you have to help Devu in achieving this condition. You can perform multiple operations on the arrays. In a single operation, you are allowed to decrease or increase any element of any of the arrays by 1. Note that you are allowed to apply the operation on any index of the array multiple times.
You need to find minimum number of operations required to satisfy Devu's condition so that the brothers can play peacefully without fighting.
|
The first line contains two space-separated integers *n*, *m* (1<=≤<=*n*,<=*m*<=≤<=105). The second line will contain *n* space-separated integers representing content of the array *a* (1<=≤<=*a**i*<=≤<=109). The third line will contain *m* space-separated integers representing content of the array *b* (1<=≤<=*b**i*<=≤<=109).
|
You need to output a single integer representing the minimum number of operations needed to satisfy Devu's condition.
|
[
"2 2\n2 3\n3 5\n",
"3 2\n1 2 3\n3 4\n",
"3 2\n4 5 6\n1 2\n"
] |
[
"3\n",
"4\n",
"0\n"
] |
In example 1, you can increase *a*<sub class="lower-index">1</sub> by 1 and decrease *b*<sub class="lower-index">2</sub> by 1 and then again decrease *b*<sub class="lower-index">2</sub> by 1. Now array *a* will be [3; 3] and array *b* will also be [3; 3]. Here minimum element of *a* is at least as large as maximum element of *b*. So minimum number of operations needed to satisfy Devu's condition are 3.
In example 3, you don't need to do any operation, Devu's condition is already satisfied.
| 2,000 |
[
{
"input": "2 2\n2 3\n3 5",
"output": "3"
},
{
"input": "3 2\n1 2 3\n3 4",
"output": "4"
},
{
"input": "3 2\n4 5 6\n1 2",
"output": "0"
},
{
"input": "10 10\n23 100 38 38 73 54 59 69 44 86\n100 100 100 100 100 100 100 100 100 100",
"output": "416"
},
{
"input": "1 1\n401114\n998223974",
"output": "997822860"
},
{
"input": "1 1\n100\n4",
"output": "0"
},
{
"input": "1 1\n100\n183299",
"output": "183199"
},
{
"input": "1 1\n999999999\n1000000000",
"output": "1"
},
{
"input": "1 1\n1000000000\n1000000000",
"output": "0"
},
{
"input": "1 1\n1\n2",
"output": "1"
},
{
"input": "1 1\n1\n1",
"output": "0"
},
{
"input": "1 1\n2\n1",
"output": "0"
},
{
"input": "1 1\n1\n2",
"output": "1"
},
{
"input": "1 1\n1\n3",
"output": "2"
},
{
"input": "1 2\n1\n2 2",
"output": "1"
},
{
"input": "2 1\n2 2\n3",
"output": "1"
}
] | 1,600,044,644 | 2,147,483,647 |
PyPy 3
|
OK
|
TESTS
| 70 | 468 | 18,944,000 |
def getIndexA(a, value, l, r):
ans = -1;
while(l <= r):
m = int(( l + r )/2);
if(a[m] < value):
ans = m;
l = m + 1
else:
r = m - 1;
return ans
def getIndexB(b, value, l, r):
ans = -1;
while(l <= r):
m = int(( l + r )/2);
if(b[m] > value):
ans = m;
l = m + 1
else:
r = m - 1;
return ans
def main():
string = input().split()
n = int(string[0])
m = int(string[1])
a = [int(value) for value in input().split()]
b = [int(value) for value in input().split()]
a.sort()
b.sort(reverse = True)
sum_a = [0]*n
sum_a[0] = a[0]
for i in range(1, n):
sum_a[i] = sum_a[i - 1] + a[i]
sum_b = [0]*m
sum_b[0] = b[0]
for i in range(1, m):
sum_b[i] = sum_b[i - 1] + b[i]
if(a[0] >= b[0]):
print("0")
return
l = a[0];
r = b[0];
ans = 9223372036854775807
for i in range(n):
mid = a[i]
index_a = i
index_b = getIndexB(b, mid, 0, m - 1)
req_sum_a = mid*(index_a + 1) - sum_a[index_a]
req_sum_b = 0;
if(index_b != -1):
req_sum_b = req_sum_b + sum_b[index_b]
req_sum_b = req_sum_b - (mid*(index_b + 1))
if(req_sum_a + req_sum_b <= ans):
ans = req_sum_b + req_sum_a
for i in range(m):
mid = b[i]
index_a = getIndexA(a, mid, 0, n - 1)
index_b = i
req_sum_a = mid*(index_a + 1)
if(index_a != -1):
req_sum_a = req_sum_a - sum_a[index_a]
req_sum_b = sum_b[index_b] - (mid*(index_b + 1))
if(req_sum_a + req_sum_b <= ans):
ans = req_sum_b + req_sum_a
print(ans)
main()
|
Title: Devu and his Brother
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Devu and his brother love each other a lot. As they are super geeks, they only like to play with arrays. They are given two arrays *a* and *b* by their father. The array *a* is given to Devu and *b* to his brother.
As Devu is really a naughty kid, he wants the minimum value of his array *a* should be at least as much as the maximum value of his brother's array *b*.
Now you have to help Devu in achieving this condition. You can perform multiple operations on the arrays. In a single operation, you are allowed to decrease or increase any element of any of the arrays by 1. Note that you are allowed to apply the operation on any index of the array multiple times.
You need to find minimum number of operations required to satisfy Devu's condition so that the brothers can play peacefully without fighting.
Input Specification:
The first line contains two space-separated integers *n*, *m* (1<=≤<=*n*,<=*m*<=≤<=105). The second line will contain *n* space-separated integers representing content of the array *a* (1<=≤<=*a**i*<=≤<=109). The third line will contain *m* space-separated integers representing content of the array *b* (1<=≤<=*b**i*<=≤<=109).
Output Specification:
You need to output a single integer representing the minimum number of operations needed to satisfy Devu's condition.
Demo Input:
['2 2\n2 3\n3 5\n', '3 2\n1 2 3\n3 4\n', '3 2\n4 5 6\n1 2\n']
Demo Output:
['3\n', '4\n', '0\n']
Note:
In example 1, you can increase *a*<sub class="lower-index">1</sub> by 1 and decrease *b*<sub class="lower-index">2</sub> by 1 and then again decrease *b*<sub class="lower-index">2</sub> by 1. Now array *a* will be [3; 3] and array *b* will also be [3; 3]. Here minimum element of *a* is at least as large as maximum element of *b*. So minimum number of operations needed to satisfy Devu's condition are 3.
In example 3, you don't need to do any operation, Devu's condition is already satisfied.
|
```python
def getIndexA(a, value, l, r):
ans = -1;
while(l <= r):
m = int(( l + r )/2);
if(a[m] < value):
ans = m;
l = m + 1
else:
r = m - 1;
return ans
def getIndexB(b, value, l, r):
ans = -1;
while(l <= r):
m = int(( l + r )/2);
if(b[m] > value):
ans = m;
l = m + 1
else:
r = m - 1;
return ans
def main():
string = input().split()
n = int(string[0])
m = int(string[1])
a = [int(value) for value in input().split()]
b = [int(value) for value in input().split()]
a.sort()
b.sort(reverse = True)
sum_a = [0]*n
sum_a[0] = a[0]
for i in range(1, n):
sum_a[i] = sum_a[i - 1] + a[i]
sum_b = [0]*m
sum_b[0] = b[0]
for i in range(1, m):
sum_b[i] = sum_b[i - 1] + b[i]
if(a[0] >= b[0]):
print("0")
return
l = a[0];
r = b[0];
ans = 9223372036854775807
for i in range(n):
mid = a[i]
index_a = i
index_b = getIndexB(b, mid, 0, m - 1)
req_sum_a = mid*(index_a + 1) - sum_a[index_a]
req_sum_b = 0;
if(index_b != -1):
req_sum_b = req_sum_b + sum_b[index_b]
req_sum_b = req_sum_b - (mid*(index_b + 1))
if(req_sum_a + req_sum_b <= ans):
ans = req_sum_b + req_sum_a
for i in range(m):
mid = b[i]
index_a = getIndexA(a, mid, 0, n - 1)
index_b = i
req_sum_a = mid*(index_a + 1)
if(index_a != -1):
req_sum_a = req_sum_a - sum_a[index_a]
req_sum_b = sum_b[index_b] - (mid*(index_b + 1))
if(req_sum_a + req_sum_b <= ans):
ans = req_sum_b + req_sum_a
print(ans)
main()
```
| 3 |
|
894 |
A
|
QAQ
|
PROGRAMMING
| 800 |
[
"brute force",
"dp"
] | null | null |
"QAQ" is a word to denote an expression of crying. Imagine "Q" as eyes with tears and "A" as a mouth.
Now Diamond has given Bort a string consisting of only uppercase English letters of length *n*. There is a great number of "QAQ" in the string (Diamond is so cute!).
Bort wants to know how many subsequences "QAQ" are in the string Diamond has given. Note that the letters "QAQ" don't have to be consecutive, but the order of letters should be exact.
|
The only line contains a string of length *n* (1<=≤<=*n*<=≤<=100). It's guaranteed that the string only contains uppercase English letters.
|
Print a single integer — the number of subsequences "QAQ" in the string.
|
[
"QAQAQYSYIOIWIN\n",
"QAQQQZZYNOIWIN\n"
] |
[
"4\n",
"3\n"
] |
In the first example there are 4 subsequences "QAQ": "QAQAQYSYIOIWIN", "QAQAQYSYIOIWIN", "QAQAQYSYIOIWIN", "QAQAQYSYIOIWIN".
| 500 |
[
{
"input": "QAQAQYSYIOIWIN",
"output": "4"
},
{
"input": "QAQQQZZYNOIWIN",
"output": "3"
},
{
"input": "QA",
"output": "0"
},
{
"input": "IAQVAQZLQBQVQFTQQQADAQJA",
"output": "24"
},
{
"input": "QQAAQASGAYAAAAKAKAQIQEAQAIAAIAQQQQQ",
"output": "378"
},
{
"input": "AMVFNFJIAVNQJWIVONQOAOOQSNQSONOASONAONQINAONAOIQONANOIQOANOQINAONOQINAONOXJCOIAQOAOQAQAQAQAQWWWAQQAQ",
"output": "1077"
},
{
"input": "AAQQAXBQQBQQXBNQRJAQKQNAQNQVDQASAGGANQQQQTJFFQQQTQQA",
"output": "568"
},
{
"input": "KAZXAVLPJQBQVQQQQQAPAQQGQTQVZQAAAOYA",
"output": "70"
},
{
"input": "W",
"output": "0"
},
{
"input": "DBA",
"output": "0"
},
{
"input": "RQAWNACASAAKAGAAAAQ",
"output": "10"
},
{
"input": "QJAWZAAOAAGIAAAAAOQATASQAEAAAAQFQQHPA",
"output": "111"
},
{
"input": "QQKWQAQAAAAAAAAGAAVAQUEQQUMQMAQQQNQLAMAAAUAEAAEMAAA",
"output": "411"
},
{
"input": "QQUMQAYAUAAGWAAAQSDAVAAQAAAASKQJJQQQQMAWAYYAAAAAAEAJAXWQQ",
"output": "625"
},
{
"input": "QORZOYAQ",
"output": "1"
},
{
"input": "QCQAQAGAWAQQQAQAVQAQQQQAQAQQQAQAAATQAAVAAAQQQQAAAUUQAQQNQQWQQWAQAAQQKQYAQAAQQQAAQRAQQQWBQQQQAPBAQGQA",
"output": "13174"
},
{
"input": "QQAQQAKQFAQLQAAWAMQAZQAJQAAQQOACQQAAAYANAQAQQAQAAQQAOBQQJQAQAQAQQQAAAAABQQQAVNZAQQQQAMQQAFAAEAQAQHQT",
"output": "10420"
},
{
"input": "AQEGQHQQKQAQQPQKAQQQAAAAQQQAQEQAAQAAQAQFSLAAQQAQOQQAVQAAAPQQAWAQAQAFQAXAQQQQTRLOQAQQJQNQXQQQQSQVDQQQ",
"output": "12488"
},
{
"input": "QNQKQQQLASQBAVQQQQAAQQOQRJQQAQQQEQZUOANAADAAQQJAQAQARAAAQQQEQBHTQAAQAAAAQQMKQQQIAOJJQQAQAAADADQUQQQA",
"output": "9114"
},
{
"input": "QQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ",
"output": "35937"
},
{
"input": "AMQQAAQAAQAAAAAAQQQBOAAANAAKQJCYQAE",
"output": "254"
},
{
"input": "AYQBAEQGAQEOAKGIXLQJAIAKQAAAQPUAJAKAATFWQQAOQQQUFQYAQQMQHOKAAJXGFCARAQSATHAUQQAATQJJQDQRAANQQAE",
"output": "2174"
},
{
"input": "AAQXAAQAYQAAAAGAQHVQYAGIVACADFAAQAAAAQZAAQMAKZAADQAQDAAQDAAAMQQOXYAQQQAKQBAAQQKAXQBJZDDLAAHQQ",
"output": "2962"
},
{
"input": "AYQQYAVAMNIAUAAKBBQVACWKTQSAQZAAQAAASZJAWBCAALAARHACQAKQQAQAARPAQAAQAQAAZQUSHQAMFVFZQQQQSAQQXAA",
"output": "2482"
},
{
"input": "LQMAQQARQAQBJQQQAGAAZQQXALQQAARQAQQQQAAQQAQQQAQQCAQQAQQAYQQQRAAZATQALYQQAAHHAAQHAAAAAAAAQQMAAQNAKQ",
"output": "7768"
},
{
"input": "MAQQWAQOYQMAAAQAQPQZAOAAQAUAQNAAQAAAITQSAQAKAQKAQQWSQAAQQAGUCDQMQWKQUXKWQQAAQQAAQQZQDQQQAABXQUUXQOA",
"output": "5422"
},
{
"input": "QTAAQDAQXAQQJQQQGAAAQQQQSBQZKAQQAQQQQEAQNUQBZCQLYQZQEQQAAQHQVAORKQVAQYQNASZQAARZAAGAAAAOQDCQ",
"output": "3024"
},
{
"input": "QQWAQQGQQUZQQQLZAAQYQXQVAQFQUAQZUQZZQUKBHSHTQYLQAOQXAQQGAQQTQOAQARQADAJRAAQPQAQQUQAUAMAUVQAAAQQAWQ",
"output": "4527"
},
{
"input": "QQAAQQAQVAQZQQQQAOEAQZPQIBQZACQQAFQQLAAQDATZQANHKYQQAQTAAFQRQAIQAJPWQAQTEIRXAEQQAYWAAAUKQQAQAQQQSQQH",
"output": "6416"
},
{
"input": "AQQQQAQAAQQAQAQAAAAAAAAAQAQAAAAAQAQAQQQAQQQAAAQQQAAAAAAAQAAAAQQQQQQQAQQQQAQAAAQAAAAAQAQAAAAAQAQAAAA",
"output": "14270"
},
{
"input": "AQQQQAQAAQQAQAQAAAAAAAAAQAQAAAAAQAQAQQQAQQQAAAQQQAAAAAAAQAAAAQQQQQQQAQQQQAQAAAQAAAAAQAQAAAAAQ",
"output": "13136"
},
{
"input": "AQQQQAQAAQQAQAQAAAAAAAAAQAQAAAAAQAQAQQQAQQQAAAQQQAAAAAAAQAAAAQQQQQQQAQQQQAQAAAQAAAAAQAQAAAAAQAQAA",
"output": "14270"
},
{
"input": "AQQQQAQAAQQAQAQAAAAAAAAAQAQAAAAAQAQAQQQAQQQAAAQQQAAAAAAAQAAAAQQQQQQQAQQQQAQAAAQAAAAAQAQAAAAAQQAA",
"output": "14231"
},
{
"input": "QQQQQAQAAQQAQAQAAAAAAAAAQAQAAAAAQAQAQQQAQQQAAAQQQAAAAAAAQAAAAQQQQQQQAQQQQAQAAAQAAAAAQAQAAAAAQAQAA",
"output": "15296"
},
{
"input": "AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ",
"output": "0"
},
{
"input": "QQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA",
"output": "0"
},
{
"input": "QQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ",
"output": "0"
},
{
"input": "QAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQA",
"output": "20825"
},
{
"input": "AQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQ",
"output": "20825"
},
{
"input": "Q",
"output": "0"
},
{
"input": "A",
"output": "0"
},
{
"input": "FFF",
"output": "0"
},
{
"input": "AAAAAA",
"output": "0"
}
] | 1,622,484,955 | 2,147,483,647 |
PyPy 3
|
OK
|
TESTS
| 43 | 156 | 1,536,000 |
import math
import sys
#from collections import deque, Counter, OrderedDict, defaultdict
#import heapq
#ceil,floor,log,sqrt,factorial,pow,pi,gcd
#import bisect
#from bisect import bisect_left,bisect_right
input = sys.stdin.readline
def inp():
return(int(input()))
def inlt():
return(list(map(int,input().split())))
def insr():
s = input().strip()
return(list(s[:len(s)]))
def invr():
return(map(int,input().split()))
s=insr()
cnt=0
for i in range(len(s)):
if s[i]=='Q':
for j in range(i+1,len(s)):
if s[j]=='A':
for k in range(j+1,len(s)):
if s[k]=='Q':
cnt+=1
print(cnt)
|
Title: QAQ
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
"QAQ" is a word to denote an expression of crying. Imagine "Q" as eyes with tears and "A" as a mouth.
Now Diamond has given Bort a string consisting of only uppercase English letters of length *n*. There is a great number of "QAQ" in the string (Diamond is so cute!).
Bort wants to know how many subsequences "QAQ" are in the string Diamond has given. Note that the letters "QAQ" don't have to be consecutive, but the order of letters should be exact.
Input Specification:
The only line contains a string of length *n* (1<=≤<=*n*<=≤<=100). It's guaranteed that the string only contains uppercase English letters.
Output Specification:
Print a single integer — the number of subsequences "QAQ" in the string.
Demo Input:
['QAQAQYSYIOIWIN\n', 'QAQQQZZYNOIWIN\n']
Demo Output:
['4\n', '3\n']
Note:
In the first example there are 4 subsequences "QAQ": "QAQAQYSYIOIWIN", "QAQAQYSYIOIWIN", "QAQAQYSYIOIWIN", "QAQAQYSYIOIWIN".
|
```python
import math
import sys
#from collections import deque, Counter, OrderedDict, defaultdict
#import heapq
#ceil,floor,log,sqrt,factorial,pow,pi,gcd
#import bisect
#from bisect import bisect_left,bisect_right
input = sys.stdin.readline
def inp():
return(int(input()))
def inlt():
return(list(map(int,input().split())))
def insr():
s = input().strip()
return(list(s[:len(s)]))
def invr():
return(map(int,input().split()))
s=insr()
cnt=0
for i in range(len(s)):
if s[i]=='Q':
for j in range(i+1,len(s)):
if s[j]=='A':
for k in range(j+1,len(s)):
if s[k]=='Q':
cnt+=1
print(cnt)
```
| 3 |
|
404 |
A
|
Valera and X
|
PROGRAMMING
| 1,000 |
[
"implementation"
] | null | null |
Valera is a little boy. Yesterday he got a huge Math hometask at school, so Valera didn't have enough time to properly learn the English alphabet for his English lesson. Unfortunately, the English teacher decided to have a test on alphabet today. At the test Valera got a square piece of squared paper. The length of the side equals *n* squares (*n* is an odd number) and each unit square contains some small letter of the English alphabet.
Valera needs to know if the letters written on the square piece of paper form letter "X". Valera's teacher thinks that the letters on the piece of paper form an "X", if:
- on both diagonals of the square paper all letters are the same; - all other squares of the paper (they are not on the diagonals) contain the same letter that is different from the letters on the diagonals.
Help Valera, write the program that completes the described task for him.
|
The first line contains integer *n* (3<=≤<=*n*<=<<=300; *n* is odd). Each of the next *n* lines contains *n* small English letters — the description of Valera's paper.
|
Print string "YES", if the letters on the paper form letter "X". Otherwise, print string "NO". Print the strings without quotes.
|
[
"5\nxooox\noxoxo\nsoxoo\noxoxo\nxooox\n",
"3\nwsw\nsws\nwsw\n",
"3\nxpx\npxp\nxpe\n"
] |
[
"NO\n",
"YES\n",
"NO\n"
] |
none
| 500 |
[
{
"input": "5\nxooox\noxoxo\nsoxoo\noxoxo\nxooox",
"output": "NO"
},
{
"input": "3\nwsw\nsws\nwsw",
"output": "YES"
},
{
"input": "3\nxpx\npxp\nxpe",
"output": "NO"
},
{
"input": "5\nliiil\nilili\niilii\nilili\nliiil",
"output": "YES"
},
{
"input": "7\nbwccccb\nckcccbj\nccbcbcc\ncccbccc\nccbcbcc\ncbcccbc\nbccccdt",
"output": "NO"
},
{
"input": "13\nsooooooooooos\nosoooooooooso\noosooooooosoo\nooosooooosooo\noooosooosoooo\nooooososooooo\noooooosoooooo\nooooososooooo\noooosooosoooo\nooosooooosooo\noosooooooosoo\nosoooooooooso\nsooooooooooos",
"output": "YES"
},
{
"input": "3\naaa\naaa\naaa",
"output": "NO"
},
{
"input": "3\naca\noec\nzba",
"output": "NO"
},
{
"input": "15\nrxeeeeeeeeeeeer\nereeeeeeeeeeere\needeeeeeeeeeoee\neeereeeeeeeewee\neeeereeeeebeeee\nqeeeereeejedyee\neeeeeerereeeeee\neeeeeeereeeeeee\neeeeeerereeeeze\neeeeereeereeeee\neeeereeeeegeeee\neeereeeeeeereee\neereeeeeeqeeved\ncreeeeeeceeeere\nreeerneeeeeeeer",
"output": "NO"
},
{
"input": "5\nxxxxx\nxxxxx\nxxxxx\nxxxxx\nxxxxx",
"output": "NO"
},
{
"input": "5\nxxxxx\nxxxxx\nxoxxx\nxxxxx\nxxxxx",
"output": "NO"
},
{
"input": "5\noxxxo\nxoxox\nxxxxx\nxoxox\noxxxo",
"output": "NO"
},
{
"input": "5\noxxxo\nxoxox\nxxoox\nxoxox\noxxxo",
"output": "NO"
},
{
"input": "5\noxxxo\nxoxox\nxxaxx\nxoxox\noxxxo",
"output": "NO"
},
{
"input": "5\noxxxo\nxoxox\noxoxx\nxoxox\noxxxo",
"output": "NO"
},
{
"input": "3\nxxx\naxa\nxax",
"output": "NO"
},
{
"input": "3\nxax\naxx\nxax",
"output": "NO"
},
{
"input": "3\nxax\naxa\nxxx",
"output": "NO"
},
{
"input": "3\nxax\nxxa\nxax",
"output": "NO"
},
{
"input": "3\nxax\naaa\nxax",
"output": "NO"
},
{
"input": "3\naax\naxa\nxax",
"output": "NO"
},
{
"input": "3\nxaa\naxa\nxax",
"output": "NO"
},
{
"input": "3\nxax\naxa\naax",
"output": "NO"
},
{
"input": "3\nxax\naxa\nxaa",
"output": "NO"
},
{
"input": "3\nxfx\naxa\nxax",
"output": "NO"
},
{
"input": "3\nxax\nafa\nxax",
"output": "NO"
},
{
"input": "3\nxax\naxa\nxaf",
"output": "NO"
},
{
"input": "3\nxox\nxxx\nxxx",
"output": "NO"
},
{
"input": "3\naxa\naax\nxxa",
"output": "NO"
},
{
"input": "3\nxox\noxx\nxox",
"output": "NO"
},
{
"input": "3\nxox\nooo\nxox",
"output": "NO"
},
{
"input": "3\naaa\naab\nbbb",
"output": "NO"
},
{
"input": "3\nxxx\nsxs\nxsx",
"output": "NO"
},
{
"input": "5\nabbba\nbabab\nbbbbb\nbaaab\nabbba",
"output": "NO"
},
{
"input": "5\nabaaa\nbbbbb\nbbabb\nbabab\nabbba",
"output": "NO"
},
{
"input": "5\nxoxox\noxoxo\nooxoo\noxoxo\nxooox",
"output": "NO"
},
{
"input": "3\nxox\noxx\nxxx",
"output": "NO"
},
{
"input": "5\nxoooo\noxooo\nooxoo\noooxo\noooox",
"output": "NO"
},
{
"input": "5\nxoooo\noxoxx\nooxoo\noxoxo\noxoox",
"output": "NO"
},
{
"input": "3\naaa\nbab\naba",
"output": "NO"
}
] | 1,601,689,108 | 2,147,483,647 |
Python 3
|
OK
|
TESTS
| 47 | 109 | 1,228,800 |
n = int(input())
s = ''
for i in range(n):
s = s + input()
#if the count of diagonal elemtns is same as 2*n-1 and on reversing the string string remains same then answer is yes
if list(s)==list(s)[::-1] and s.count(s[0])==(2*n-1):
print("YES")
else:
print("NO")
|
Title: Valera and X
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Valera is a little boy. Yesterday he got a huge Math hometask at school, so Valera didn't have enough time to properly learn the English alphabet for his English lesson. Unfortunately, the English teacher decided to have a test on alphabet today. At the test Valera got a square piece of squared paper. The length of the side equals *n* squares (*n* is an odd number) and each unit square contains some small letter of the English alphabet.
Valera needs to know if the letters written on the square piece of paper form letter "X". Valera's teacher thinks that the letters on the piece of paper form an "X", if:
- on both diagonals of the square paper all letters are the same; - all other squares of the paper (they are not on the diagonals) contain the same letter that is different from the letters on the diagonals.
Help Valera, write the program that completes the described task for him.
Input Specification:
The first line contains integer *n* (3<=≤<=*n*<=<<=300; *n* is odd). Each of the next *n* lines contains *n* small English letters — the description of Valera's paper.
Output Specification:
Print string "YES", if the letters on the paper form letter "X". Otherwise, print string "NO". Print the strings without quotes.
Demo Input:
['5\nxooox\noxoxo\nsoxoo\noxoxo\nxooox\n', '3\nwsw\nsws\nwsw\n', '3\nxpx\npxp\nxpe\n']
Demo Output:
['NO\n', 'YES\n', 'NO\n']
Note:
none
|
```python
n = int(input())
s = ''
for i in range(n):
s = s + input()
#if the count of diagonal elemtns is same as 2*n-1 and on reversing the string string remains same then answer is yes
if list(s)==list(s)[::-1] and s.count(s[0])==(2*n-1):
print("YES")
else:
print("NO")
```
| 3 |
|
961 |
B
|
Lecture Sleep
|
PROGRAMMING
| 1,200 |
[
"data structures",
"dp",
"implementation",
"two pointers"
] | null | null |
Your friend Mishka and you attend a calculus lecture. Lecture lasts *n* minutes. Lecturer tells *a**i* theorems during the *i*-th minute.
Mishka is really interested in calculus, though it is so hard to stay awake for all the time of lecture. You are given an array *t* of Mishka's behavior. If Mishka is asleep during the *i*-th minute of the lecture then *t**i* will be equal to 0, otherwise it will be equal to 1. When Mishka is awake he writes down all the theorems he is being told — *a**i* during the *i*-th minute. Otherwise he writes nothing.
You know some secret technique to keep Mishka awake for *k* minutes straight. However you can use it only once. You can start using it at the beginning of any minute between 1 and *n*<=-<=*k*<=+<=1. If you use it on some minute *i* then Mishka will be awake during minutes *j* such that and will write down all the theorems lecturer tells.
You task is to calculate the maximum number of theorems Mishka will be able to write down if you use your technique only once to wake him up.
|
The first line of the input contains two integer numbers *n* and *k* (1<=≤<=*k*<=≤<=*n*<=≤<=105) — the duration of the lecture in minutes and the number of minutes you can keep Mishka awake.
The second line of the input contains *n* integer numbers *a*1,<=*a*2,<=... *a**n* (1<=≤<=*a**i*<=≤<=104) — the number of theorems lecturer tells during the *i*-th minute.
The third line of the input contains *n* integer numbers *t*1,<=*t*2,<=... *t**n* (0<=≤<=*t**i*<=≤<=1) — type of Mishka's behavior at the *i*-th minute of the lecture.
|
Print only one integer — the maximum number of theorems Mishka will be able to write down if you use your technique only once to wake him up.
|
[
"6 3\n1 3 5 2 5 4\n1 1 0 1 0 0\n"
] |
[
"16\n"
] |
In the sample case the better way is to use the secret technique at the beginning of the third minute. Then the number of theorems Mishka will be able to write down will be equal to 16.
| 0 |
[
{
"input": "6 3\n1 3 5 2 5 4\n1 1 0 1 0 0",
"output": "16"
},
{
"input": "5 3\n1 9999 10000 10000 10000\n0 0 0 0 0",
"output": "30000"
},
{
"input": "3 3\n10 10 10\n1 1 0",
"output": "30"
},
{
"input": "1 1\n423\n0",
"output": "423"
},
{
"input": "6 6\n1 3 5 2 5 4\n1 1 0 1 0 0",
"output": "20"
},
{
"input": "5 2\n1 2 3 4 20\n0 0 0 1 0",
"output": "24"
},
{
"input": "3 1\n1 2 3\n0 0 1",
"output": "5"
},
{
"input": "4 2\n4 5 6 8\n1 0 1 0",
"output": "18"
},
{
"input": "6 3\n1 3 5 2 1 15\n1 1 0 1 0 0",
"output": "22"
},
{
"input": "5 5\n1 2 3 4 5\n1 1 1 0 1",
"output": "15"
},
{
"input": "3 3\n3 3 3\n1 0 1",
"output": "9"
},
{
"input": "5 5\n500 44 3 4 50\n1 0 0 0 0",
"output": "601"
},
{
"input": "2 2\n3 2\n1 0",
"output": "5"
},
{
"input": "7 6\n4 9 1 7 1 8 4\n0 0 0 1 0 1 0",
"output": "30"
},
{
"input": "4 3\n6 5 9 6\n1 1 0 1",
"output": "26"
},
{
"input": "2 1\n3 2\n0 0",
"output": "3"
},
{
"input": "1 1\n10\n0",
"output": "10"
},
{
"input": "2 1\n3 2\n1 0",
"output": "5"
},
{
"input": "4 2\n3 6 7 2\n0 0 1 1",
"output": "18"
},
{
"input": "10 5\n3 5 9 2 5 9 3 8 8 1\n0 1 1 1 0 1 0 0 0 0",
"output": "49"
},
{
"input": "10 4\n9 5 6 4 3 9 5 1 10 7\n0 0 0 0 0 0 1 0 0 1",
"output": "36"
},
{
"input": "9 8\n3 3 7 7 1 9 10 7 1\n1 1 1 1 1 1 1 1 1",
"output": "48"
},
{
"input": "2 1\n3 4\n0 0",
"output": "4"
},
{
"input": "2 1\n3 2\n0 1",
"output": "5"
},
{
"input": "10 1\n6 6 8 7 6 6 3 2 5 6\n0 0 1 0 0 1 0 1 1 1",
"output": "34"
},
{
"input": "3 2\n10 10 6\n0 0 0",
"output": "20"
},
{
"input": "6 3\n1 3 5 2 5 4\n1 1 1 1 1 1",
"output": "20"
},
{
"input": "10 5\n1 1 1 1 1 1 1 1 10000 1\n1 1 1 1 1 1 1 1 0 1",
"output": "10009"
}
] | 1,668,435,983 | 2,147,483,647 |
PyPy 3-64
|
OK
|
TESTS
| 37 | 109 | 19,251,200 |
n,k=map(int,input().split())
# s=(input().strip())
# t=(input().strip())
val=list(map(int,input().split()))
# s=list(map(int,input()))
bi=list(map(int,input().split()))
i=0;j=0;ans=0;mx=-1
while j<n:
if bi[j]==0:
ans+=val[j]
if j-i+1<k:
j+=1
elif j-i+1==k:
mx=max(mx,ans)
if bi[i]==0:
ans-=val[i]
i+=1
j+=1
if mx==-1:mx=0
for i in range(n):
if bi[i]==1:
mx+=val[i]
print(mx)
|
Title: Lecture Sleep
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Your friend Mishka and you attend a calculus lecture. Lecture lasts *n* minutes. Lecturer tells *a**i* theorems during the *i*-th minute.
Mishka is really interested in calculus, though it is so hard to stay awake for all the time of lecture. You are given an array *t* of Mishka's behavior. If Mishka is asleep during the *i*-th minute of the lecture then *t**i* will be equal to 0, otherwise it will be equal to 1. When Mishka is awake he writes down all the theorems he is being told — *a**i* during the *i*-th minute. Otherwise he writes nothing.
You know some secret technique to keep Mishka awake for *k* minutes straight. However you can use it only once. You can start using it at the beginning of any minute between 1 and *n*<=-<=*k*<=+<=1. If you use it on some minute *i* then Mishka will be awake during minutes *j* such that and will write down all the theorems lecturer tells.
You task is to calculate the maximum number of theorems Mishka will be able to write down if you use your technique only once to wake him up.
Input Specification:
The first line of the input contains two integer numbers *n* and *k* (1<=≤<=*k*<=≤<=*n*<=≤<=105) — the duration of the lecture in minutes and the number of minutes you can keep Mishka awake.
The second line of the input contains *n* integer numbers *a*1,<=*a*2,<=... *a**n* (1<=≤<=*a**i*<=≤<=104) — the number of theorems lecturer tells during the *i*-th minute.
The third line of the input contains *n* integer numbers *t*1,<=*t*2,<=... *t**n* (0<=≤<=*t**i*<=≤<=1) — type of Mishka's behavior at the *i*-th minute of the lecture.
Output Specification:
Print only one integer — the maximum number of theorems Mishka will be able to write down if you use your technique only once to wake him up.
Demo Input:
['6 3\n1 3 5 2 5 4\n1 1 0 1 0 0\n']
Demo Output:
['16\n']
Note:
In the sample case the better way is to use the secret technique at the beginning of the third minute. Then the number of theorems Mishka will be able to write down will be equal to 16.
|
```python
n,k=map(int,input().split())
# s=(input().strip())
# t=(input().strip())
val=list(map(int,input().split()))
# s=list(map(int,input()))
bi=list(map(int,input().split()))
i=0;j=0;ans=0;mx=-1
while j<n:
if bi[j]==0:
ans+=val[j]
if j-i+1<k:
j+=1
elif j-i+1==k:
mx=max(mx,ans)
if bi[i]==0:
ans-=val[i]
i+=1
j+=1
if mx==-1:mx=0
for i in range(n):
if bi[i]==1:
mx+=val[i]
print(mx)
```
| 3 |
|
122 |
A
|
Lucky Division
|
PROGRAMMING
| 1,000 |
[
"brute force",
"number theory"
] | null | null |
Petya loves lucky numbers. Everybody knows that lucky numbers are positive integers whose decimal representation contains only the lucky digits 4 and 7. For example, numbers 47, 744, 4 are lucky and 5, 17, 467 are not.
Petya calls a number almost lucky if it could be evenly divided by some lucky number. Help him find out if the given number *n* is almost lucky.
|
The single line contains an integer *n* (1<=≤<=*n*<=≤<=1000) — the number that needs to be checked.
|
In the only line print "YES" (without the quotes), if number *n* is almost lucky. Otherwise, print "NO" (without the quotes).
|
[
"47\n",
"16\n",
"78\n"
] |
[
"YES\n",
"YES\n",
"NO\n"
] |
Note that all lucky numbers are almost lucky as any number is evenly divisible by itself.
In the first sample 47 is a lucky number. In the second sample 16 is divisible by 4.
| 500 |
[
{
"input": "47",
"output": "YES"
},
{
"input": "16",
"output": "YES"
},
{
"input": "78",
"output": "NO"
},
{
"input": "48",
"output": "YES"
},
{
"input": "100",
"output": "YES"
},
{
"input": "107",
"output": "NO"
},
{
"input": "77",
"output": "YES"
},
{
"input": "477",
"output": "YES"
},
{
"input": "480",
"output": "YES"
},
{
"input": "1",
"output": "NO"
},
{
"input": "3",
"output": "NO"
},
{
"input": "4",
"output": "YES"
},
{
"input": "49",
"output": "YES"
},
{
"input": "56",
"output": "YES"
},
{
"input": "124",
"output": "YES"
},
{
"input": "1000",
"output": "YES"
},
{
"input": "999",
"output": "NO"
},
{
"input": "298",
"output": "NO"
},
{
"input": "274",
"output": "NO"
},
{
"input": "998",
"output": "NO"
},
{
"input": "42",
"output": "YES"
},
{
"input": "788",
"output": "YES"
},
{
"input": "70",
"output": "YES"
},
{
"input": "444",
"output": "YES"
},
{
"input": "777",
"output": "YES"
},
{
"input": "799",
"output": "YES"
},
{
"input": "25",
"output": "NO"
},
{
"input": "882",
"output": "YES"
},
{
"input": "88",
"output": "YES"
},
{
"input": "11",
"output": "NO"
},
{
"input": "2",
"output": "NO"
},
{
"input": "7",
"output": "YES"
},
{
"input": "8",
"output": "YES"
},
{
"input": "94",
"output": "YES"
},
{
"input": "477",
"output": "YES"
},
{
"input": "141",
"output": "YES"
}
] | 1,696,659,849 | 2,147,483,647 |
Python 3
|
OK
|
TESTS
| 36 | 92 | 0 |
n = int(input())
a = []
for i in range(1, 1001):
k = 0
for j in str(i):
if int(j) in [0, 1, 2, 3, 5, 6, 8, 9]:
k += 1
break
if k == 0:
a.append(i)
for i in a:
if n % i == 0:
print('YES')
quit()
print('NO')
|
Title: Lucky Division
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Petya loves lucky numbers. Everybody knows that lucky numbers are positive integers whose decimal representation contains only the lucky digits 4 and 7. For example, numbers 47, 744, 4 are lucky and 5, 17, 467 are not.
Petya calls a number almost lucky if it could be evenly divided by some lucky number. Help him find out if the given number *n* is almost lucky.
Input Specification:
The single line contains an integer *n* (1<=≤<=*n*<=≤<=1000) — the number that needs to be checked.
Output Specification:
In the only line print "YES" (without the quotes), if number *n* is almost lucky. Otherwise, print "NO" (without the quotes).
Demo Input:
['47\n', '16\n', '78\n']
Demo Output:
['YES\n', 'YES\n', 'NO\n']
Note:
Note that all lucky numbers are almost lucky as any number is evenly divisible by itself.
In the first sample 47 is a lucky number. In the second sample 16 is divisible by 4.
|
```python
n = int(input())
a = []
for i in range(1, 1001):
k = 0
for j in str(i):
if int(j) in [0, 1, 2, 3, 5, 6, 8, 9]:
k += 1
break
if k == 0:
a.append(i)
for i in a:
if n % i == 0:
print('YES')
quit()
print('NO')
```
| 3 |
|
362 |
B
|
Petya and Staircases
|
PROGRAMMING
| 1,100 |
[
"implementation",
"sortings"
] | null | null |
Little boy Petya loves stairs very much. But he is bored from simple going up and down them — he loves jumping over several stairs at a time. As he stands on some stair, he can either jump to the next one or jump over one or two stairs at a time. But some stairs are too dirty and Petya doesn't want to step on them.
Now Petya is on the first stair of the staircase, consisting of *n* stairs. He also knows the numbers of the dirty stairs of this staircase. Help Petya find out if he can jump through the entire staircase and reach the last stair number *n* without touching a dirty stair once.
One has to note that anyway Petya should step on the first and last stairs, so if the first or the last stair is dirty, then Petya cannot choose a path with clean steps only.
|
The first line contains two integers *n* and *m* (1<=≤<=*n*<=≤<=109, 0<=≤<=*m*<=≤<=3000) — the number of stairs in the staircase and the number of dirty stairs, correspondingly. The second line contains *m* different space-separated integers *d*1,<=*d*2,<=...,<=*d**m* (1<=≤<=*d**i*<=≤<=*n*) — the numbers of the dirty stairs (in an arbitrary order).
|
Print "YES" if Petya can reach stair number *n*, stepping only on the clean stairs. Otherwise print "NO".
|
[
"10 5\n2 4 8 3 6\n",
"10 5\n2 4 5 7 9\n"
] |
[
"NO",
"YES"
] |
none
| 500 |
[
{
"input": "10 5\n2 4 8 3 6",
"output": "NO"
},
{
"input": "10 5\n2 4 5 7 9",
"output": "YES"
},
{
"input": "10 9\n2 3 4 5 6 7 8 9 10",
"output": "NO"
},
{
"input": "5 2\n4 5",
"output": "NO"
},
{
"input": "123 13\n36 73 111 2 92 5 47 55 48 113 7 78 37",
"output": "YES"
},
{
"input": "10 10\n7 6 4 2 5 10 8 3 9 1",
"output": "NO"
},
{
"input": "12312 0",
"output": "YES"
},
{
"input": "9817239 1\n6323187",
"output": "YES"
},
{
"input": "1 1\n1",
"output": "NO"
},
{
"input": "5 4\n4 2 5 1",
"output": "NO"
},
{
"input": "5 3\n4 3 5",
"output": "NO"
},
{
"input": "500 3\n18 62 445",
"output": "YES"
},
{
"input": "500 50\n72 474 467 241 442 437 336 234 410 120 438 164 405 177 142 114 27 20 445 235 46 176 88 488 242 391 28 414 145 92 206 334 152 343 367 254 100 243 155 348 148 450 461 483 97 34 471 69 416 362",
"output": "NO"
},
{
"input": "500 8\n365 313 338 410 482 417 325 384",
"output": "YES"
},
{
"input": "1000000000 10\n2 3 5 6 8 9 123 874 1230 1000000000",
"output": "NO"
},
{
"input": "1000000000 10\n1 2 3 5 6 8 9 123 874 1230",
"output": "NO"
},
{
"input": "10 1\n1",
"output": "NO"
},
{
"input": "10 4\n1 2 4 5",
"output": "NO"
},
{
"input": "50 20\n22 33 17 23 27 5 26 31 41 20 8 24 6 3 4 29 40 25 13 16",
"output": "NO"
},
{
"input": "50 40\n14 27 19 30 31 20 28 11 37 29 23 33 7 26 22 16 1 6 18 3 47 36 38 2 48 9 41 8 5 50 4 45 44 25 39 12 43 42 40 46",
"output": "NO"
},
{
"input": "123 12\n35 95 47 99 79 122 58 94 31 57 18 10",
"output": "YES"
},
{
"input": "10 5\n1 3 5 7 9",
"output": "NO"
},
{
"input": "100 7\n2 3 5 6 8 9 100",
"output": "NO"
},
{
"input": "100 3\n98 99 100",
"output": "NO"
},
{
"input": "100 3\n97 98 99",
"output": "NO"
},
{
"input": "100 3\n96 98 99",
"output": "YES"
},
{
"input": "10 6\n2 3 5 6 8 9",
"output": "YES"
},
{
"input": "1000000000 10\n2 4 10 18 40 42 49 58 59 60",
"output": "NO"
},
{
"input": "10 3\n1 4 6",
"output": "NO"
},
{
"input": "8 3\n2 3 4",
"output": "NO"
},
{
"input": "100 3\n4 5 6",
"output": "NO"
},
{
"input": "10 2\n10 1",
"output": "NO"
},
{
"input": "10 1\n10",
"output": "NO"
},
{
"input": "4 2\n2 3",
"output": "YES"
},
{
"input": "2 1\n1",
"output": "NO"
},
{
"input": "2 0",
"output": "YES"
},
{
"input": "4 3\n2 3 4",
"output": "NO"
},
{
"input": "5 3\n4 2 3",
"output": "NO"
}
] | 1,632,104,336 | 2,147,483,647 |
Python 3
|
TIME_LIMIT_EXCEEDED
|
TESTS
| 4 | 1,000 | 7,065,600 |
#362B (100No. Problem B)
n,d = map(int,input().split())
stair = sorted(list(map(int,input().split())))
# print(stair)
i = 1
res = "YES"
if (i in stair):
print("NO")
else:
while i < n:
if i+3 not in stair and i+3 <= n:
i+=3
elif i+2 not in stair and i+2 <= n:
i+=2
elif i+1 not in stair and i+1 <= n:
i+=1
else:
res = "NO"
break
# print(i)
print(res)
|
Title: Petya and Staircases
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Little boy Petya loves stairs very much. But he is bored from simple going up and down them — he loves jumping over several stairs at a time. As he stands on some stair, he can either jump to the next one or jump over one or two stairs at a time. But some stairs are too dirty and Petya doesn't want to step on them.
Now Petya is on the first stair of the staircase, consisting of *n* stairs. He also knows the numbers of the dirty stairs of this staircase. Help Petya find out if he can jump through the entire staircase and reach the last stair number *n* without touching a dirty stair once.
One has to note that anyway Petya should step on the first and last stairs, so if the first or the last stair is dirty, then Petya cannot choose a path with clean steps only.
Input Specification:
The first line contains two integers *n* and *m* (1<=≤<=*n*<=≤<=109, 0<=≤<=*m*<=≤<=3000) — the number of stairs in the staircase and the number of dirty stairs, correspondingly. The second line contains *m* different space-separated integers *d*1,<=*d*2,<=...,<=*d**m* (1<=≤<=*d**i*<=≤<=*n*) — the numbers of the dirty stairs (in an arbitrary order).
Output Specification:
Print "YES" if Petya can reach stair number *n*, stepping only on the clean stairs. Otherwise print "NO".
Demo Input:
['10 5\n2 4 8 3 6\n', '10 5\n2 4 5 7 9\n']
Demo Output:
['NO', 'YES']
Note:
none
|
```python
#362B (100No. Problem B)
n,d = map(int,input().split())
stair = sorted(list(map(int,input().split())))
# print(stair)
i = 1
res = "YES"
if (i in stair):
print("NO")
else:
while i < n:
if i+3 not in stair and i+3 <= n:
i+=3
elif i+2 not in stair and i+2 <= n:
i+=2
elif i+1 not in stair and i+1 <= n:
i+=1
else:
res = "NO"
break
# print(i)
print(res)
```
| 0 |
|
620 |
A
|
Professor GukiZ's Robot
|
PROGRAMMING
| 800 |
[
"implementation",
"math"
] | null | null |
Professor GukiZ makes a new robot. The robot are in the point with coordinates (*x*1,<=*y*1) and should go to the point (*x*2,<=*y*2). In a single step the robot can change any of its coordinates (maybe both of them) by one (decrease or increase). So the robot can move in one of the 8 directions. Find the minimal number of steps the robot should make to get the finish position.
|
The first line contains two integers *x*1,<=*y*1 (<=-<=109<=≤<=*x*1,<=*y*1<=≤<=109) — the start position of the robot.
The second line contains two integers *x*2,<=*y*2 (<=-<=109<=≤<=*x*2,<=*y*2<=≤<=109) — the finish position of the robot.
|
Print the only integer *d* — the minimal number of steps to get the finish position.
|
[
"0 0\n4 5\n",
"3 4\n6 1\n"
] |
[
"5\n",
"3\n"
] |
In the first example robot should increase both of its coordinates by one four times, so it will be in position (4, 4). After that robot should simply increase its *y* coordinate and get the finish position.
In the second example robot should simultaneously increase *x* coordinate and decrease *y* coordinate by one three times.
| 0 |
[
{
"input": "0 0\n4 5",
"output": "5"
},
{
"input": "3 4\n6 1",
"output": "3"
},
{
"input": "0 0\n4 6",
"output": "6"
},
{
"input": "1 1\n-3 -5",
"output": "6"
},
{
"input": "-1 -1\n-10 100",
"output": "101"
},
{
"input": "1 -1\n100 -100",
"output": "99"
},
{
"input": "-1000000000 -1000000000\n1000000000 1000000000",
"output": "2000000000"
},
{
"input": "-1000000000 -1000000000\n0 999999999",
"output": "1999999999"
},
{
"input": "0 0\n2 1",
"output": "2"
},
{
"input": "10 0\n100 0",
"output": "90"
},
{
"input": "1 5\n6 4",
"output": "5"
},
{
"input": "0 0\n5 4",
"output": "5"
},
{
"input": "10 1\n20 1",
"output": "10"
},
{
"input": "1 1\n-3 4",
"output": "4"
},
{
"input": "-863407280 504312726\n786535210 -661703810",
"output": "1649942490"
},
{
"input": "-588306085 -741137832\n341385643 152943311",
"output": "929691728"
},
{
"input": "0 0\n4 0",
"output": "4"
},
{
"input": "93097194 -48405232\n-716984003 -428596062",
"output": "810081197"
},
{
"input": "9 1\n1 1",
"output": "8"
},
{
"input": "4 6\n0 4",
"output": "4"
},
{
"input": "2 4\n5 2",
"output": "3"
},
{
"input": "-100000000 -100000000\n100000000 100000123",
"output": "200000123"
},
{
"input": "5 6\n5 7",
"output": "1"
},
{
"input": "12 16\n12 1",
"output": "15"
},
{
"input": "0 0\n5 1",
"output": "5"
},
{
"input": "0 1\n1 1",
"output": "1"
},
{
"input": "-44602634 913365223\n-572368780 933284951",
"output": "527766146"
},
{
"input": "-2 0\n2 -2",
"output": "4"
},
{
"input": "0 0\n3 1",
"output": "3"
},
{
"input": "-458 2\n1255 4548",
"output": "4546"
},
{
"input": "-5 -4\n-3 -3",
"output": "2"
},
{
"input": "4 5\n7 3",
"output": "3"
},
{
"input": "-1000000000 -999999999\n1000000000 999999998",
"output": "2000000000"
},
{
"input": "-1000000000 -1000000000\n1000000000 -1000000000",
"output": "2000000000"
},
{
"input": "-464122675 -898521847\n656107323 -625340409",
"output": "1120229998"
},
{
"input": "-463154699 -654742385\n-699179052 -789004997",
"output": "236024353"
},
{
"input": "982747270 -593488945\n342286841 -593604186",
"output": "640460429"
},
{
"input": "-80625246 708958515\n468950878 574646184",
"output": "549576124"
},
{
"input": "0 0\n1 0",
"output": "1"
},
{
"input": "109810 1\n2 3",
"output": "109808"
},
{
"input": "-9 0\n9 9",
"output": "18"
},
{
"input": "9 9\n9 9",
"output": "0"
},
{
"input": "1 1\n4 3",
"output": "3"
},
{
"input": "1 2\n45 1",
"output": "44"
},
{
"input": "207558188 -313753260\n-211535387 -721675423",
"output": "419093575"
},
{
"input": "-11 0\n0 0",
"output": "11"
},
{
"input": "-1000000000 1000000000\n1000000000 -1000000000",
"output": "2000000000"
},
{
"input": "0 0\n1 1",
"output": "1"
},
{
"input": "0 0\n0 1",
"output": "1"
},
{
"input": "0 0\n-1 1",
"output": "1"
},
{
"input": "0 0\n-1 0",
"output": "1"
},
{
"input": "0 0\n-1 -1",
"output": "1"
},
{
"input": "0 0\n0 -1",
"output": "1"
},
{
"input": "0 0\n1 -1",
"output": "1"
},
{
"input": "10 90\n90 10",
"output": "80"
},
{
"input": "851016864 573579544\n-761410925 -380746263",
"output": "1612427789"
},
{
"input": "1 9\n9 9",
"output": "8"
},
{
"input": "1000 1000\n1000 1000",
"output": "0"
},
{
"input": "1 9\n9 1",
"output": "8"
},
{
"input": "1 90\n90 90",
"output": "89"
},
{
"input": "100 100\n1000 1000",
"output": "900"
},
{
"input": "-1 0\n0 0",
"output": "1"
},
{
"input": "-750595959 -2984043\n649569876 -749608783",
"output": "1400165835"
},
{
"input": "958048496 712083589\n423286949 810566863",
"output": "534761547"
},
{
"input": "146316710 53945094\n-523054748 147499505",
"output": "669371458"
},
{
"input": "50383856 -596516251\n-802950224 -557916272",
"output": "853334080"
},
{
"input": "-637204864 -280290367\n-119020929 153679771",
"output": "518183935"
},
{
"input": "-100 -100\n-60 -91",
"output": "40"
},
{
"input": "337537326 74909428\n-765558776 167951547",
"output": "1103096102"
},
{
"input": "0 81\n18 90",
"output": "18"
},
{
"input": "283722202 -902633305\n-831696497 -160868946",
"output": "1115418699"
},
{
"input": "1000 1000\n-1000 1000",
"output": "2000"
},
{
"input": "5 6\n4 8",
"output": "2"
},
{
"input": "40572000 597493595\n-935051731 368493185",
"output": "975623731"
},
{
"input": "-5 5\n5 5",
"output": "10"
}
] | 1,655,999,786 | 2,147,483,647 |
Python 3
|
RUNTIME_ERROR
|
TESTS
| 1 | 30 | 0 |
'''
set the first coordinate to the origin by finding the difference
of the two coordinates
'''
xa, ya = map ( int, input () .split () )
xb, yb = map ( int, input () .split () )
x = xb - xa
y = yb - ya
if x == y:
_print = x
elif x == -y:
_print: abs ( y )
elif x > y:
_print = y + ( x - y )
elif y > x:
_print = x + ( y - x )
else:
_print = 0
print (_print)
|
Title: Professor GukiZ's Robot
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Professor GukiZ makes a new robot. The robot are in the point with coordinates (*x*1,<=*y*1) and should go to the point (*x*2,<=*y*2). In a single step the robot can change any of its coordinates (maybe both of them) by one (decrease or increase). So the robot can move in one of the 8 directions. Find the minimal number of steps the robot should make to get the finish position.
Input Specification:
The first line contains two integers *x*1,<=*y*1 (<=-<=109<=≤<=*x*1,<=*y*1<=≤<=109) — the start position of the robot.
The second line contains two integers *x*2,<=*y*2 (<=-<=109<=≤<=*x*2,<=*y*2<=≤<=109) — the finish position of the robot.
Output Specification:
Print the only integer *d* — the minimal number of steps to get the finish position.
Demo Input:
['0 0\n4 5\n', '3 4\n6 1\n']
Demo Output:
['5\n', '3\n']
Note:
In the first example robot should increase both of its coordinates by one four times, so it will be in position (4, 4). After that robot should simply increase its *y* coordinate and get the finish position.
In the second example robot should simultaneously increase *x* coordinate and decrease *y* coordinate by one three times.
|
```python
'''
set the first coordinate to the origin by finding the difference
of the two coordinates
'''
xa, ya = map ( int, input () .split () )
xb, yb = map ( int, input () .split () )
x = xb - xa
y = yb - ya
if x == y:
_print = x
elif x == -y:
_print: abs ( y )
elif x > y:
_print = y + ( x - y )
elif y > x:
_print = x + ( y - x )
else:
_print = 0
print (_print)
```
| -1 |
|
18 |
C
|
Stripe
|
PROGRAMMING
| 1,200 |
[
"data structures",
"implementation"
] |
C. Stripe
|
2
|
64
|
Once Bob took a paper stripe of *n* squares (the height of the stripe is 1 square). In each square he wrote an integer number, possibly negative. He became interested in how many ways exist to cut this stripe into two pieces so that the sum of numbers from one piece is equal to the sum of numbers from the other piece, and each piece contains positive integer amount of squares. Would you help Bob solve this problem?
|
The first input line contains integer *n* (1<=≤<=*n*<=≤<=105) — amount of squares in the stripe. The second line contains *n* space-separated numbers — they are the numbers written in the squares of the stripe. These numbers are integer and do not exceed 10000 in absolute value.
|
Output the amount of ways to cut the stripe into two non-empty pieces so that the sum of numbers from one piece is equal to the sum of numbers from the other piece. Don't forget that it's allowed to cut the stripe along the squares' borders only.
|
[
"9\n1 5 -6 7 9 -16 0 -2 2\n",
"3\n1 1 1\n",
"2\n0 0\n"
] |
[
"3\n",
"0\n",
"1\n"
] |
none
| 0 |
[
{
"input": "9\n1 5 -6 7 9 -16 0 -2 2",
"output": "3"
},
{
"input": "3\n1 1 1",
"output": "0"
},
{
"input": "2\n0 0",
"output": "1"
},
{
"input": "4\n100 1 10 111",
"output": "1"
},
{
"input": "10\n0 4 -3 0 -2 2 -3 -3 2 5",
"output": "3"
},
{
"input": "10\n0 -1 2 2 -1 1 0 0 0 2",
"output": "0"
},
{
"input": "10\n-1 -1 1 -1 0 1 0 1 1 1",
"output": "1"
},
{
"input": "10\n0 0 0 0 0 0 0 0 0 0",
"output": "9"
},
{
"input": "50\n-4 -3 3 4 -1 0 2 -4 -3 -4 1 4 3 0 4 1 0 -3 4 -3 -2 2 2 1 0 -4 -4 -5 3 2 -1 4 5 -3 -3 4 4 -5 2 -3 4 -5 2 5 -4 4 1 -2 -4 3",
"output": "3"
},
{
"input": "15\n0 4 0 3 -1 4 -2 -2 -4 -4 3 2 4 -1 -3",
"output": "0"
},
{
"input": "10\n3 -1 -3 -1 3 -2 0 3 1 -2",
"output": "0"
},
{
"input": "100\n-4 2 4 4 1 3 -3 -3 2 1 -4 0 0 2 3 -1 -4 -3 4 -2 -3 -3 -3 -1 -2 -3 -1 -4 0 4 0 -1 4 0 -4 -4 4 -4 -2 1 -4 1 -3 -2 3 -4 4 0 -1 3 -1 4 -1 4 -1 3 -3 -3 -2 -2 4 -3 -3 4 -3 -2 -1 0 -2 4 0 -3 -1 -2 -3 1 -4 1 -3 -3 -3 -2 -3 0 1 -2 -2 -4 -3 -1 2 3 -1 1 1 0 3 -3 -1 -2",
"output": "1"
},
{
"input": "100\n-2 -1 1 0 -2 -1 2 2 0 0 2 1 0 2 0 2 1 0 -1 -1 -1 0 -2 -1 2 -1 -2 2 -2 2 -2 -2 2 1 1 1 -2 2 0 0 2 -1 2 2 2 0 -1 -1 -1 1 -2 2 2 2 -2 0 0 -2 0 -2 -2 0 -1 -1 -2 -1 1 2 -2 -1 1 -2 -1 0 -2 2 2 -1 -2 2 0 0 0 1 0 1 2 1 -2 -2 -1 -1 -2 -2 -2 -1 2 2 2 -2",
"output": "6"
},
{
"input": "100\n2 7 6 0 8 -2 0 1 8 -1 7 -4 -1 1 0 3 4 -4 3 7 8 -4 -6 6 4 -2 -5 7 4 6 1 6 3 8 -2 6 -6 -3 0 -1 -7 -8 -2 5 8 6 -2 -2 -5 -4 -7 -3 -5 -3 -3 -1 5 8 4 0 -7 -6 8 -4 -1 7 2 6 6 4 -5 -4 -5 -2 2 -2 -7 -1 5 -8 -6 -2 -5 4 2 8 -6 7 -8 -1 -5 8 6 -3 -1 7 -1 2 -8 -8",
"output": "0"
},
{
"input": "1\n0",
"output": "0"
},
{
"input": "1\n10000",
"output": "0"
},
{
"input": "1\n-10000",
"output": "0"
}
] | 1,680,010,643 | 2,147,483,647 |
Python 3
|
OK
|
TESTS
| 45 | 340 | 7,680,000 |
n = int(input())
entrada = input().split(" ")
lista = []
for i in entrada:
lista.append(int(i))
for j in range(1,len(lista)):
lista[j] = lista[j] + lista[j - 1]
count = 0
for k in range(len(lista) - 1):
esquerda = lista[k]
direita = lista[len(lista) - 1] - esquerda
if(esquerda == direita):
count+=1
print(count)
|
Title: Stripe
Time Limit: 2 seconds
Memory Limit: 64 megabytes
Problem Description:
Once Bob took a paper stripe of *n* squares (the height of the stripe is 1 square). In each square he wrote an integer number, possibly negative. He became interested in how many ways exist to cut this stripe into two pieces so that the sum of numbers from one piece is equal to the sum of numbers from the other piece, and each piece contains positive integer amount of squares. Would you help Bob solve this problem?
Input Specification:
The first input line contains integer *n* (1<=≤<=*n*<=≤<=105) — amount of squares in the stripe. The second line contains *n* space-separated numbers — they are the numbers written in the squares of the stripe. These numbers are integer and do not exceed 10000 in absolute value.
Output Specification:
Output the amount of ways to cut the stripe into two non-empty pieces so that the sum of numbers from one piece is equal to the sum of numbers from the other piece. Don't forget that it's allowed to cut the stripe along the squares' borders only.
Demo Input:
['9\n1 5 -6 7 9 -16 0 -2 2\n', '3\n1 1 1\n', '2\n0 0\n']
Demo Output:
['3\n', '0\n', '1\n']
Note:
none
|
```python
n = int(input())
entrada = input().split(" ")
lista = []
for i in entrada:
lista.append(int(i))
for j in range(1,len(lista)):
lista[j] = lista[j] + lista[j - 1]
count = 0
for k in range(len(lista) - 1):
esquerda = lista[k]
direita = lista[len(lista) - 1] - esquerda
if(esquerda == direita):
count+=1
print(count)
```
| 3.85778 |
45 |
A
|
Codecraft III
|
PROGRAMMING
| 900 |
[
"implementation"
] |
A. Codecraft III
|
2
|
256
|
Today Vasya visited a widely known site and learned that the continuation of his favourite game Codecraft II will appear after exactly *k* months. He looked at the calendar and learned that at the moment is the month number *s*. Vasya immediately got interested in what month Codecraft III will appear. Help him understand that.
All the twelve months in Vasya's calendar are named using their usual English names: January, February, March, April, May, June, July, August, September, October, November, December.
|
The first input line contains the name of the current month. It is guaranteed that it is a proper English name of one of twelve months. The first letter is uppercase, the rest are lowercase. The second line contains integer *k* (0<=≤<=*k*<=≤<=100) — the number of months left till the appearance of Codecraft III.
|
Print starting from an uppercase letter the name of the month in which the continuation of Codeforces II will appear. The printed name must be contained in the list January, February, March, April, May, June, July, August, September, October, November, December.
|
[
"November\n3\n",
"May\n24\n"
] |
[
"February\n",
"May\n"
] |
none
| 0 |
[
{
"input": "November\n3",
"output": "February"
},
{
"input": "May\n24",
"output": "May"
},
{
"input": "April\n0",
"output": "April"
},
{
"input": "September\n0",
"output": "September"
},
{
"input": "August\n0",
"output": "August"
},
{
"input": "June\n1",
"output": "July"
},
{
"input": "July\n2",
"output": "September"
},
{
"input": "September\n3",
"output": "December"
},
{
"input": "July\n4",
"output": "November"
},
{
"input": "August\n24",
"output": "August"
},
{
"input": "May\n48",
"output": "May"
},
{
"input": "November\n47",
"output": "October"
},
{
"input": "December\n49",
"output": "January"
},
{
"input": "June\n99",
"output": "September"
},
{
"input": "March\n100",
"output": "July"
},
{
"input": "December\n1",
"output": "January"
},
{
"input": "January\n11",
"output": "December"
},
{
"input": "December\n0",
"output": "December"
},
{
"input": "January\n0",
"output": "January"
},
{
"input": "July\n77",
"output": "December"
},
{
"input": "February\n11",
"output": "January"
},
{
"input": "February\n22",
"output": "December"
},
{
"input": "July\n33",
"output": "April"
},
{
"input": "May\n44",
"output": "January"
},
{
"input": "June\n97",
"output": "July"
}
] | 1,649,092,670 | 2,147,483,647 |
Python 3
|
OK
|
TESTS
| 25 | 62 | 0 |
month = input()
n = int(input())
months = ['January', 'February', 'March', 'April', 'May', 'June',
'July', 'August', 'September', 'October', 'November', 'December']
index =(months.index(month)+n)%12
print(months[index])
|
Title: Codecraft III
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Today Vasya visited a widely known site and learned that the continuation of his favourite game Codecraft II will appear after exactly *k* months. He looked at the calendar and learned that at the moment is the month number *s*. Vasya immediately got interested in what month Codecraft III will appear. Help him understand that.
All the twelve months in Vasya's calendar are named using their usual English names: January, February, March, April, May, June, July, August, September, October, November, December.
Input Specification:
The first input line contains the name of the current month. It is guaranteed that it is a proper English name of one of twelve months. The first letter is uppercase, the rest are lowercase. The second line contains integer *k* (0<=≤<=*k*<=≤<=100) — the number of months left till the appearance of Codecraft III.
Output Specification:
Print starting from an uppercase letter the name of the month in which the continuation of Codeforces II will appear. The printed name must be contained in the list January, February, March, April, May, June, July, August, September, October, November, December.
Demo Input:
['November\n3\n', 'May\n24\n']
Demo Output:
['February\n', 'May\n']
Note:
none
|
```python
month = input()
n = int(input())
months = ['January', 'February', 'March', 'April', 'May', 'June',
'July', 'August', 'September', 'October', 'November', 'December']
index =(months.index(month)+n)%12
print(months[index])
```
| 3.9845 |
27 |
A
|
Next Test
|
PROGRAMMING
| 1,200 |
[
"implementation",
"sortings"
] |
A. Next Test
|
2
|
256
|
«Polygon» is a system which allows to create programming tasks in a simple and professional way. When you add a test to the problem, the corresponding form asks you for the test index. As in most cases it is clear which index the next test will have, the system suggests the default value of the index. It is calculated as the smallest positive integer which is not used as an index for some previously added test.
You are to implement this feature. Create a program which determines the default index of the next test, given the indexes of the previously added tests.
|
The first line contains one integer *n* (1<=≤<=*n*<=≤<=3000) — the amount of previously added tests. The second line contains *n* distinct integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=3000) — indexes of these tests.
|
Output the required default value for the next test index.
|
[
"3\n1 7 2\n"
] |
[
"3\n"
] |
none
| 500 |
[
{
"input": "1\n1",
"output": "2"
},
{
"input": "2\n2 1",
"output": "3"
},
{
"input": "3\n3 4 1",
"output": "2"
},
{
"input": "4\n6 4 3 5",
"output": "1"
},
{
"input": "5\n3 2 1 7 4",
"output": "5"
},
{
"input": "6\n4 1 2 5 3 7",
"output": "6"
},
{
"input": "7\n3 2 1 6 5 7 4",
"output": "8"
},
{
"input": "8\n2 8 3 7 6 9 1 5",
"output": "4"
},
{
"input": "9\n10 5 9 3 8 7 1 2 4",
"output": "6"
},
{
"input": "10\n7 2 3 8 9 6 5 4 1 10",
"output": "11"
},
{
"input": "1\n1",
"output": "2"
},
{
"input": "2\n1 2",
"output": "3"
},
{
"input": "3\n2 4 1",
"output": "3"
},
{
"input": "4\n4 2 3 1",
"output": "5"
},
{
"input": "5\n3 1 4 2 5",
"output": "6"
},
{
"input": "6\n1 3 6 7 2 4",
"output": "5"
},
{
"input": "7\n1 5 4 7 2 3 6",
"output": "8"
},
{
"input": "8\n12 1 6 5 2 8 3 4",
"output": "7"
},
{
"input": "9\n3 2 7 5 6 4 1 9 10",
"output": "8"
},
{
"input": "10\n1 7 13 6 5 10 3 8 2 4",
"output": "9"
},
{
"input": "1\n2",
"output": "1"
},
{
"input": "1\n3",
"output": "1"
},
{
"input": "1\n3000",
"output": "1"
},
{
"input": "2\n2 3",
"output": "1"
},
{
"input": "2\n3000 1",
"output": "2"
}
] | 1,610,294,477 | 2,147,483,647 |
Python 3
|
OK
|
TESTS
| 30 | 124 | 409,600 |
input(); print(min(set(range(1, 3002)) - set(map(int, input().split()))))
|
Title: Next Test
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
«Polygon» is a system which allows to create programming tasks in a simple and professional way. When you add a test to the problem, the corresponding form asks you for the test index. As in most cases it is clear which index the next test will have, the system suggests the default value of the index. It is calculated as the smallest positive integer which is not used as an index for some previously added test.
You are to implement this feature. Create a program which determines the default index of the next test, given the indexes of the previously added tests.
Input Specification:
The first line contains one integer *n* (1<=≤<=*n*<=≤<=3000) — the amount of previously added tests. The second line contains *n* distinct integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=3000) — indexes of these tests.
Output Specification:
Output the required default value for the next test index.
Demo Input:
['3\n1 7 2\n']
Demo Output:
['3\n']
Note:
none
|
```python
input(); print(min(set(range(1, 3002)) - set(map(int, input().split()))))
```
| 3.968237 |
104 |
A
|
Blackjack
|
PROGRAMMING
| 800 |
[
"implementation"
] |
A. Blackjack
|
2
|
256
|
One rainy gloomy evening when all modules hid in the nearby cafes to drink hot energetic cocktails, the Hexadecimal virus decided to fly over the Mainframe to look for a Great Idea. And she has found one!
Why not make her own Codeforces, with blackjack and other really cool stuff? Many people will surely be willing to visit this splendid shrine of high culture.
In Mainframe a standard pack of 52 cards is used to play blackjack. The pack contains cards of 13 values: 2, 3, 4, 5, 6, 7, 8, 9, 10, jacks, queens, kings and aces. Each value also exists in one of four suits: hearts, diamonds, clubs and spades. Also, each card earns some value in points assigned to it: cards with value from two to ten earn from 2 to 10 points, correspondingly. An ace can either earn 1 or 11, whatever the player wishes. The picture cards (king, queen and jack) earn 10 points. The number of points a card earns does not depend on the suit. The rules of the game are very simple. The player gets two cards, if the sum of points of those cards equals *n*, then the player wins, otherwise the player loses.
The player has already got the first card, it's the queen of spades. To evaluate chances for victory, you should determine how many ways there are to get the second card so that the sum of points exactly equals *n*.
|
The only line contains *n* (1<=≤<=*n*<=≤<=25) — the required sum of points.
|
Print the numbers of ways to get the second card in the required way if the first card is the queen of spades.
|
[
"12\n",
"20\n",
"10\n"
] |
[
"4",
"15",
"0"
] |
In the first sample only four two's of different suits can earn the required sum of points.
In the second sample we can use all tens, jacks, queens and kings; overall it's 15 cards, as the queen of spades (as any other card) is only present once in the pack of cards and it's already in use.
In the third sample there is no card, that would add a zero to the current ten points.
| 500 |
[
{
"input": "12",
"output": "4"
},
{
"input": "20",
"output": "15"
},
{
"input": "10",
"output": "0"
},
{
"input": "11",
"output": "4"
},
{
"input": "15",
"output": "4"
},
{
"input": "18",
"output": "4"
},
{
"input": "25",
"output": "0"
},
{
"input": "22",
"output": "0"
},
{
"input": "1",
"output": "0"
},
{
"input": "2",
"output": "0"
},
{
"input": "3",
"output": "0"
},
{
"input": "4",
"output": "0"
},
{
"input": "5",
"output": "0"
},
{
"input": "6",
"output": "0"
},
{
"input": "7",
"output": "0"
},
{
"input": "8",
"output": "0"
},
{
"input": "9",
"output": "0"
},
{
"input": "13",
"output": "4"
},
{
"input": "14",
"output": "4"
},
{
"input": "16",
"output": "4"
},
{
"input": "17",
"output": "4"
},
{
"input": "19",
"output": "4"
},
{
"input": "21",
"output": "4"
},
{
"input": "23",
"output": "0"
},
{
"input": "24",
"output": "0"
}
] | 1,597,173,475 | 2,147,483,647 |
Python 3
|
WRONG_ANSWER
|
TESTS
| 3 | 156 | 6,656,000 |
dic = dict()
for i in range(2,10):
dic[i]=4
dic[1]=1
dic[10]=15
dif = int(input())-10
print(dic.get(dif,0))
|
Title: Blackjack
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
One rainy gloomy evening when all modules hid in the nearby cafes to drink hot energetic cocktails, the Hexadecimal virus decided to fly over the Mainframe to look for a Great Idea. And she has found one!
Why not make her own Codeforces, with blackjack and other really cool stuff? Many people will surely be willing to visit this splendid shrine of high culture.
In Mainframe a standard pack of 52 cards is used to play blackjack. The pack contains cards of 13 values: 2, 3, 4, 5, 6, 7, 8, 9, 10, jacks, queens, kings and aces. Each value also exists in one of four suits: hearts, diamonds, clubs and spades. Also, each card earns some value in points assigned to it: cards with value from two to ten earn from 2 to 10 points, correspondingly. An ace can either earn 1 or 11, whatever the player wishes. The picture cards (king, queen and jack) earn 10 points. The number of points a card earns does not depend on the suit. The rules of the game are very simple. The player gets two cards, if the sum of points of those cards equals *n*, then the player wins, otherwise the player loses.
The player has already got the first card, it's the queen of spades. To evaluate chances for victory, you should determine how many ways there are to get the second card so that the sum of points exactly equals *n*.
Input Specification:
The only line contains *n* (1<=≤<=*n*<=≤<=25) — the required sum of points.
Output Specification:
Print the numbers of ways to get the second card in the required way if the first card is the queen of spades.
Demo Input:
['12\n', '20\n', '10\n']
Demo Output:
['4', '15', '0']
Note:
In the first sample only four two's of different suits can earn the required sum of points.
In the second sample we can use all tens, jacks, queens and kings; overall it's 15 cards, as the queen of spades (as any other card) is only present once in the pack of cards and it's already in use.
In the third sample there is no card, that would add a zero to the current ten points.
|
```python
dic = dict()
for i in range(2,10):
dic[i]=4
dic[1]=1
dic[10]=15
dif = int(input())-10
print(dic.get(dif,0))
```
| 0 |
991 |
A
|
If at first you don't succeed...
|
PROGRAMMING
| 1,000 |
[
"implementation"
] | null | null |
Each student eagerly awaits the day he would pass the exams successfully. Thus, Vasya was ready to celebrate, but, alas, he didn't pass it. However, many of Vasya's fellow students from the same group were more successful and celebrated after the exam.
Some of them celebrated in the BugDonalds restaurant, some of them — in the BeaverKing restaurant, the most successful ones were fast enough to celebrate in both of restaurants. Students which didn't pass the exam didn't celebrate in any of those restaurants and elected to stay home to prepare for their reexamination. However, this quickly bored Vasya and he started checking celebration photos on the Kilogramm. He found out that, in total, BugDonalds was visited by $A$ students, BeaverKing — by $B$ students and $C$ students visited both restaurants. Vasya also knows that there are $N$ students in his group.
Based on this info, Vasya wants to determine either if his data contradicts itself or, if it doesn't, how many students in his group didn't pass the exam. Can you help him so he won't waste his valuable preparation time?
|
The first line contains four integers — $A$, $B$, $C$ and $N$ ($0 \leq A, B, C, N \leq 100$).
|
If a distribution of $N$ students exists in which $A$ students visited BugDonalds, $B$ — BeaverKing, $C$ — both of the restaurants and at least one student is left home (it is known that Vasya didn't pass the exam and stayed at home), output one integer — amount of students (including Vasya) who did not pass the exam.
If such a distribution does not exist and Vasya made a mistake while determining the numbers $A$, $B$, $C$ or $N$ (as in samples 2 and 3), output $-1$.
|
[
"10 10 5 20\n",
"2 2 0 4\n",
"2 2 2 1\n"
] |
[
"5",
"-1",
"-1"
] |
The first sample describes following situation: $5$ only visited BugDonalds, $5$ students only visited BeaverKing, $5$ visited both of them and $5$ students (including Vasya) didn't pass the exam.
In the second sample $2$ students only visited BugDonalds and $2$ only visited BeaverKing, but that means all $4$ students in group passed the exam which contradicts the fact that Vasya didn't pass meaning that this situation is impossible.
The third sample describes a situation where $2$ students visited BugDonalds but the group has only $1$ which makes it clearly impossible.
| 500 |
[
{
"input": "10 10 5 20",
"output": "5"
},
{
"input": "2 2 0 4",
"output": "-1"
},
{
"input": "2 2 2 1",
"output": "-1"
},
{
"input": "98 98 97 100",
"output": "1"
},
{
"input": "1 5 2 10",
"output": "-1"
},
{
"input": "5 1 2 10",
"output": "-1"
},
{
"input": "6 7 5 8",
"output": "-1"
},
{
"input": "6 7 5 9",
"output": "1"
},
{
"input": "6 7 5 7",
"output": "-1"
},
{
"input": "50 50 1 100",
"output": "1"
},
{
"input": "8 3 2 12",
"output": "3"
},
{
"input": "10 19 6 25",
"output": "2"
},
{
"input": "1 0 0 99",
"output": "98"
},
{
"input": "0 1 0 98",
"output": "97"
},
{
"input": "1 1 0 97",
"output": "95"
},
{
"input": "1 1 1 96",
"output": "95"
},
{
"input": "0 0 0 0",
"output": "-1"
},
{
"input": "100 0 0 0",
"output": "-1"
},
{
"input": "0 100 0 0",
"output": "-1"
},
{
"input": "100 100 0 0",
"output": "-1"
},
{
"input": "0 0 100 0",
"output": "-1"
},
{
"input": "100 0 100 0",
"output": "-1"
},
{
"input": "0 100 100 0",
"output": "-1"
},
{
"input": "100 100 100 0",
"output": "-1"
},
{
"input": "0 0 0 100",
"output": "100"
},
{
"input": "100 0 0 100",
"output": "-1"
},
{
"input": "0 100 0 100",
"output": "-1"
},
{
"input": "100 100 0 100",
"output": "-1"
},
{
"input": "0 0 100 100",
"output": "-1"
},
{
"input": "100 0 100 100",
"output": "-1"
},
{
"input": "0 100 100 100",
"output": "-1"
},
{
"input": "100 100 100 100",
"output": "-1"
},
{
"input": "10 45 7 52",
"output": "4"
},
{
"input": "38 1 1 68",
"output": "30"
},
{
"input": "8 45 2 67",
"output": "16"
},
{
"input": "36 36 18 65",
"output": "11"
},
{
"input": "10 30 8 59",
"output": "27"
},
{
"input": "38 20 12 49",
"output": "3"
},
{
"input": "8 19 4 38",
"output": "15"
},
{
"input": "36 21 17 72",
"output": "32"
},
{
"input": "14 12 12 89",
"output": "75"
},
{
"input": "38 6 1 44",
"output": "1"
},
{
"input": "13 4 6 82",
"output": "-1"
},
{
"input": "5 3 17 56",
"output": "-1"
},
{
"input": "38 5 29 90",
"output": "-1"
},
{
"input": "22 36 18 55",
"output": "15"
},
{
"input": "13 0 19 75",
"output": "-1"
},
{
"input": "62 65 10 89",
"output": "-1"
},
{
"input": "2 29 31 72",
"output": "-1"
},
{
"input": "1 31 19 55",
"output": "-1"
},
{
"input": "1 25 28 88",
"output": "-1"
},
{
"input": "34 32 28 33",
"output": "-1"
},
{
"input": "43 36 1 100",
"output": "22"
},
{
"input": "16 39 55 70",
"output": "-1"
},
{
"input": "2 3 0 91",
"output": "86"
},
{
"input": "55 29 12 48",
"output": "-1"
},
{
"input": "7 33 20 88",
"output": "-1"
},
{
"input": "40 38 27 99",
"output": "48"
},
{
"input": "18 28 14 84",
"output": "52"
},
{
"input": "34 25 25 92",
"output": "58"
},
{
"input": "4 24 5 76",
"output": "-1"
},
{
"input": "5 22 16 96",
"output": "-1"
},
{
"input": "1 1 0 4",
"output": "2"
},
{
"input": "5 5 3 1",
"output": "-1"
},
{
"input": "0 0 0 1",
"output": "1"
},
{
"input": "2 3 0 8",
"output": "3"
},
{
"input": "5 5 2 5",
"output": "-1"
},
{
"input": "1 2 1 3",
"output": "1"
},
{
"input": "3 0 0 4",
"output": "1"
},
{
"input": "0 0 0 5",
"output": "5"
},
{
"input": "5 5 0 3",
"output": "-1"
},
{
"input": "5 6 1 7",
"output": "-1"
},
{
"input": "10 10 10 11",
"output": "1"
},
{
"input": "0 0 0 10",
"output": "10"
},
{
"input": "5 15 5 30",
"output": "15"
},
{
"input": "3 2 0 7",
"output": "2"
}
] | 1,609,999,272 | 2,147,483,647 |
PyPy 3
|
RUNTIME_ERROR
|
TESTS
| 0 | 202 | 2,150,400 |
A, B, C, N = map(input().strip().split())
D = N - (A + B - C)
if D <= 0 or C > A + B or A + B > N:
print('-1')
exit(0)
print(D)
|
Title: If at first you don't succeed...
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Each student eagerly awaits the day he would pass the exams successfully. Thus, Vasya was ready to celebrate, but, alas, he didn't pass it. However, many of Vasya's fellow students from the same group were more successful and celebrated after the exam.
Some of them celebrated in the BugDonalds restaurant, some of them — in the BeaverKing restaurant, the most successful ones were fast enough to celebrate in both of restaurants. Students which didn't pass the exam didn't celebrate in any of those restaurants and elected to stay home to prepare for their reexamination. However, this quickly bored Vasya and he started checking celebration photos on the Kilogramm. He found out that, in total, BugDonalds was visited by $A$ students, BeaverKing — by $B$ students and $C$ students visited both restaurants. Vasya also knows that there are $N$ students in his group.
Based on this info, Vasya wants to determine either if his data contradicts itself or, if it doesn't, how many students in his group didn't pass the exam. Can you help him so he won't waste his valuable preparation time?
Input Specification:
The first line contains four integers — $A$, $B$, $C$ and $N$ ($0 \leq A, B, C, N \leq 100$).
Output Specification:
If a distribution of $N$ students exists in which $A$ students visited BugDonalds, $B$ — BeaverKing, $C$ — both of the restaurants and at least one student is left home (it is known that Vasya didn't pass the exam and stayed at home), output one integer — amount of students (including Vasya) who did not pass the exam.
If such a distribution does not exist and Vasya made a mistake while determining the numbers $A$, $B$, $C$ or $N$ (as in samples 2 and 3), output $-1$.
Demo Input:
['10 10 5 20\n', '2 2 0 4\n', '2 2 2 1\n']
Demo Output:
['5', '-1', '-1']
Note:
The first sample describes following situation: $5$ only visited BugDonalds, $5$ students only visited BeaverKing, $5$ visited both of them and $5$ students (including Vasya) didn't pass the exam.
In the second sample $2$ students only visited BugDonalds and $2$ only visited BeaverKing, but that means all $4$ students in group passed the exam which contradicts the fact that Vasya didn't pass meaning that this situation is impossible.
The third sample describes a situation where $2$ students visited BugDonalds but the group has only $1$ which makes it clearly impossible.
|
```python
A, B, C, N = map(input().strip().split())
D = N - (A + B - C)
if D <= 0 or C > A + B or A + B > N:
print('-1')
exit(0)
print(D)
```
| -1 |
|
990 |
B
|
Micro-World
|
PROGRAMMING
| 1,200 |
[
"greedy",
"sortings"
] | null | null |
You have a Petri dish with bacteria and you are preparing to dive into the harsh micro-world. But, unfortunately, you don't have any microscope nearby, so you can't watch them.
You know that you have $n$ bacteria in the Petri dish and size of the $i$-th bacteria is $a_i$. Also you know intergalactic positive integer constant $K$.
The $i$-th bacteria can swallow the $j$-th bacteria if and only if $a_i > a_j$ and $a_i \le a_j + K$. The $j$-th bacteria disappear, but the $i$-th bacteria doesn't change its size. The bacteria can perform multiple swallows. On each swallow operation any bacteria $i$ can swallow any bacteria $j$ if $a_i > a_j$ and $a_i \le a_j + K$. The swallow operations go one after another.
For example, the sequence of bacteria sizes $a=[101, 53, 42, 102, 101, 55, 54]$ and $K=1$. The one of possible sequences of swallows is: $[101, 53, 42, 102, \underline{101}, 55, 54]$ $\to$ $[101, \underline{53}, 42, 102, 55, 54]$ $\to$ $[\underline{101}, 42, 102, 55, 54]$ $\to$ $[42, 102, 55, \underline{54}]$ $\to$ $[42, 102, 55]$. In total there are $3$ bacteria remained in the Petri dish.
Since you don't have a microscope, you can only guess, what the minimal possible number of bacteria can remain in your Petri dish when you finally will find any microscope.
|
The first line contains two space separated positive integers $n$ and $K$ ($1 \le n \le 2 \cdot 10^5$, $1 \le K \le 10^6$) — number of bacteria and intergalactic constant $K$.
The second line contains $n$ space separated integers $a_1, a_2, \dots, a_n$ ($1 \le a_i \le 10^6$) — sizes of bacteria you have.
|
Print the only integer — minimal possible number of bacteria can remain.
|
[
"7 1\n101 53 42 102 101 55 54\n",
"6 5\n20 15 10 15 20 25\n",
"7 1000000\n1 1 1 1 1 1 1\n"
] |
[
"3\n",
"1\n",
"7\n"
] |
The first example is clarified in the problem statement.
In the second example an optimal possible sequence of swallows is: $[20, 15, 10, 15, \underline{20}, 25]$ $\to$ $[20, 15, 10, \underline{15}, 25]$ $\to$ $[20, 15, \underline{10}, 25]$ $\to$ $[20, \underline{15}, 25]$ $\to$ $[\underline{20}, 25]$ $\to$ $[25]$.
In the third example no bacteria can swallow any other bacteria.
| 0 |
[
{
"input": "7 1\n101 53 42 102 101 55 54",
"output": "3"
},
{
"input": "6 5\n20 15 10 15 20 25",
"output": "1"
},
{
"input": "7 1000000\n1 1 1 1 1 1 1",
"output": "7"
},
{
"input": "1 1\n1",
"output": "1"
},
{
"input": "1 4\n8",
"output": "1"
},
{
"input": "10 1\n1 2 3 5 6 8 10 11 9 4",
"output": "2"
},
{
"input": "9 2\n1 6 1 5 5 8 6 8 7",
"output": "4"
},
{
"input": "15 1\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "15"
},
{
"input": "2 1000000\n1 1000000",
"output": "1"
},
{
"input": "7 2\n1 5 5 8 9 8 8",
"output": "4"
},
{
"input": "10 1\n2 6 3 4 2 4 4 3 2 1",
"output": "4"
},
{
"input": "4 1\n2 2 1 1",
"output": "2"
},
{
"input": "10 1\n6 3 1 3 6 4 1 3 6 4",
"output": "7"
},
{
"input": "2 1\n1 1",
"output": "2"
},
{
"input": "2 1\n1 2",
"output": "1"
},
{
"input": "8 2\n3 13 9 8 3 13 9 14",
"output": "5"
},
{
"input": "8 1000000\n1 1 5 1000000 1000000 2 2 2",
"output": "2"
},
{
"input": "2 1\n999152 999153",
"output": "1"
}
] | 1,528,638,012 | 2,147,483,647 |
Python 3
|
RUNTIME_ERROR
|
TESTS
| 3 | 234 | 13,824,000 |
n, k = map(int, input().split())
a = [int(x) for x in input().split()]
a = sorted(a)
count = 0
countRep = 0
freq = [0] * 10**5
for i in range(len(a)):
freq[a[i]] += 1
a = sorted(list(set(a)))
for i in range(len(a) - 1):
if a[i + 1] <= a[i] + k:
count += freq[a[i]]
print(n - count)
|
Title: Micro-World
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You have a Petri dish with bacteria and you are preparing to dive into the harsh micro-world. But, unfortunately, you don't have any microscope nearby, so you can't watch them.
You know that you have $n$ bacteria in the Petri dish and size of the $i$-th bacteria is $a_i$. Also you know intergalactic positive integer constant $K$.
The $i$-th bacteria can swallow the $j$-th bacteria if and only if $a_i > a_j$ and $a_i \le a_j + K$. The $j$-th bacteria disappear, but the $i$-th bacteria doesn't change its size. The bacteria can perform multiple swallows. On each swallow operation any bacteria $i$ can swallow any bacteria $j$ if $a_i > a_j$ and $a_i \le a_j + K$. The swallow operations go one after another.
For example, the sequence of bacteria sizes $a=[101, 53, 42, 102, 101, 55, 54]$ and $K=1$. The one of possible sequences of swallows is: $[101, 53, 42, 102, \underline{101}, 55, 54]$ $\to$ $[101, \underline{53}, 42, 102, 55, 54]$ $\to$ $[\underline{101}, 42, 102, 55, 54]$ $\to$ $[42, 102, 55, \underline{54}]$ $\to$ $[42, 102, 55]$. In total there are $3$ bacteria remained in the Petri dish.
Since you don't have a microscope, you can only guess, what the minimal possible number of bacteria can remain in your Petri dish when you finally will find any microscope.
Input Specification:
The first line contains two space separated positive integers $n$ and $K$ ($1 \le n \le 2 \cdot 10^5$, $1 \le K \le 10^6$) — number of bacteria and intergalactic constant $K$.
The second line contains $n$ space separated integers $a_1, a_2, \dots, a_n$ ($1 \le a_i \le 10^6$) — sizes of bacteria you have.
Output Specification:
Print the only integer — minimal possible number of bacteria can remain.
Demo Input:
['7 1\n101 53 42 102 101 55 54\n', '6 5\n20 15 10 15 20 25\n', '7 1000000\n1 1 1 1 1 1 1\n']
Demo Output:
['3\n', '1\n', '7\n']
Note:
The first example is clarified in the problem statement.
In the second example an optimal possible sequence of swallows is: $[20, 15, 10, 15, \underline{20}, 25]$ $\to$ $[20, 15, 10, \underline{15}, 25]$ $\to$ $[20, 15, \underline{10}, 25]$ $\to$ $[20, \underline{15}, 25]$ $\to$ $[\underline{20}, 25]$ $\to$ $[25]$.
In the third example no bacteria can swallow any other bacteria.
|
```python
n, k = map(int, input().split())
a = [int(x) for x in input().split()]
a = sorted(a)
count = 0
countRep = 0
freq = [0] * 10**5
for i in range(len(a)):
freq[a[i]] += 1
a = sorted(list(set(a)))
for i in range(len(a) - 1):
if a[i + 1] <= a[i] + k:
count += freq[a[i]]
print(n - count)
```
| -1 |
|
266 |
A
|
Stones on the Table
|
PROGRAMMING
| 800 |
[
"implementation"
] | null | null |
There are *n* stones on the table in a row, each of them can be red, green or blue. Count the minimum number of stones to take from the table so that any two neighboring stones had different colors. Stones in a row are considered neighboring if there are no other stones between them.
|
The first line contains integer *n* (1<=≤<=*n*<=≤<=50) — the number of stones on the table.
The next line contains string *s*, which represents the colors of the stones. We'll consider the stones in the row numbered from 1 to *n* from left to right. Then the *i*-th character *s* equals "R", if the *i*-th stone is red, "G", if it's green and "B", if it's blue.
|
Print a single integer — the answer to the problem.
|
[
"3\nRRG\n",
"5\nRRRRR\n",
"4\nBRBG\n"
] |
[
"1\n",
"4\n",
"0\n"
] |
none
| 500 |
[
{
"input": "3\nRRG",
"output": "1"
},
{
"input": "5\nRRRRR",
"output": "4"
},
{
"input": "4\nBRBG",
"output": "0"
},
{
"input": "1\nB",
"output": "0"
},
{
"input": "2\nBG",
"output": "0"
},
{
"input": "3\nBGB",
"output": "0"
},
{
"input": "4\nRBBR",
"output": "1"
},
{
"input": "5\nRGGBG",
"output": "1"
},
{
"input": "10\nGGBRBRGGRB",
"output": "2"
},
{
"input": "50\nGRBGGRBRGRBGGBBBBBGGGBBBBRBRGBRRBRGBBBRBBRRGBGGGRB",
"output": "18"
},
{
"input": "15\nBRRBRGGBBRRRRGR",
"output": "6"
},
{
"input": "20\nRRGBBRBRGRGBBGGRGRRR",
"output": "6"
},
{
"input": "25\nBBGBGRBGGBRRBGRRBGGBBRBRB",
"output": "6"
},
{
"input": "30\nGRGGGBGGRGBGGRGRBGBGBRRRRRRGRB",
"output": "9"
},
{
"input": "35\nGBBGBRGBBGGRBBGBRRGGRRRRRRRBRBBRRGB",
"output": "14"
},
{
"input": "40\nGBBRRGBGGGRGGGRRRRBRBGGBBGGGBGBBBBBRGGGG",
"output": "20"
},
{
"input": "45\nGGGBBRBBRRGRBBGGBGRBRGGBRBRGBRRGBGRRBGRGRBRRG",
"output": "11"
},
{
"input": "50\nRBGGBGGRBGRBBBGBBGRBBBGGGRBBBGBBBGRGGBGGBRBGBGRRGG",
"output": "17"
},
{
"input": "50\nGGGBBRGGGGGRRGGRBGGRGBBRBRRBGRGBBBGBRBGRGBBGRGGBRB",
"output": "16"
},
{
"input": "50\nGBGRGRRBRRRRRGGBBGBRRRBBBRBBBRRGRBBRGBRBGGRGRBBGGG",
"output": "19"
},
{
"input": "10\nGRRBRBRBGR",
"output": "1"
},
{
"input": "10\nBRBGBGRRBR",
"output": "1"
},
{
"input": "20\nGBGBGGRRRRGRBBGRGRGR",
"output": "5"
},
{
"input": "20\nRRGGRBBGBBRBGRRBRRBG",
"output": "6"
},
{
"input": "30\nBGBRGBBBGRGBBRGBGRBBBRGGRRGRRB",
"output": "8"
},
{
"input": "30\nBBBBGGBRBGBBGBGBGBGGGRGRRGGBBB",
"output": "11"
},
{
"input": "40\nGBRRGRBGBRRGBRGGGBRGBGBRGBBRRGRGGBBGBGBB",
"output": "9"
},
{
"input": "40\nBRGRGGRGGRBBRRRBRBBGGGRRGBGBBGRBBRGBRRGG",
"output": "13"
},
{
"input": "50\nRBGBGGRRGGRGGBGBGRRBGGBGBRRBBGBBGBBBGBBRBBRBRBRGRG",
"output": "13"
},
{
"input": "50\nRBRRGBGRRRBGRRBGRRGRBBRBBRRBRGGBRBRRBGGRBGGBRBRGRB",
"output": "12"
},
{
"input": "2\nBB",
"output": "1"
},
{
"input": "50\nRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRR",
"output": "49"
},
{
"input": "50\nRRRRRRRRGRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRR",
"output": "47"
},
{
"input": "50\nRRRRRRRRRRRRGGRRRRRRRRRBRRRRRRRRRRRRRRBBRRRRRRRRRR",
"output": "43"
}
] | 1,696,865,530 | 2,147,483,647 |
Python 3
|
OK
|
TESTS
| 34 | 92 | 0 |
test_number=int(input())
test_list=list(input())
num=0
for i in range(test_number-1):
if test_list[i]==test_list[i+1]:
num+=1
print(num)
|
Title: Stones on the Table
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
There are *n* stones on the table in a row, each of them can be red, green or blue. Count the minimum number of stones to take from the table so that any two neighboring stones had different colors. Stones in a row are considered neighboring if there are no other stones between them.
Input Specification:
The first line contains integer *n* (1<=≤<=*n*<=≤<=50) — the number of stones on the table.
The next line contains string *s*, which represents the colors of the stones. We'll consider the stones in the row numbered from 1 to *n* from left to right. Then the *i*-th character *s* equals "R", if the *i*-th stone is red, "G", if it's green and "B", if it's blue.
Output Specification:
Print a single integer — the answer to the problem.
Demo Input:
['3\nRRG\n', '5\nRRRRR\n', '4\nBRBG\n']
Demo Output:
['1\n', '4\n', '0\n']
Note:
none
|
```python
test_number=int(input())
test_list=list(input())
num=0
for i in range(test_number-1):
if test_list[i]==test_list[i+1]:
num+=1
print(num)
```
| 3 |
|
494 |
A
|
Treasure
|
PROGRAMMING
| 1,500 |
[
"greedy"
] | null | null |
Malek has recently found a treasure map. While he was looking for a treasure he found a locked door. There was a string *s* written on the door consisting of characters '(', ')' and '#'. Below there was a manual on how to open the door. After spending a long time Malek managed to decode the manual and found out that the goal is to replace each '#' with one or more ')' characters so that the final string becomes beautiful.
Below there was also written that a string is called beautiful if for each *i* (1<=≤<=*i*<=≤<=|*s*|) there are no more ')' characters than '(' characters among the first *i* characters of *s* and also the total number of '(' characters is equal to the total number of ')' characters.
Help Malek open the door by telling him for each '#' character how many ')' characters he must replace it with.
|
The first line of the input contains a string *s* (1<=≤<=|*s*|<=≤<=105). Each character of this string is one of the characters '(', ')' or '#'. It is guaranteed that *s* contains at least one '#' character.
|
If there is no way of replacing '#' characters which leads to a beautiful string print <=-<=1. Otherwise for each character '#' print a separate line containing a positive integer, the number of ')' characters this character must be replaced with.
If there are several possible answers, you may output any of them.
|
[
"(((#)((#)\n",
"()((#((#(#()\n",
"#\n",
"(#)\n"
] |
[
"1\n2\n",
"2\n2\n1",
"-1\n",
"-1\n"
] |
|*s*| denotes the length of the string *s*.
| 500 |
[
{
"input": "(((#)((#)",
"output": "1\n2"
},
{
"input": "()((#((#(#()",
"output": "1\n1\n3"
},
{
"input": "#",
"output": "-1"
},
{
"input": "(#)",
"output": "-1"
},
{
"input": "(((((#(#(#(#()",
"output": "1\n1\n1\n5"
},
{
"input": "#))))",
"output": "-1"
},
{
"input": "((#(()#(##",
"output": "1\n1\n1\n1"
},
{
"input": "##((((((()",
"output": "-1"
},
{
"input": "(((((((((((((((((((###################",
"output": "1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1"
},
{
"input": "((#)(",
"output": "-1"
},
{
"input": "((#)((#)((#)((#)((#)((#)((#)((#)((#)((#)((#)((#)((#)((#)((#)((##",
"output": "1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1"
},
{
"input": ")((##((###",
"output": "-1"
},
{
"input": "(#))(#(#)((((#(##((#(#((((#(##((((((#((()(()(())((()#((((#((()((((#(((((#(##)(##()((((()())(((((#(((",
"output": "-1"
},
{
"input": "#(#(#((##((()))(((#)(#()#(((()()(()#(##(((()(((()))#(((((()(((((((()#((#((()(#(((()(()##(()(((()((#(",
"output": "-1"
},
{
"input": "((#(",
"output": "-1"
},
{
"input": "()#(#())()()#)(#)()##)#((()#)((#)()#())((#((((((((#)()()(()()(((((#)#(#((((#((##()(##(((#(()(#((#))#",
"output": "-1"
},
{
"input": "(())((((#)",
"output": "3"
},
{
"input": "(#(",
"output": "-1"
},
{
"input": "((#)(",
"output": "-1"
},
{
"input": "(((()#(#)(",
"output": "-1"
},
{
"input": "#((#",
"output": "-1"
},
{
"input": "(#((((()",
"output": "-1"
},
{
"input": "(#((",
"output": "-1"
},
{
"input": ")(((())#",
"output": "-1"
}
] | 1,638,579,709 | 2,147,483,647 |
PyPy 3
|
WRONG_ANSWER
|
TESTS
| 13 | 77 | 4,198,400 |
ans=[]
s=input()
c=0;v=0
for x in s:
if x=='(':
c+=1
v+=1
elif x==')':
c-=1
v-=1
else:
v=0
c-=1
if c < 0: print(-1);exit()
ans.append(1)
if c < 0: print(-1);exit()
ans[-1]+=c
if v>0: print(-1);exit()
print(*ans)
|
Title: Treasure
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Malek has recently found a treasure map. While he was looking for a treasure he found a locked door. There was a string *s* written on the door consisting of characters '(', ')' and '#'. Below there was a manual on how to open the door. After spending a long time Malek managed to decode the manual and found out that the goal is to replace each '#' with one or more ')' characters so that the final string becomes beautiful.
Below there was also written that a string is called beautiful if for each *i* (1<=≤<=*i*<=≤<=|*s*|) there are no more ')' characters than '(' characters among the first *i* characters of *s* and also the total number of '(' characters is equal to the total number of ')' characters.
Help Malek open the door by telling him for each '#' character how many ')' characters he must replace it with.
Input Specification:
The first line of the input contains a string *s* (1<=≤<=|*s*|<=≤<=105). Each character of this string is one of the characters '(', ')' or '#'. It is guaranteed that *s* contains at least one '#' character.
Output Specification:
If there is no way of replacing '#' characters which leads to a beautiful string print <=-<=1. Otherwise for each character '#' print a separate line containing a positive integer, the number of ')' characters this character must be replaced with.
If there are several possible answers, you may output any of them.
Demo Input:
['(((#)((#)\n', '()((#((#(#()\n', '#\n', '(#)\n']
Demo Output:
['1\n2\n', '2\n2\n1', '-1\n', '-1\n']
Note:
|*s*| denotes the length of the string *s*.
|
```python
ans=[]
s=input()
c=0;v=0
for x in s:
if x=='(':
c+=1
v+=1
elif x==')':
c-=1
v-=1
else:
v=0
c-=1
if c < 0: print(-1);exit()
ans.append(1)
if c < 0: print(-1);exit()
ans[-1]+=c
if v>0: print(-1);exit()
print(*ans)
```
| 0 |
|
732 |
A
|
Buy a Shovel
|
PROGRAMMING
| 800 |
[
"brute force",
"constructive algorithms",
"implementation",
"math"
] | null | null |
Polycarp urgently needs a shovel! He comes to the shop and chooses an appropriate one. The shovel that Policarp chooses is sold for *k* burles. Assume that there is an unlimited number of such shovels in the shop.
In his pocket Polycarp has an unlimited number of "10-burle coins" and exactly one coin of *r* burles (1<=≤<=*r*<=≤<=9).
What is the minimum number of shovels Polycarp has to buy so that he can pay for the purchase without any change? It is obvious that he can pay for 10 shovels without any change (by paying the requied amount of 10-burle coins and not using the coin of *r* burles). But perhaps he can buy fewer shovels and pay without any change. Note that Polycarp should buy at least one shovel.
|
The single line of input contains two integers *k* and *r* (1<=≤<=*k*<=≤<=1000, 1<=≤<=*r*<=≤<=9) — the price of one shovel and the denomination of the coin in Polycarp's pocket that is different from "10-burle coins".
Remember that he has an unlimited number of coins in the denomination of 10, that is, Polycarp has enough money to buy any number of shovels.
|
Print the required minimum number of shovels Polycarp has to buy so that he can pay for them without any change.
|
[
"117 3\n",
"237 7\n",
"15 2\n"
] |
[
"9\n",
"1\n",
"2\n"
] |
In the first example Polycarp can buy 9 shovels and pay 9·117 = 1053 burles. Indeed, he can pay this sum by using 10-burle coins and one 3-burle coin. He can't buy fewer shovels without any change.
In the second example it is enough for Polycarp to buy one shovel.
In the third example Polycarp should buy two shovels and pay 2·15 = 30 burles. It is obvious that he can pay this sum without any change.
| 500 |
[
{
"input": "117 3",
"output": "9"
},
{
"input": "237 7",
"output": "1"
},
{
"input": "15 2",
"output": "2"
},
{
"input": "1 1",
"output": "1"
},
{
"input": "1 9",
"output": "9"
},
{
"input": "1000 3",
"output": "1"
},
{
"input": "1000 1",
"output": "1"
},
{
"input": "1000 9",
"output": "1"
},
{
"input": "1 2",
"output": "2"
},
{
"input": "999 9",
"output": "1"
},
{
"input": "999 8",
"output": "2"
},
{
"input": "105 6",
"output": "2"
},
{
"input": "403 9",
"output": "3"
},
{
"input": "546 4",
"output": "4"
},
{
"input": "228 9",
"output": "5"
},
{
"input": "57 2",
"output": "6"
},
{
"input": "437 9",
"output": "7"
},
{
"input": "997 6",
"output": "8"
},
{
"input": "109 1",
"output": "9"
},
{
"input": "998 9",
"output": "5"
},
{
"input": "4 2",
"output": "3"
},
{
"input": "9 3",
"output": "7"
},
{
"input": "8 2",
"output": "4"
},
{
"input": "1 3",
"output": "3"
},
{
"input": "1 4",
"output": "4"
},
{
"input": "1 5",
"output": "5"
},
{
"input": "1 6",
"output": "6"
},
{
"input": "1 7",
"output": "7"
},
{
"input": "1 8",
"output": "8"
},
{
"input": "100 3",
"output": "1"
},
{
"input": "1000 2",
"output": "1"
},
{
"input": "1000 4",
"output": "1"
},
{
"input": "1000 5",
"output": "1"
},
{
"input": "1000 6",
"output": "1"
},
{
"input": "1000 7",
"output": "1"
},
{
"input": "1000 8",
"output": "1"
},
{
"input": "23 4",
"output": "8"
},
{
"input": "33 1",
"output": "7"
},
{
"input": "33 2",
"output": "4"
},
{
"input": "666 5",
"output": "5"
},
{
"input": "2 3",
"output": "5"
},
{
"input": "5 5",
"output": "1"
},
{
"input": "3 6",
"output": "2"
},
{
"input": "12 4",
"output": "2"
},
{
"input": "15 5",
"output": "1"
},
{
"input": "2 5",
"output": "5"
},
{
"input": "25 5",
"output": "1"
},
{
"input": "2 9",
"output": "5"
},
{
"input": "6 7",
"output": "5"
},
{
"input": "8 9",
"output": "5"
},
{
"input": "2 7",
"output": "5"
},
{
"input": "4 7",
"output": "5"
},
{
"input": "2 1",
"output": "5"
},
{
"input": "261 1",
"output": "1"
}
] | 1,683,376,029 | 2,147,483,647 |
PyPy 3-64
|
WRONG_ANSWER
|
TESTS
| 0 | 46 | 0 |
k,r=list(map(int,input().split(' ')))
cnt=1
while k%10!=0 and k%10!=r:
cnt+=1
k=(k*cnt)%10
print(k)
print(cnt)
|
Title: Buy a Shovel
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Polycarp urgently needs a shovel! He comes to the shop and chooses an appropriate one. The shovel that Policarp chooses is sold for *k* burles. Assume that there is an unlimited number of such shovels in the shop.
In his pocket Polycarp has an unlimited number of "10-burle coins" and exactly one coin of *r* burles (1<=≤<=*r*<=≤<=9).
What is the minimum number of shovels Polycarp has to buy so that he can pay for the purchase without any change? It is obvious that he can pay for 10 shovels without any change (by paying the requied amount of 10-burle coins and not using the coin of *r* burles). But perhaps he can buy fewer shovels and pay without any change. Note that Polycarp should buy at least one shovel.
Input Specification:
The single line of input contains two integers *k* and *r* (1<=≤<=*k*<=≤<=1000, 1<=≤<=*r*<=≤<=9) — the price of one shovel and the denomination of the coin in Polycarp's pocket that is different from "10-burle coins".
Remember that he has an unlimited number of coins in the denomination of 10, that is, Polycarp has enough money to buy any number of shovels.
Output Specification:
Print the required minimum number of shovels Polycarp has to buy so that he can pay for them without any change.
Demo Input:
['117 3\n', '237 7\n', '15 2\n']
Demo Output:
['9\n', '1\n', '2\n']
Note:
In the first example Polycarp can buy 9 shovels and pay 9·117 = 1053 burles. Indeed, he can pay this sum by using 10-burle coins and one 3-burle coin. He can't buy fewer shovels without any change.
In the second example it is enough for Polycarp to buy one shovel.
In the third example Polycarp should buy two shovels and pay 2·15 = 30 burles. It is obvious that he can pay this sum without any change.
|
```python
k,r=list(map(int,input().split(' ')))
cnt=1
while k%10!=0 and k%10!=r:
cnt+=1
k=(k*cnt)%10
print(k)
print(cnt)
```
| 0 |
|
215 |
A
|
Bicycle Chain
|
PROGRAMMING
| 900 |
[
"brute force",
"implementation"
] | null | null |
Vasya's bicycle chain drive consists of two parts: *n* stars are attached to the pedal axle, *m* stars are attached to the rear wheel axle. The chain helps to rotate the rear wheel by transmitting the pedal rotation.
We know that the *i*-th star on the pedal axle has *a**i* (0<=<<=*a*1<=<<=*a*2<=<<=...<=<<=*a**n*) teeth, and the *j*-th star on the rear wheel axle has *b**j* (0<=<<=*b*1<=<<=*b*2<=<<=...<=<<=*b**m*) teeth. Any pair (*i*,<=*j*) (1<=≤<=*i*<=≤<=*n*; 1<=≤<=*j*<=≤<=*m*) is called a gear and sets the indexes of stars to which the chain is currently attached. Gear (*i*,<=*j*) has a gear ratio, equal to the value .
Since Vasya likes integers, he wants to find such gears (*i*,<=*j*), that their ratios are integers. On the other hand, Vasya likes fast driving, so among all "integer" gears (*i*,<=*j*) he wants to choose a gear with the maximum ratio. Help him to find the number of such gears.
In the problem, fraction denotes division in real numbers, that is, no rounding is performed.
|
The first input line contains integer *n* (1<=≤<=*n*<=≤<=50) — the number of stars on the bicycle's pedal axle. The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=104) in the order of strict increasing.
The third input line contains integer *m* (1<=≤<=*m*<=≤<=50) — the number of stars on the rear wheel axle. The fourth line contains *m* integers *b*1,<=*b*2,<=...,<=*b**m* (1<=≤<=*b**i*<=≤<=104) in the order of strict increasing.
It is guaranteed that there exists at least one gear (*i*,<=*j*), that its gear ratio is an integer. The numbers on the lines are separated by spaces.
|
Print the number of "integer" gears with the maximum ratio among all "integer" gears.
|
[
"2\n4 5\n3\n12 13 15\n",
"4\n1 2 3 4\n5\n10 11 12 13 14\n"
] |
[
"2\n",
"1\n"
] |
In the first sample the maximum "integer" gear ratio equals 3. There are two gears that have such gear ratio. For one of them *a*<sub class="lower-index">1</sub> = 4, *b*<sub class="lower-index">1</sub> = 12, and for the other *a*<sub class="lower-index">2</sub> = 5, *b*<sub class="lower-index">3</sub> = 15.
| 500 |
[
{
"input": "2\n4 5\n3\n12 13 15",
"output": "2"
},
{
"input": "4\n1 2 3 4\n5\n10 11 12 13 14",
"output": "1"
},
{
"input": "1\n1\n1\n1",
"output": "1"
},
{
"input": "2\n1 2\n1\n1",
"output": "1"
},
{
"input": "1\n1\n2\n1 2",
"output": "1"
},
{
"input": "4\n3 7 11 13\n4\n51 119 187 221",
"output": "4"
},
{
"input": "4\n2 3 4 5\n3\n1 2 3",
"output": "2"
},
{
"input": "10\n6 12 13 20 48 53 74 92 96 97\n10\n1 21 32 36 47 54 69 75 95 97",
"output": "1"
},
{
"input": "10\n5 9 10 14 15 17 19 22 24 26\n10\n2 11 17 19 21 22 24 25 27 28",
"output": "1"
},
{
"input": "10\n24 53 56 126 354 432 442 740 795 856\n10\n273 438 494 619 689 711 894 947 954 958",
"output": "1"
},
{
"input": "10\n3 4 6 7 8 10 14 16 19 20\n10\n3 4 5 7 8 10 15 16 18 20",
"output": "1"
},
{
"input": "10\n1 6 8 14 15 17 25 27 34 39\n10\n1 8 16 17 19 22 32 39 44 50",
"output": "1"
},
{
"input": "10\n5 21 22 23 25 32 35 36 38 39\n10\n3 7 8 9 18 21 23 24 36 38",
"output": "4"
},
{
"input": "50\n5 8 13 16 19 20 21 22 24 27 28 29 30 32 33 34 35 43 45 48 50 51 54 55 58 59 60 61 62 65 70 71 72 76 78 79 80 81 83 84 85 87 89 91 92 94 97 98 99 100\n50\n2 3 5 6 7 10 15 16 17 20 23 28 29 30 31 34 36 37 40 42 45 46 48 54 55 56 58 59 61 62 69 70 71 72 75 76 78 82 84 85 86 87 88 89 90 91 92 97 99 100",
"output": "1"
},
{
"input": "50\n3 5 6 8 9 11 13 19 21 23 24 32 34 35 42 50 51 52 56 58 59 69 70 72 73 75 76 77 78 80 83 88 90 95 96 100 101 102 108 109 113 119 124 135 138 141 142 143 145 150\n50\n5 8 10 11 18 19 23 30 35 43 51 53 55 58 63 68 69 71 77 78 79 82 83 86 88 89 91 92 93 94 96 102 103 105 109 110 113 114 116 123 124 126 127 132 133 135 136 137 142 149",
"output": "1"
},
{
"input": "50\n6 16 24 25 27 33 36 40 51 60 62 65 71 72 75 77 85 87 91 93 98 102 103 106 117 118 120 121 122 123 125 131 134 136 143 148 155 157 160 161 164 166 170 178 184 187 188 192 194 197\n50\n5 9 17 23 27 34 40 44 47 59 62 70 81 82 87 88 89 90 98 101 102 110 113 114 115 116 119 122 124 128 130 137 138 140 144 150 152 155 159 164 166 169 171 175 185 186 187 189 190 193",
"output": "1"
},
{
"input": "50\n14 22 23 31 32 35 48 63 76 79 88 97 101 102 103 104 106 113 114 115 116 126 136 138 145 152 155 156 162 170 172 173 179 180 182 203 208 210 212 222 226 229 231 232 235 237 245 246 247 248\n50\n2 5 6 16 28 44 45 46 54 55 56 63 72 80 87 93 94 96 97 100 101 103 132 135 140 160 164 165 167 168 173 180 182 185 186 192 194 198 199 202 203 211 213 216 217 227 232 233 236 245",
"output": "1"
},
{
"input": "50\n14 19 33 35 38 41 51 54 69 70 71 73 76 80 84 94 102 104 105 106 107 113 121 128 131 168 180 181 187 191 195 201 205 207 210 216 220 238 249 251 263 271 272 275 281 283 285 286 291 294\n50\n2 3 5 20 21 35 38 40 43 48 49 52 55 64 73 77 82 97 109 113 119 121 125 132 137 139 145 146 149 180 182 197 203 229 234 241 244 251 264 271 274 281 284 285 287 291 292 293 294 298",
"output": "1"
},
{
"input": "50\n2 4 5 16 18 19 22 23 25 26 34 44 48 54 67 79 80 84 92 110 116 133 138 154 163 171 174 202 205 218 228 229 234 245 247 249 250 263 270 272 274 275 277 283 289 310 312 334 339 342\n50\n1 5 17 18 25 37 46 47 48 59 67 75 80 83 84 107 115 122 137 141 159 162 175 180 184 204 221 224 240 243 247 248 249 258 259 260 264 266 269 271 274 293 294 306 329 330 334 335 342 350",
"output": "1"
},
{
"input": "50\n6 9 11 21 28 39 42 56 60 63 81 88 91 95 105 110 117 125 149 165 174 176 185 189 193 196 205 231 233 268 278 279 281 286 289 292 298 303 305 306 334 342 350 353 361 371 372 375 376 378\n50\n6 17 20 43 45 52 58 59 82 83 88 102 111 118 121 131 145 173 190 191 200 216 224 225 232 235 243 256 260 271 290 291 321 322 323 329 331 333 334 341 343 348 351 354 356 360 366 379 387 388",
"output": "1"
},
{
"input": "10\n17 239 443 467 661 1069 1823 2333 3767 4201\n20\n51 83 97 457 593 717 997 1329 1401 1459 1471 1983 2371 2539 3207 3251 3329 5469 6637 6999",
"output": "8"
},
{
"input": "20\n179 359 401 467 521 601 919 941 1103 1279 1709 1913 1949 2003 2099 2143 2179 2213 2399 4673\n20\n151 181 191 251 421 967 1109 1181 1249 1447 1471 1553 1619 2327 2551 2791 3049 3727 6071 7813",
"output": "3"
},
{
"input": "20\n79 113 151 709 809 983 1291 1399 1409 1429 2377 2659 2671 2897 3217 3511 3557 3797 3823 4363\n10\n19 101 659 797 1027 1963 2129 2971 3299 9217",
"output": "3"
},
{
"input": "30\n19 47 109 179 307 331 389 401 461 509 547 569 617 853 883 1249 1361 1381 1511 1723 1741 1783 2459 2531 2621 3533 3821 4091 5557 6217\n20\n401 443 563 941 967 997 1535 1567 1655 1747 1787 1945 1999 2251 2305 2543 2735 4415 6245 7555",
"output": "8"
},
{
"input": "30\n3 43 97 179 257 313 353 359 367 389 397 457 547 599 601 647 1013 1021 1063 1433 1481 1531 1669 3181 3373 3559 3769 4157 4549 5197\n50\n13 15 17 19 29 79 113 193 197 199 215 223 271 293 359 485 487 569 601 683 895 919 941 967 1283 1285 1289 1549 1565 1765 1795 1835 1907 1931 1945 1985 1993 2285 2731 2735 2995 3257 4049 4139 5105 5315 7165 7405 7655 8345",
"output": "20"
},
{
"input": "50\n11 17 23 53 59 109 137 149 173 251 353 379 419 421 439 503 593 607 661 773 821 877 941 997 1061 1117 1153 1229 1289 1297 1321 1609 1747 2311 2389 2543 2693 3041 3083 3137 3181 3209 3331 3373 3617 3767 4201 4409 4931 6379\n50\n55 59 67 73 85 89 101 115 211 263 295 353 545 599 607 685 739 745 997 1031 1255 1493 1523 1667 1709 1895 1949 2161 2195 2965 3019 3035 3305 3361 3373 3673 3739 3865 3881 4231 4253 4385 4985 5305 5585 5765 6145 6445 8045 8735",
"output": "23"
},
{
"input": "5\n33 78 146 3055 4268\n5\n2211 2584 5226 9402 9782",
"output": "3"
},
{
"input": "5\n35 48 52 86 8001\n10\n332 3430 3554 4704 4860 5096 6215 7583 8228 8428",
"output": "4"
},
{
"input": "10\n97 184 207 228 269 2084 4450 6396 7214 9457\n16\n338 1179 1284 1545 1570 2444 3167 3395 3397 5550 6440 7245 7804 7980 9415 9959",
"output": "5"
},
{
"input": "30\n25 30 41 57 58 62 70 72 76 79 84 85 88 91 98 101 104 109 119 129 136 139 148 151 926 1372 3093 3936 5423 7350\n25\n1600 1920 2624 3648 3712 3968 4480 4608 4864 5056 5376 5440 5632 5824 6272 6464 6656 6934 6976 7616 8256 8704 8896 9472 9664",
"output": "24"
},
{
"input": "5\n33 78 146 3055 4268\n5\n2211 2584 5226 9402 9782",
"output": "3"
},
{
"input": "5\n35 48 52 86 8001\n10\n332 3430 3554 4704 4860 5096 6215 7583 8228 8428",
"output": "4"
},
{
"input": "10\n97 184 207 228 269 2084 4450 6396 7214 9457\n16\n338 1179 1284 1545 1570 2444 3167 3395 3397 5550 6440 7245 7804 7980 9415 9959",
"output": "5"
},
{
"input": "30\n25 30 41 57 58 62 70 72 76 79 84 85 88 91 98 101 104 109 119 129 136 139 148 151 926 1372 3093 3936 5423 7350\n25\n1600 1920 2624 3648 3712 3968 4480 4608 4864 5056 5376 5440 5632 5824 6272 6464 6656 6934 6976 7616 8256 8704 8896 9472 9664",
"output": "24"
},
{
"input": "47\n66 262 357 457 513 530 538 540 592 691 707 979 1015 1242 1246 1667 1823 1886 1963 2133 2649 2679 2916 2949 3413 3523 3699 3958 4393 4922 5233 5306 5799 6036 6302 6629 7208 7282 7315 7822 7833 7927 8068 8150 8870 8962 9987\n39\n167 199 360 528 1515 1643 1986 1988 2154 2397 2856 3552 3656 3784 3980 4096 4104 4240 4320 4736 4951 5266 5656 5849 5850 6169 6517 6875 7244 7339 7689 7832 8120 8716 9503 9509 9933 9936 9968",
"output": "12"
},
{
"input": "1\n94\n50\n423 446 485 1214 1468 1507 1853 1930 1999 2258 2271 2285 2425 2543 2715 2743 2992 3196 4074 4108 4448 4475 4652 5057 5250 5312 5356 5375 5731 5986 6298 6501 6521 7146 7255 7276 7332 7481 7998 8141 8413 8665 8908 9221 9336 9491 9504 9677 9693 9706",
"output": "1"
},
{
"input": "50\n51 67 75 186 194 355 512 561 720 876 1077 1221 1503 1820 2153 2385 2568 2608 2937 2969 3271 3311 3481 4081 4093 4171 4255 4256 4829 5020 5192 5636 5817 6156 6712 6717 7153 7436 7608 7612 7866 7988 8264 8293 8867 9311 9879 9882 9889 9908\n1\n5394",
"output": "1"
},
{
"input": "50\n26 367 495 585 675 789 855 1185 1312 1606 2037 2241 2587 2612 2628 2807 2873 2924 3774 4067 4376 4668 4902 5001 5082 5100 5104 5209 5345 5515 5661 5777 5902 5907 6155 6323 6675 6791 7503 8159 8207 8254 8740 8848 8855 8933 9069 9164 9171 9586\n5\n1557 6246 7545 8074 8284",
"output": "1"
},
{
"input": "5\n25 58 91 110 2658\n50\n21 372 909 1172 1517 1554 1797 1802 1843 1977 2006 2025 2137 2225 2317 2507 2645 2754 2919 3024 3202 3212 3267 3852 4374 4487 4553 4668 4883 4911 4916 5016 5021 5068 5104 5162 5683 5856 6374 6871 7333 7531 8099 8135 8173 8215 8462 8776 9433 9790",
"output": "4"
},
{
"input": "45\n37 48 56 59 69 70 79 83 85 86 99 114 131 134 135 145 156 250 1739 1947 2116 2315 2449 3104 3666 4008 4406 4723 4829 5345 5836 6262 6296 6870 7065 7110 7130 7510 7595 8092 8442 8574 9032 9091 9355\n50\n343 846 893 1110 1651 1837 2162 2331 2596 3012 3024 3131 3294 3394 3528 3717 3997 4125 4347 4410 4581 4977 5030 5070 5119 5229 5355 5413 5418 5474 5763 5940 6151 6161 6164 6237 6506 6519 6783 7182 7413 7534 8069 8253 8442 8505 9135 9308 9828 9902",
"output": "17"
},
{
"input": "50\n17 20 22 28 36 38 46 47 48 50 52 57 58 62 63 69 70 74 75 78 79 81 82 86 87 90 93 95 103 202 292 442 1756 1769 2208 2311 2799 2957 3483 4280 4324 4932 5109 5204 6225 6354 6561 7136 8754 9670\n40\n68 214 957 1649 1940 2078 2134 2716 3492 3686 4462 4559 4656 4756 4850 5044 5490 5529 5592 5626 6014 6111 6693 6790 7178 7275 7566 7663 7702 7857 7954 8342 8511 8730 8957 9021 9215 9377 9445 9991",
"output": "28"
},
{
"input": "39\n10 13 21 25 36 38 47 48 58 64 68 69 73 79 86 972 2012 2215 2267 2503 3717 3945 4197 4800 5266 6169 6612 6824 7023 7322 7582 7766 8381 8626 8879 9079 9088 9838 9968\n50\n432 877 970 1152 1202 1223 1261 1435 1454 1578 1843 1907 2003 2037 2183 2195 2215 2425 3065 3492 3615 3637 3686 3946 4189 4415 4559 4656 4665 4707 4886 4887 5626 5703 5955 6208 6521 6581 6596 6693 6985 7013 7081 7343 7663 8332 8342 8637 9207 9862",
"output": "15"
},
{
"input": "50\n7 144 269 339 395 505 625 688 709 950 1102 1152 1350 1381 1641 1830 1977 1999 2093 2180 2718 3308 3574 4168 4232 4259 4393 4689 4982 5154 5476 5581 5635 5721 6159 6302 6741 7010 7152 7315 7417 7482 8116 8239 8640 9347 9395 9614 9661 9822\n20\n84 162 292 1728 1866 2088 3228 3470 4068 5318 5470 6060 6380 6929 7500 8256 8399 8467 8508 9691",
"output": "8"
},
{
"input": "50\n159 880 1070 1139 1358 1608 1691 1841 2073 2171 2213 2597 2692 2759 2879 2931 3173 3217 3441 4201 4878 5106 5129 5253 5395 5647 5968 6019 6130 6276 6286 6330 6409 6728 7488 7713 7765 7828 7899 8064 8264 8457 8483 8685 8900 8946 8965 9133 9187 9638\n45\n57 159 1070 1139 1391 1608 1691 1841 2171 2213 2692 2759 2931 3173 3217 3441 4201 4878 5106 5129 5253 5647 5968 6130 6276 6286 6409 7488 7694 7713 7765 7828 7899 8003 8064 8081 8244 8264 8685 8900 8946 8965 9133 9638 9673",
"output": "38"
},
{
"input": "3\n3 4 5\n3\n6 20 25",
"output": "2"
},
{
"input": "4\n2 3 5 8\n4\n2 6 8 10",
"output": "1"
},
{
"input": "4\n3 5 7 11\n4\n3 5 7 22",
"output": "1"
},
{
"input": "2\n2 3\n3\n20 30 50",
"output": "1"
},
{
"input": "3\n1 2 3\n4\n2 4 6 49",
"output": "1"
},
{
"input": "2\n4 5\n3\n12 15 20",
"output": "1"
},
{
"input": "3\n2 5 7\n3\n4 5 7",
"output": "1"
},
{
"input": "3\n3 5 8\n3\n6 8 10",
"output": "2"
},
{
"input": "2\n2 3\n4\n4 6 9 33",
"output": "1"
},
{
"input": "2\n2 3\n4\n4 6 21 40",
"output": "1"
},
{
"input": "3\n4 9 10\n3\n8 9 10",
"output": "1"
},
{
"input": "5\n1 5 6 9 51\n5\n5 12 18 27 10000",
"output": "1"
},
{
"input": "13\n1 2 3 4 5 6 7 8 9 10 11 12 13\n1\n14",
"output": "1"
}
] | 1,637,305,733 | 2,147,483,647 |
Python 3
|
OK
|
TESTS
| 57 | 92 | 0 |
n=int(input())
a=[int(x) for x in input().split()]
m=int(input())
b=[int(x) for x in input().split()]
lst=[]
for i in a:
for j in b:
if j%i==0:
lst.append(j//i)
print(lst.count(max(lst)))
|
Title: Bicycle Chain
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Vasya's bicycle chain drive consists of two parts: *n* stars are attached to the pedal axle, *m* stars are attached to the rear wheel axle. The chain helps to rotate the rear wheel by transmitting the pedal rotation.
We know that the *i*-th star on the pedal axle has *a**i* (0<=<<=*a*1<=<<=*a*2<=<<=...<=<<=*a**n*) teeth, and the *j*-th star on the rear wheel axle has *b**j* (0<=<<=*b*1<=<<=*b*2<=<<=...<=<<=*b**m*) teeth. Any pair (*i*,<=*j*) (1<=≤<=*i*<=≤<=*n*; 1<=≤<=*j*<=≤<=*m*) is called a gear and sets the indexes of stars to which the chain is currently attached. Gear (*i*,<=*j*) has a gear ratio, equal to the value .
Since Vasya likes integers, he wants to find such gears (*i*,<=*j*), that their ratios are integers. On the other hand, Vasya likes fast driving, so among all "integer" gears (*i*,<=*j*) he wants to choose a gear with the maximum ratio. Help him to find the number of such gears.
In the problem, fraction denotes division in real numbers, that is, no rounding is performed.
Input Specification:
The first input line contains integer *n* (1<=≤<=*n*<=≤<=50) — the number of stars on the bicycle's pedal axle. The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=104) in the order of strict increasing.
The third input line contains integer *m* (1<=≤<=*m*<=≤<=50) — the number of stars on the rear wheel axle. The fourth line contains *m* integers *b*1,<=*b*2,<=...,<=*b**m* (1<=≤<=*b**i*<=≤<=104) in the order of strict increasing.
It is guaranteed that there exists at least one gear (*i*,<=*j*), that its gear ratio is an integer. The numbers on the lines are separated by spaces.
Output Specification:
Print the number of "integer" gears with the maximum ratio among all "integer" gears.
Demo Input:
['2\n4 5\n3\n12 13 15\n', '4\n1 2 3 4\n5\n10 11 12 13 14\n']
Demo Output:
['2\n', '1\n']
Note:
In the first sample the maximum "integer" gear ratio equals 3. There are two gears that have such gear ratio. For one of them *a*<sub class="lower-index">1</sub> = 4, *b*<sub class="lower-index">1</sub> = 12, and for the other *a*<sub class="lower-index">2</sub> = 5, *b*<sub class="lower-index">3</sub> = 15.
|
```python
n=int(input())
a=[int(x) for x in input().split()]
m=int(input())
b=[int(x) for x in input().split()]
lst=[]
for i in a:
for j in b:
if j%i==0:
lst.append(j//i)
print(lst.count(max(lst)))
```
| 3 |
|
149 |
A
|
Business trip
|
PROGRAMMING
| 900 |
[
"greedy",
"implementation",
"sortings"
] | null | null |
What joy! Petya's parents went on a business trip for the whole year and the playful kid is left all by himself. Petya got absolutely happy. He jumped on the bed and threw pillows all day long, until...
Today Petya opened the cupboard and found a scary note there. His parents had left him with duties: he should water their favourite flower all year, each day, in the morning, in the afternoon and in the evening. "Wait a second!" — thought Petya. He know for a fact that if he fulfills the parents' task in the *i*-th (1<=≤<=*i*<=≤<=12) month of the year, then the flower will grow by *a**i* centimeters, and if he doesn't water the flower in the *i*-th month, then the flower won't grow this month. Petya also knows that try as he might, his parents won't believe that he has been watering the flower if it grows strictly less than by *k* centimeters.
Help Petya choose the minimum number of months when he will water the flower, given that the flower should grow no less than by *k* centimeters.
|
The first line contains exactly one integer *k* (0<=≤<=*k*<=≤<=100). The next line contains twelve space-separated integers: the *i*-th (1<=≤<=*i*<=≤<=12) number in the line represents *a**i* (0<=≤<=*a**i*<=≤<=100).
|
Print the only integer — the minimum number of months when Petya has to water the flower so that the flower grows no less than by *k* centimeters. If the flower can't grow by *k* centimeters in a year, print -1.
|
[
"5\n1 1 1 1 2 2 3 2 2 1 1 1\n",
"0\n0 0 0 0 0 0 0 1 1 2 3 0\n",
"11\n1 1 4 1 1 5 1 1 4 1 1 1\n"
] |
[
"2\n",
"0\n",
"3\n"
] |
Let's consider the first sample test. There it is enough to water the flower during the seventh and the ninth month. Then the flower grows by exactly five centimeters.
In the second sample Petya's parents will believe him even if the flower doesn't grow at all (*k* = 0). So, it is possible for Petya not to water the flower at all.
| 500 |
[
{
"input": "5\n1 1 1 1 2 2 3 2 2 1 1 1",
"output": "2"
},
{
"input": "0\n0 0 0 0 0 0 0 1 1 2 3 0",
"output": "0"
},
{
"input": "11\n1 1 4 1 1 5 1 1 4 1 1 1",
"output": "3"
},
{
"input": "15\n20 1 1 1 1 2 2 1 2 2 1 1",
"output": "1"
},
{
"input": "7\n8 9 100 12 14 17 21 10 11 100 23 10",
"output": "1"
},
{
"input": "52\n1 12 3 11 4 5 10 6 9 7 8 2",
"output": "6"
},
{
"input": "50\n2 2 3 4 5 4 4 5 7 3 2 7",
"output": "-1"
},
{
"input": "0\n55 81 28 48 99 20 67 95 6 19 10 93",
"output": "0"
},
{
"input": "93\n85 40 93 66 92 43 61 3 64 51 90 21",
"output": "1"
},
{
"input": "99\n36 34 22 0 0 0 52 12 0 0 33 47",
"output": "2"
},
{
"input": "99\n28 32 31 0 10 35 11 18 0 0 32 28",
"output": "3"
},
{
"input": "99\n19 17 0 1 18 11 29 9 29 22 0 8",
"output": "4"
},
{
"input": "76\n2 16 11 10 12 0 20 4 4 14 11 14",
"output": "5"
},
{
"input": "41\n2 1 7 7 4 2 4 4 9 3 10 0",
"output": "6"
},
{
"input": "47\n8 2 2 4 3 1 9 4 2 7 7 8",
"output": "7"
},
{
"input": "58\n6 11 7 0 5 6 3 9 4 9 5 1",
"output": "8"
},
{
"input": "32\n5 2 4 1 5 0 5 1 4 3 0 3",
"output": "9"
},
{
"input": "31\n6 1 0 4 4 5 1 0 5 3 2 0",
"output": "9"
},
{
"input": "35\n2 3 0 0 6 3 3 4 3 5 0 6",
"output": "9"
},
{
"input": "41\n3 1 3 4 3 6 6 1 4 4 0 6",
"output": "11"
},
{
"input": "97\n0 5 3 12 10 16 22 8 21 17 21 10",
"output": "5"
},
{
"input": "100\n21 21 0 0 4 13 0 26 0 0 0 15",
"output": "6"
},
{
"input": "100\n0 0 16 5 22 0 5 0 25 0 14 13",
"output": "7"
},
{
"input": "97\n17 0 10 0 0 0 18 0 14 23 15 0",
"output": "6"
},
{
"input": "100\n0 9 0 18 7 0 0 14 33 3 0 16",
"output": "7"
},
{
"input": "95\n5 2 13 0 15 18 17 0 6 11 0 8",
"output": "9"
},
{
"input": "94\n11 13 0 9 15 8 8 16 3 7 1 3",
"output": "11"
},
{
"input": "96\n8 4 12 15 8 0 4 10 6 6 12 11",
"output": "11"
},
{
"input": "100\n5 5 3 8 6 5 0 3 3 8 1 3",
"output": "-1"
},
{
"input": "100\n1 0 0 1 1 0 1 1 1 1 2 1",
"output": "-1"
},
{
"input": "100\n6 3 2 0 4 1 2 2 2 2 1 1",
"output": "-1"
},
{
"input": "0\n0 0 0 0 0 0 0 0 0 0 0 0",
"output": "0"
},
{
"input": "100\n0 0 0 0 0 0 0 0 0 0 0 0",
"output": "-1"
},
{
"input": "0\n100 100 100 100 100 100 100 100 100 100 100 100",
"output": "0"
},
{
"input": "100\n100 100 100 100 100 100 100 100 100 100 100 100",
"output": "1"
},
{
"input": "12\n1 1 1 1 1 1 1 1 1 1 1 1",
"output": "12"
},
{
"input": "13\n1 1 1 1 1 1 1 1 1 1 1 2",
"output": "12"
},
{
"input": "15\n10 1 1 1 1 1 1 1 1 1 1 1",
"output": "6"
},
{
"input": "1\n0 0 0 0 0 0 0 0 0 0 0 0",
"output": "-1"
}
] | 1,691,388,094 | 2,147,483,647 |
Python 3
|
WRONG_ANSWER
|
TESTS
| 6 | 62 | 0 |
k = int(input())
a = list(map(int, input().split()))
a.sort()
a = a[::-1]
s = 0
c = 0
for _, v in enumerate(a):
if s >= k:
break
s += v
c += 1
print(c)
|
Title: Business trip
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
What joy! Petya's parents went on a business trip for the whole year and the playful kid is left all by himself. Petya got absolutely happy. He jumped on the bed and threw pillows all day long, until...
Today Petya opened the cupboard and found a scary note there. His parents had left him with duties: he should water their favourite flower all year, each day, in the morning, in the afternoon and in the evening. "Wait a second!" — thought Petya. He know for a fact that if he fulfills the parents' task in the *i*-th (1<=≤<=*i*<=≤<=12) month of the year, then the flower will grow by *a**i* centimeters, and if he doesn't water the flower in the *i*-th month, then the flower won't grow this month. Petya also knows that try as he might, his parents won't believe that he has been watering the flower if it grows strictly less than by *k* centimeters.
Help Petya choose the minimum number of months when he will water the flower, given that the flower should grow no less than by *k* centimeters.
Input Specification:
The first line contains exactly one integer *k* (0<=≤<=*k*<=≤<=100). The next line contains twelve space-separated integers: the *i*-th (1<=≤<=*i*<=≤<=12) number in the line represents *a**i* (0<=≤<=*a**i*<=≤<=100).
Output Specification:
Print the only integer — the minimum number of months when Petya has to water the flower so that the flower grows no less than by *k* centimeters. If the flower can't grow by *k* centimeters in a year, print -1.
Demo Input:
['5\n1 1 1 1 2 2 3 2 2 1 1 1\n', '0\n0 0 0 0 0 0 0 1 1 2 3 0\n', '11\n1 1 4 1 1 5 1 1 4 1 1 1\n']
Demo Output:
['2\n', '0\n', '3\n']
Note:
Let's consider the first sample test. There it is enough to water the flower during the seventh and the ninth month. Then the flower grows by exactly five centimeters.
In the second sample Petya's parents will believe him even if the flower doesn't grow at all (*k* = 0). So, it is possible for Petya not to water the flower at all.
|
```python
k = int(input())
a = list(map(int, input().split()))
a.sort()
a = a[::-1]
s = 0
c = 0
for _, v in enumerate(a):
if s >= k:
break
s += v
c += 1
print(c)
```
| 0 |
|
11 |
A
|
Increasing Sequence
|
PROGRAMMING
| 900 |
[
"constructive algorithms",
"implementation",
"math"
] |
A. Increasing Sequence
|
1
|
64
|
A sequence *a*0,<=*a*1,<=...,<=*a**t*<=-<=1 is called increasing if *a**i*<=-<=1<=<<=*a**i* for each *i*:<=0<=<<=*i*<=<<=*t*.
You are given a sequence *b*0,<=*b*1,<=...,<=*b**n*<=-<=1 and a positive integer *d*. In each move you may choose one element of the given sequence and add *d* to it. What is the least number of moves required to make the given sequence increasing?
|
The first line of the input contains two integer numbers *n* and *d* (2<=≤<=*n*<=≤<=2000,<=1<=≤<=*d*<=≤<=106). The second line contains space separated sequence *b*0,<=*b*1,<=...,<=*b**n*<=-<=1 (1<=≤<=*b**i*<=≤<=106).
|
Output the minimal number of moves needed to make the sequence increasing.
|
[
"4 2\n1 3 3 2\n"
] |
[
"3\n"
] |
none
| 0 |
[
{
"input": "4 2\n1 3 3 2",
"output": "3"
},
{
"input": "2 1\n1 1",
"output": "1"
},
{
"input": "2 1\n2 5",
"output": "0"
},
{
"input": "2 1\n1 2",
"output": "0"
},
{
"input": "2 1\n1 1",
"output": "1"
},
{
"input": "2 7\n10 20",
"output": "0"
},
{
"input": "2 7\n1 1",
"output": "1"
},
{
"input": "3 3\n18 1 9",
"output": "10"
},
{
"input": "3 3\n15 17 9",
"output": "3"
},
{
"input": "3 3\n10 9 12",
"output": "2"
},
{
"input": "10 3\n2 1 17 10 5 16 8 4 15 17",
"output": "31"
},
{
"input": "10 3\n6 11 4 12 22 15 23 26 24 26",
"output": "13"
},
{
"input": "10 3\n10 24 13 15 18 14 15 26 33 35",
"output": "29"
},
{
"input": "100 3\n529 178 280 403 326 531 671 427 188 866 669 646 421 804 494 609 53 1012 211 243 887 833 900 543 226 42 859 718 454 372 971 692 846 770 511 395 499 479 641 756 115 269 206 45 1039 727 400 779 859 614 146 214 196 919 702 959 380 830 535 878 859 784 316 305 782 924 536 243 236 978 564 150 291 877 808 983 537 839 490 120 168 838 267 650 900 170 211 504 326 771 895 984 994 483 776 100 471 1078 317 580",
"output": "15717"
},
{
"input": "100 3\n329 226 331 909 962 112 837 1005 194 818 506 416 125 648 367 459 400 582 989 547 329 438 234 121 272 226 821 376 834 427 718 164 834 113 654 177 737 212 169 696 744 180 89 944 233 147 667 990 809 1072 1085 1093 814 265 1067 312 833 572 303 901 1032 504 185 817 389 158 613 723 239 269 911 352 769 404 225 822 897 606 947 323 913 804 923 1084 552 901 486 249 209 898 847 610 728 1122 986 669 1116 1076 367 327",
"output": "16133"
}
] | 1,588,079,213 | 2,147,483,647 |
Python 3
|
TIME_LIMIT_EXCEEDED
|
TESTS
| 15 | 1,000 | 0 |
n, d = list(map(int, input().split(' '))) #input numbers n and d
numbers = list(map(int, input().split(' '))) #imput series
count = 0 #initialize counter
for i in range(1,n):
if numbers[i] <= numbers[i-1]: #if previous number is is equal or greater than the next one, we increase the second with d while it is still smaller or equal
while numbers[i] <= numbers[i-1]:
numbers[i] += d
count += 1
print(count) #print answer
|
Title: Increasing Sequence
Time Limit: 1 seconds
Memory Limit: 64 megabytes
Problem Description:
A sequence *a*0,<=*a*1,<=...,<=*a**t*<=-<=1 is called increasing if *a**i*<=-<=1<=<<=*a**i* for each *i*:<=0<=<<=*i*<=<<=*t*.
You are given a sequence *b*0,<=*b*1,<=...,<=*b**n*<=-<=1 and a positive integer *d*. In each move you may choose one element of the given sequence and add *d* to it. What is the least number of moves required to make the given sequence increasing?
Input Specification:
The first line of the input contains two integer numbers *n* and *d* (2<=≤<=*n*<=≤<=2000,<=1<=≤<=*d*<=≤<=106). The second line contains space separated sequence *b*0,<=*b*1,<=...,<=*b**n*<=-<=1 (1<=≤<=*b**i*<=≤<=106).
Output Specification:
Output the minimal number of moves needed to make the sequence increasing.
Demo Input:
['4 2\n1 3 3 2\n']
Demo Output:
['3\n']
Note:
none
|
```python
n, d = list(map(int, input().split(' '))) #input numbers n and d
numbers = list(map(int, input().split(' '))) #imput series
count = 0 #initialize counter
for i in range(1,n):
if numbers[i] <= numbers[i-1]: #if previous number is is equal or greater than the next one, we increase the second with d while it is still smaller or equal
while numbers[i] <= numbers[i-1]:
numbers[i] += d
count += 1
print(count) #print answer
```
| 0 |
246 |
B
|
Increase and Decrease
|
PROGRAMMING
| 1,300 |
[
"greedy",
"math"
] | null | null |
Polycarpus has an array, consisting of *n* integers *a*1,<=*a*2,<=...,<=*a**n*. Polycarpus likes it when numbers in an array match. That's why he wants the array to have as many equal numbers as possible. For that Polycarpus performs the following operation multiple times:
- he chooses two elements of the array *a**i*, *a**j* (*i*<=≠<=*j*); - he simultaneously increases number *a**i* by 1 and decreases number *a**j* by 1, that is, executes *a**i*<==<=*a**i*<=+<=1 and *a**j*<==<=*a**j*<=-<=1.
The given operation changes exactly two distinct array elements. Polycarpus can apply the described operation an infinite number of times.
Now he wants to know what maximum number of equal array elements he can get if he performs an arbitrary number of such operation. Help Polycarpus.
|
The first line contains integer *n* (1<=≤<=*n*<=≤<=105) — the array size. The second line contains space-separated integers *a*1,<=*a*2,<=...,<=*a**n* (|*a**i*|<=≤<=104) — the original array.
|
Print a single integer — the maximum number of equal array elements he can get if he performs an arbitrary number of the given operation.
|
[
"2\n2 1\n",
"3\n1 4 1\n"
] |
[
"1\n",
"3\n"
] |
none
| 1,000 |
[
{
"input": "2\n2 1",
"output": "1"
},
{
"input": "3\n1 4 1",
"output": "3"
},
{
"input": "4\n2 -7 -2 -6",
"output": "3"
},
{
"input": "4\n2 0 -2 -1",
"output": "3"
},
{
"input": "6\n-1 1 0 0 -1 -1",
"output": "5"
},
{
"input": "5\n0 0 0 0 0",
"output": "5"
},
{
"input": "100\n968 793 -628 -416 942 -308 977 168 728 -879 952 781 -425 -475 -480 738 -740 142 -319 -116 -701 -183 41 324 -918 -391 -176 781 763 888 475 -617 134 -802 -133 -211 855 -869 -236 503 550 387 137 -221 -957 -800 -56 -673 440 -791 -217 -959 -892 886 -593 427 890 223 -425 -342 -262 693 -137 924 860 156 -110 444 -12 703 421 -638 725 -551 597 -206 -80 393 -441 -759 617 424 -506 209 579 -685 -861 507 312 597 -81 -491 424 222 -892 629 512 743 -452 -504",
"output": "99"
}
] | 1,676,711,149 | 2,147,483,647 |
Python 3
|
OK
|
TESTS
| 30 | 124 | 3,174,400 |
n = int(input())
print(n if sum([int(i) for i in input().split()]) % n == 0 else n - 1)
|
Title: Increase and Decrease
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Polycarpus has an array, consisting of *n* integers *a*1,<=*a*2,<=...,<=*a**n*. Polycarpus likes it when numbers in an array match. That's why he wants the array to have as many equal numbers as possible. For that Polycarpus performs the following operation multiple times:
- he chooses two elements of the array *a**i*, *a**j* (*i*<=≠<=*j*); - he simultaneously increases number *a**i* by 1 and decreases number *a**j* by 1, that is, executes *a**i*<==<=*a**i*<=+<=1 and *a**j*<==<=*a**j*<=-<=1.
The given operation changes exactly two distinct array elements. Polycarpus can apply the described operation an infinite number of times.
Now he wants to know what maximum number of equal array elements he can get if he performs an arbitrary number of such operation. Help Polycarpus.
Input Specification:
The first line contains integer *n* (1<=≤<=*n*<=≤<=105) — the array size. The second line contains space-separated integers *a*1,<=*a*2,<=...,<=*a**n* (|*a**i*|<=≤<=104) — the original array.
Output Specification:
Print a single integer — the maximum number of equal array elements he can get if he performs an arbitrary number of the given operation.
Demo Input:
['2\n2 1\n', '3\n1 4 1\n']
Demo Output:
['1\n', '3\n']
Note:
none
|
```python
n = int(input())
print(n if sum([int(i) for i in input().split()]) % n == 0 else n - 1)
```
| 3 |
|
433 |
A
|
Kitahara Haruki's Gift
|
PROGRAMMING
| 1,100 |
[
"brute force",
"implementation"
] | null | null |
Kitahara Haruki has bought *n* apples for Touma Kazusa and Ogiso Setsuna. Now he wants to divide all the apples between the friends.
Each apple weights 100 grams or 200 grams. Of course Kitahara Haruki doesn't want to offend any of his friend. Therefore the total weight of the apples given to Touma Kazusa must be equal to the total weight of the apples given to Ogiso Setsuna.
But unfortunately Kitahara Haruki doesn't have a knife right now, so he cannot split any apple into some parts. Please, tell him: is it possible to divide all the apples in a fair way between his friends?
|
The first line contains an integer *n* (1<=≤<=*n*<=≤<=100) — the number of apples. The second line contains *n* integers *w*1,<=*w*2,<=...,<=*w**n* (*w**i*<==<=100 or *w**i*<==<=200), where *w**i* is the weight of the *i*-th apple.
|
In a single line print "YES" (without the quotes) if it is possible to divide all the apples between his friends. Otherwise print "NO" (without the quotes).
|
[
"3\n100 200 100\n",
"4\n100 100 100 200\n"
] |
[
"YES\n",
"NO\n"
] |
In the first test sample Kitahara Haruki can give the first and the last apple to Ogiso Setsuna and the middle apple to Touma Kazusa.
| 500 |
[
{
"input": "3\n100 200 100",
"output": "YES"
},
{
"input": "4\n100 100 100 200",
"output": "NO"
},
{
"input": "1\n100",
"output": "NO"
},
{
"input": "1\n200",
"output": "NO"
},
{
"input": "2\n100 100",
"output": "YES"
},
{
"input": "2\n200 200",
"output": "YES"
},
{
"input": "100\n200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200",
"output": "YES"
},
{
"input": "100\n200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 100 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200",
"output": "NO"
},
{
"input": "52\n200 200 100 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 100 200 200 200 200 200 200 200 200 200 200 200 200 200 200 100 200 200 200 200 100 200 100 200 200 200 100 200 200",
"output": "YES"
},
{
"input": "2\n100 200",
"output": "NO"
},
{
"input": "2\n200 100",
"output": "NO"
},
{
"input": "3\n100 100 100",
"output": "NO"
},
{
"input": "3\n200 200 200",
"output": "NO"
},
{
"input": "3\n200 100 200",
"output": "NO"
},
{
"input": "4\n100 100 100 100",
"output": "YES"
},
{
"input": "4\n200 200 200 200",
"output": "YES"
},
{
"input": "100\n200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 100 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 100 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200",
"output": "YES"
},
{
"input": "100\n200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 100 200 100 200 100 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200",
"output": "NO"
},
{
"input": "100\n100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100",
"output": "YES"
},
{
"input": "100\n100 100 200 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100",
"output": "NO"
},
{
"input": "100\n100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 200 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 200 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100",
"output": "YES"
},
{
"input": "100\n100 100 100 100 100 100 100 100 200 100 100 200 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 200 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100",
"output": "NO"
},
{
"input": "99\n200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200",
"output": "NO"
},
{
"input": "99\n200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 100 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200",
"output": "NO"
},
{
"input": "99\n200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 100 200 200 200 200 200 100 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200",
"output": "YES"
},
{
"input": "99\n200 200 200 200 200 200 200 200 200 200 200 100 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 100 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 100 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200",
"output": "NO"
},
{
"input": "99\n100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100",
"output": "NO"
},
{
"input": "99\n100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 200 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100",
"output": "YES"
},
{
"input": "99\n100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 200 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 200 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100",
"output": "NO"
},
{
"input": "100\n100 100 200 100 100 200 200 200 200 100 200 100 100 100 200 100 100 100 100 200 100 100 100 100 100 100 200 100 100 200 200 100 100 100 200 200 200 100 200 200 100 200 100 100 200 100 200 200 100 200 200 100 100 200 200 100 200 200 100 100 200 100 200 100 200 200 200 200 200 100 200 200 200 200 200 200 100 100 200 200 200 100 100 100 200 100 100 200 100 100 100 200 200 100 100 200 200 200 200 100",
"output": "YES"
},
{
"input": "100\n100 100 200 200 100 200 100 100 100 100 100 100 200 100 200 200 200 100 100 200 200 200 200 200 100 200 100 200 100 100 100 200 100 100 200 100 200 100 100 100 200 200 100 100 100 200 200 200 200 200 100 200 200 100 100 100 100 200 100 100 200 100 100 100 100 200 200 200 100 200 100 200 200 200 100 100 200 200 200 200 100 200 100 200 200 100 200 100 200 200 200 200 200 200 100 100 100 200 200 100",
"output": "NO"
},
{
"input": "100\n100 200 100 100 200 200 200 200 100 200 200 200 200 200 200 200 200 200 100 100 100 200 200 200 200 200 100 200 200 200 200 100 200 200 100 100 200 100 100 100 200 100 100 100 200 100 200 100 200 200 200 100 100 200 100 200 100 200 100 100 100 200 100 200 100 100 100 100 200 200 200 200 100 200 200 100 200 100 100 100 200 100 100 100 100 100 200 100 100 100 200 200 200 100 200 100 100 100 200 200",
"output": "YES"
},
{
"input": "99\n100 200 200 200 100 200 100 200 200 100 100 100 100 200 100 100 200 100 200 100 100 200 100 100 200 200 100 100 100 100 200 200 200 200 200 100 100 200 200 100 100 100 100 200 200 100 100 100 100 100 200 200 200 100 100 100 200 200 200 100 200 100 100 100 100 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 100 100 200 100 200 200 200 200 100 200 100 100 100 100 100 100 100 100 100",
"output": "YES"
},
{
"input": "99\n100 200 100 100 100 100 200 200 100 200 100 100 200 100 100 100 100 100 100 200 100 100 100 100 100 100 100 200 100 200 100 100 100 100 100 100 100 200 200 200 200 200 200 200 100 200 100 200 100 200 100 200 100 100 200 200 200 100 200 200 200 200 100 200 100 200 200 200 200 100 200 100 200 200 100 200 200 200 200 200 100 100 200 100 100 100 100 200 200 200 100 100 200 200 200 200 200 200 200",
"output": "NO"
},
{
"input": "99\n200 100 100 100 200 200 200 100 100 100 100 100 100 100 100 100 200 200 100 200 200 100 200 100 100 200 200 200 100 200 100 200 200 100 200 100 200 200 200 100 100 200 200 200 200 100 100 100 100 200 200 200 200 100 200 200 200 100 100 100 200 200 200 100 200 100 200 100 100 100 200 100 200 200 100 200 200 200 100 100 100 200 200 200 100 200 200 200 100 100 100 200 100 200 100 100 100 200 200",
"output": "YES"
},
{
"input": "56\n100 200 200 200 200 200 100 200 100 100 200 100 100 100 100 100 200 200 200 100 200 100 100 200 200 200 100 200 100 200 200 100 100 100 100 100 200 100 200 100 200 200 200 100 100 200 200 200 200 200 200 200 200 200 200 100",
"output": "YES"
},
{
"input": "72\n200 100 200 200 200 100 100 200 200 100 100 100 100 200 100 200 100 100 100 100 200 100 200 100 100 200 100 100 200 100 200 100 100 200 100 200 100 100 200 200 200 200 200 100 100 200 200 200 200 100 100 100 200 200 100 100 100 100 100 200 100 100 200 100 100 200 200 100 100 200 100 200",
"output": "YES"
},
{
"input": "32\n200 200 200 100 100 100 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 100 200 200 200 200 200 200",
"output": "YES"
},
{
"input": "48\n200 200 200 200 200 200 100 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 200 100 200 100 200 200 200 200 200 200",
"output": "NO"
},
{
"input": "60\n100 100 200 200 100 200 100 200 100 100 100 100 100 100 200 100 100 100 200 100 200 100 100 100 100 100 200 100 200 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 200 100 100 100",
"output": "YES"
},
{
"input": "24\n200 200 100 100 200 100 200 200 100 200 200 200 200 200 100 200 200 200 200 200 200 200 200 100",
"output": "YES"
},
{
"input": "40\n100 100 200 200 200 200 100 100 100 200 100 100 200 200 100 100 100 100 100 200 100 200 200 100 200 200 200 100 100 100 100 100 200 200 100 200 100 100 200 100",
"output": "NO"
},
{
"input": "5\n200 200 200 200 200",
"output": "NO"
},
{
"input": "9\n100 100 100 200 100 100 200 100 200",
"output": "YES"
},
{
"input": "1\n200",
"output": "NO"
},
{
"input": "7\n200 200 200 100 200 200 200",
"output": "NO"
},
{
"input": "4\n100 100 200 200",
"output": "YES"
},
{
"input": "6\n100 100 100 200 200 200",
"output": "NO"
},
{
"input": "4\n200 100 100 200",
"output": "YES"
},
{
"input": "5\n100 100 100 100 200",
"output": "YES"
}
] | 1,693,606,841 | 2,147,483,647 |
Python 3
|
WRONG_ANSWER
|
TESTS
| 4 | 46 | 307,200 |
from collections import defaultdict
n = int(input())
arr = list(map(int, input().split()))
v = [sum(arr) // 2] * 2
#250 mod 100 = 50
arr.sort()
if sum(arr) % 2 != 0:
print("NO")
else:
v[0] %= 100
v[1] %= 200
if v[0] == 0 and v[1] == 0:
print("YES")
else:
print("NO")
|
Title: Kitahara Haruki's Gift
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Kitahara Haruki has bought *n* apples for Touma Kazusa and Ogiso Setsuna. Now he wants to divide all the apples between the friends.
Each apple weights 100 grams or 200 grams. Of course Kitahara Haruki doesn't want to offend any of his friend. Therefore the total weight of the apples given to Touma Kazusa must be equal to the total weight of the apples given to Ogiso Setsuna.
But unfortunately Kitahara Haruki doesn't have a knife right now, so he cannot split any apple into some parts. Please, tell him: is it possible to divide all the apples in a fair way between his friends?
Input Specification:
The first line contains an integer *n* (1<=≤<=*n*<=≤<=100) — the number of apples. The second line contains *n* integers *w*1,<=*w*2,<=...,<=*w**n* (*w**i*<==<=100 or *w**i*<==<=200), where *w**i* is the weight of the *i*-th apple.
Output Specification:
In a single line print "YES" (without the quotes) if it is possible to divide all the apples between his friends. Otherwise print "NO" (without the quotes).
Demo Input:
['3\n100 200 100\n', '4\n100 100 100 200\n']
Demo Output:
['YES\n', 'NO\n']
Note:
In the first test sample Kitahara Haruki can give the first and the last apple to Ogiso Setsuna and the middle apple to Touma Kazusa.
|
```python
from collections import defaultdict
n = int(input())
arr = list(map(int, input().split()))
v = [sum(arr) // 2] * 2
#250 mod 100 = 50
arr.sort()
if sum(arr) % 2 != 0:
print("NO")
else:
v[0] %= 100
v[1] %= 200
if v[0] == 0 and v[1] == 0:
print("YES")
else:
print("NO")
```
| 0 |
|
508 |
A
|
Pasha and Pixels
|
PROGRAMMING
| 1,100 |
[
"brute force"
] | null | null |
Pasha loves his phone and also putting his hair up... But the hair is now irrelevant.
Pasha has installed a new game to his phone. The goal of the game is following. There is a rectangular field consisting of *n* row with *m* pixels in each row. Initially, all the pixels are colored white. In one move, Pasha can choose any pixel and color it black. In particular, he can choose the pixel that is already black, then after the boy's move the pixel does not change, that is, it remains black. Pasha loses the game when a 2<=×<=2 square consisting of black pixels is formed.
Pasha has made a plan of *k* moves, according to which he will paint pixels. Each turn in his plan is represented as a pair of numbers *i* and *j*, denoting respectively the row and the column of the pixel to be colored on the current move.
Determine whether Pasha loses if he acts in accordance with his plan, and if he does, on what move the 2<=×<=2 square consisting of black pixels is formed.
|
The first line of the input contains three integers *n*,<=*m*,<=*k* (1<=≤<=*n*,<=*m*<=≤<=1000, 1<=≤<=*k*<=≤<=105) — the number of rows, the number of columns and the number of moves that Pasha is going to perform.
The next *k* lines contain Pasha's moves in the order he makes them. Each line contains two integers *i* and *j* (1<=≤<=*i*<=≤<=*n*, 1<=≤<=*j*<=≤<=*m*), representing the row number and column number of the pixel that was painted during a move.
|
If Pasha loses, print the number of the move when the 2<=×<=2 square consisting of black pixels is formed.
If Pasha doesn't lose, that is, no 2<=×<=2 square consisting of black pixels is formed during the given *k* moves, print 0.
|
[
"2 2 4\n1 1\n1 2\n2 1\n2 2\n",
"2 3 6\n2 3\n2 2\n1 3\n2 2\n1 2\n1 1\n",
"5 3 7\n2 3\n1 2\n1 1\n4 1\n3 1\n5 3\n3 2\n"
] |
[
"4\n",
"5\n",
"0\n"
] |
none
| 500 |
[
{
"input": "2 2 4\n1 1\n1 2\n2 1\n2 2",
"output": "4"
},
{
"input": "2 3 6\n2 3\n2 2\n1 3\n2 2\n1 2\n1 1",
"output": "5"
},
{
"input": "5 3 7\n2 3\n1 2\n1 1\n4 1\n3 1\n5 3\n3 2",
"output": "0"
},
{
"input": "3 3 11\n2 1\n3 1\n1 1\n1 3\n1 2\n2 3\n3 3\n3 2\n2 2\n1 3\n3 3",
"output": "9"
},
{
"input": "2 2 5\n1 1\n2 1\n2 1\n1 2\n2 2",
"output": "5"
},
{
"input": "518 518 10\n37 97\n47 278\n17 467\n158 66\n483 351\n83 123\n285 219\n513 187\n380 75\n304 352",
"output": "0"
},
{
"input": "1 1 5\n1 1\n1 1\n1 1\n1 1\n1 1",
"output": "0"
},
{
"input": "1 5 5\n1 1\n1 2\n1 3\n1 4\n1 5",
"output": "0"
},
{
"input": "5 1 5\n1 1\n2 1\n3 1\n4 1\n5 1",
"output": "0"
},
{
"input": "1 1 1\n1 1",
"output": "0"
},
{
"input": "10 10 4\n5 9\n6 9\n6 10\n5 10",
"output": "4"
},
{
"input": "1000 1000 4\n999 999\n999 1000\n1000 999\n1000 1000",
"output": "4"
},
{
"input": "2 3 5\n2 3\n1 3\n1 2\n1 1\n2 2",
"output": "5"
},
{
"input": "1000 1000 4\n1000 1000\n999 999\n1000 999\n999 1000",
"output": "4"
}
] | 1,697,856,980 | 2,147,483,647 |
Python 3
|
OK
|
TESTS
| 52 | 249 | 8,499,200 |
n,m,k=map(int,input().split())
ma=[[0]*(m+2) for _ in range(n+2)]
s=[]
for _ in range(k):
a,b=map(int,input().split())
ma[a][b]=1
if ma[a][b]==1 and ma[a+1][b]==1 and ma[a][b+1]==1 and ma[a+1][b+1]==1:
s.append(_)
elif ma[a][b-1]==1 and ma[a+1][b]==1 and ma[a+1][b-1]==1:
s.append(_)
elif ma[a-1][b]==1 and ma[a][b+1]==1 and ma[a-1][b+1]==1:
s.append(_)
elif ma[a][b-1]==1 and ma[a-1][b]==1 and ma[a-1][b-1]==1:
s.append(_)
if len(s)!=0:
print(str(s[0]+1))
elif len(s)==0:
print(0)
|
Title: Pasha and Pixels
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Pasha loves his phone and also putting his hair up... But the hair is now irrelevant.
Pasha has installed a new game to his phone. The goal of the game is following. There is a rectangular field consisting of *n* row with *m* pixels in each row. Initially, all the pixels are colored white. In one move, Pasha can choose any pixel and color it black. In particular, he can choose the pixel that is already black, then after the boy's move the pixel does not change, that is, it remains black. Pasha loses the game when a 2<=×<=2 square consisting of black pixels is formed.
Pasha has made a plan of *k* moves, according to which he will paint pixels. Each turn in his plan is represented as a pair of numbers *i* and *j*, denoting respectively the row and the column of the pixel to be colored on the current move.
Determine whether Pasha loses if he acts in accordance with his plan, and if he does, on what move the 2<=×<=2 square consisting of black pixels is formed.
Input Specification:
The first line of the input contains three integers *n*,<=*m*,<=*k* (1<=≤<=*n*,<=*m*<=≤<=1000, 1<=≤<=*k*<=≤<=105) — the number of rows, the number of columns and the number of moves that Pasha is going to perform.
The next *k* lines contain Pasha's moves in the order he makes them. Each line contains two integers *i* and *j* (1<=≤<=*i*<=≤<=*n*, 1<=≤<=*j*<=≤<=*m*), representing the row number and column number of the pixel that was painted during a move.
Output Specification:
If Pasha loses, print the number of the move when the 2<=×<=2 square consisting of black pixels is formed.
If Pasha doesn't lose, that is, no 2<=×<=2 square consisting of black pixels is formed during the given *k* moves, print 0.
Demo Input:
['2 2 4\n1 1\n1 2\n2 1\n2 2\n', '2 3 6\n2 3\n2 2\n1 3\n2 2\n1 2\n1 1\n', '5 3 7\n2 3\n1 2\n1 1\n4 1\n3 1\n5 3\n3 2\n']
Demo Output:
['4\n', '5\n', '0\n']
Note:
none
|
```python
n,m,k=map(int,input().split())
ma=[[0]*(m+2) for _ in range(n+2)]
s=[]
for _ in range(k):
a,b=map(int,input().split())
ma[a][b]=1
if ma[a][b]==1 and ma[a+1][b]==1 and ma[a][b+1]==1 and ma[a+1][b+1]==1:
s.append(_)
elif ma[a][b-1]==1 and ma[a+1][b]==1 and ma[a+1][b-1]==1:
s.append(_)
elif ma[a-1][b]==1 and ma[a][b+1]==1 and ma[a-1][b+1]==1:
s.append(_)
elif ma[a][b-1]==1 and ma[a-1][b]==1 and ma[a-1][b-1]==1:
s.append(_)
if len(s)!=0:
print(str(s[0]+1))
elif len(s)==0:
print(0)
```
| 3 |
|
851 |
A
|
Arpa and a research in Mexican wave
|
PROGRAMMING
| 800 |
[
"implementation",
"math"
] | null | null |
Arpa is researching the Mexican wave.
There are *n* spectators in the stadium, labeled from 1 to *n*. They start the Mexican wave at time 0.
- At time 1, the first spectator stands. - At time 2, the second spectator stands. - ... - At time *k*, the *k*-th spectator stands. - At time *k*<=+<=1, the (*k*<=+<=1)-th spectator stands and the first spectator sits. - At time *k*<=+<=2, the (*k*<=+<=2)-th spectator stands and the second spectator sits. - ... - At time *n*, the *n*-th spectator stands and the (*n*<=-<=*k*)-th spectator sits. - At time *n*<=+<=1, the (*n*<=+<=1<=-<=*k*)-th spectator sits. - ... - At time *n*<=+<=*k*, the *n*-th spectator sits.
Arpa wants to know how many spectators are standing at time *t*.
|
The first line contains three integers *n*, *k*, *t* (1<=≤<=*n*<=≤<=109, 1<=≤<=*k*<=≤<=*n*, 1<=≤<=*t*<=<<=*n*<=+<=*k*).
|
Print single integer: how many spectators are standing at time *t*.
|
[
"10 5 3\n",
"10 5 7\n",
"10 5 12\n"
] |
[
"3\n",
"5\n",
"3\n"
] |
In the following a sitting spectator is represented as -, a standing spectator is represented as ^.
- At *t* = 0 ---------- <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/4d97e684117250a9afe9be022ab8a63653dd15aa.png" style="max-width: 100.0%;max-height: 100.0%;"/> number of standing spectators = 0. - At *t* = 1 ^--------- <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/4d97e684117250a9afe9be022ab8a63653dd15aa.png" style="max-width: 100.0%;max-height: 100.0%;"/> number of standing spectators = 1. - At *t* = 2 ^^-------- <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/4d97e684117250a9afe9be022ab8a63653dd15aa.png" style="max-width: 100.0%;max-height: 100.0%;"/> number of standing spectators = 2. - At *t* = 3 ^^^------- <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/4d97e684117250a9afe9be022ab8a63653dd15aa.png" style="max-width: 100.0%;max-height: 100.0%;"/> number of standing spectators = 3. - At *t* = 4 ^^^^------ <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/4d97e684117250a9afe9be022ab8a63653dd15aa.png" style="max-width: 100.0%;max-height: 100.0%;"/> number of standing spectators = 4. - At *t* = 5 ^^^^^----- <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/4d97e684117250a9afe9be022ab8a63653dd15aa.png" style="max-width: 100.0%;max-height: 100.0%;"/> number of standing spectators = 5. - At *t* = 6 -^^^^^---- <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/4d97e684117250a9afe9be022ab8a63653dd15aa.png" style="max-width: 100.0%;max-height: 100.0%;"/> number of standing spectators = 5. - At *t* = 7 --^^^^^--- <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/4d97e684117250a9afe9be022ab8a63653dd15aa.png" style="max-width: 100.0%;max-height: 100.0%;"/> number of standing spectators = 5. - At *t* = 8 ---^^^^^-- <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/4d97e684117250a9afe9be022ab8a63653dd15aa.png" style="max-width: 100.0%;max-height: 100.0%;"/> number of standing spectators = 5. - At *t* = 9 ----^^^^^- <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/4d97e684117250a9afe9be022ab8a63653dd15aa.png" style="max-width: 100.0%;max-height: 100.0%;"/> number of standing spectators = 5. - At *t* = 10 -----^^^^^ <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/4d97e684117250a9afe9be022ab8a63653dd15aa.png" style="max-width: 100.0%;max-height: 100.0%;"/> number of standing spectators = 5. - At *t* = 11 ------^^^^ <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/4d97e684117250a9afe9be022ab8a63653dd15aa.png" style="max-width: 100.0%;max-height: 100.0%;"/> number of standing spectators = 4. - At *t* = 12 -------^^^ <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/4d97e684117250a9afe9be022ab8a63653dd15aa.png" style="max-width: 100.0%;max-height: 100.0%;"/> number of standing spectators = 3. - At *t* = 13 --------^^ <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/4d97e684117250a9afe9be022ab8a63653dd15aa.png" style="max-width: 100.0%;max-height: 100.0%;"/> number of standing spectators = 2. - At *t* = 14 ---------^ <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/4d97e684117250a9afe9be022ab8a63653dd15aa.png" style="max-width: 100.0%;max-height: 100.0%;"/> number of standing spectators = 1. - At *t* = 15 ---------- <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/4d97e684117250a9afe9be022ab8a63653dd15aa.png" style="max-width: 100.0%;max-height: 100.0%;"/> number of standing spectators = 0.
| 500 |
[
{
"input": "10 5 3",
"output": "3"
},
{
"input": "10 5 7",
"output": "5"
},
{
"input": "10 5 12",
"output": "3"
},
{
"input": "840585600 770678331 788528791",
"output": "770678331"
},
{
"input": "25462281 23343504 8024619",
"output": "8024619"
},
{
"input": "723717988 205757169 291917494",
"output": "205757169"
},
{
"input": "27462087 20831796 15492397",
"output": "15492397"
},
{
"input": "966696824 346707476 1196846860",
"output": "116557440"
},
{
"input": "290274403 41153108 327683325",
"output": "3744186"
},
{
"input": "170963478 151220598 222269210",
"output": "99914866"
},
{
"input": "14264008 309456 11132789",
"output": "309456"
},
{
"input": "886869816 281212106 52891064",
"output": "52891064"
},
{
"input": "330543750 243917820 205522400",
"output": "205522400"
},
{
"input": "457658451 18625039 157624558",
"output": "18625039"
},
{
"input": "385908940 143313325 509731380",
"output": "19490885"
},
{
"input": "241227633 220621961 10025257",
"output": "10025257"
},
{
"input": "474139818 268918981 388282504",
"output": "268918981"
},
{
"input": "25963410 3071034 820199",
"output": "820199"
},
{
"input": "656346757 647995766 75748423",
"output": "75748423"
},
{
"input": "588568132 411878522 521753621",
"output": "411878522"
},
{
"input": "735788762 355228487 139602545",
"output": "139602545"
},
{
"input": "860798593 463398487 506871376",
"output": "463398487"
},
{
"input": "362624055 110824996 194551217",
"output": "110824996"
},
{
"input": "211691721 195866131 313244576",
"output": "94313276"
},
{
"input": "45661815 26072719 9643822",
"output": "9643822"
},
{
"input": "757183104 590795077 709609355",
"output": "590795077"
},
{
"input": "418386749 1915035 197248338",
"output": "1915035"
},
{
"input": "763782282 297277890 246562421",
"output": "246562421"
},
{
"input": "893323188 617630677 607049638",
"output": "607049638"
},
{
"input": "506708261 356545583 296093684",
"output": "296093684"
},
{
"input": "984295813 427551190 84113823",
"output": "84113823"
},
{
"input": "774984967 61373612 96603505",
"output": "61373612"
},
{
"input": "774578969 342441237 91492393",
"output": "91492393"
},
{
"input": "76495801 8780305 56447339",
"output": "8780305"
},
{
"input": "48538385 582843 16805978",
"output": "582843"
},
{
"input": "325794610 238970909 553089099",
"output": "11676420"
},
{
"input": "834925315 316928679 711068031",
"output": "316928679"
},
{
"input": "932182199 454838315 267066713",
"output": "267066713"
},
{
"input": "627793782 552043394 67061810",
"output": "67061810"
},
{
"input": "24317170 17881607 218412",
"output": "218412"
},
{
"input": "1000000000 1000 1",
"output": "1"
},
{
"input": "1000000000 1000 2",
"output": "2"
},
{
"input": "1000000000 1 1000",
"output": "1"
},
{
"input": "100 100 100",
"output": "100"
},
{
"input": "100 100 99",
"output": "99"
},
{
"input": "100 100 101",
"output": "99"
},
{
"input": "100 100 199",
"output": "1"
},
{
"input": "1000000000 1000000000 1999999999",
"output": "1"
},
{
"input": "10 5 5",
"output": "5"
},
{
"input": "5 3 5",
"output": "3"
},
{
"input": "10 3 3",
"output": "3"
},
{
"input": "10 5 6",
"output": "5"
},
{
"input": "3 2 4",
"output": "1"
},
{
"input": "10 5 14",
"output": "1"
},
{
"input": "6 1 4",
"output": "1"
},
{
"input": "10 10 19",
"output": "1"
},
{
"input": "10 4 11",
"output": "3"
},
{
"input": "2 2 3",
"output": "1"
},
{
"input": "10 5 11",
"output": "4"
},
{
"input": "600 200 700",
"output": "100"
},
{
"input": "2000 1000 2001",
"output": "999"
},
{
"input": "1000 1000 1001",
"output": "999"
},
{
"input": "5 4 6",
"output": "3"
},
{
"input": "2 1 2",
"output": "1"
},
{
"input": "10 3 10",
"output": "3"
},
{
"input": "15 10 10",
"output": "10"
},
{
"input": "10 5 13",
"output": "2"
},
{
"input": "2 2 2",
"output": "2"
},
{
"input": "5 5 6",
"output": "4"
},
{
"input": "10 6 12",
"output": "4"
},
{
"input": "7 5 8",
"output": "4"
},
{
"input": "10 4 9",
"output": "4"
},
{
"input": "9 2 6",
"output": "2"
},
{
"input": "5 2 6",
"output": "1"
},
{
"input": "6 2 6",
"output": "2"
},
{
"input": "5 5 8",
"output": "2"
},
{
"input": "3 3 5",
"output": "1"
},
{
"input": "10 2 5",
"output": "2"
},
{
"input": "5 3 7",
"output": "1"
},
{
"input": "5 4 8",
"output": "1"
},
{
"input": "10 6 11",
"output": "5"
},
{
"input": "5 3 6",
"output": "2"
},
{
"input": "10 6 14",
"output": "2"
},
{
"input": "10 10 10",
"output": "10"
},
{
"input": "1000000000 1 1000000000",
"output": "1"
},
{
"input": "20 4 22",
"output": "2"
},
{
"input": "5 4 4",
"output": "4"
},
{
"input": "4 3 6",
"output": "1"
},
{
"input": "12 8 18",
"output": "2"
},
{
"input": "10 5 10",
"output": "5"
},
{
"input": "100 50 149",
"output": "1"
},
{
"input": "4 4 4",
"output": "4"
},
{
"input": "7 6 9",
"output": "4"
},
{
"input": "16 10 21",
"output": "5"
},
{
"input": "10 2 11",
"output": "1"
},
{
"input": "600 200 500",
"output": "200"
},
{
"input": "100 30 102",
"output": "28"
},
{
"input": "10 10 18",
"output": "2"
},
{
"input": "15 3 10",
"output": "3"
},
{
"input": "1000000000 1000000000 1000000000",
"output": "1000000000"
},
{
"input": "5 5 5",
"output": "5"
},
{
"input": "10 3 12",
"output": "1"
},
{
"input": "747 457 789",
"output": "415"
},
{
"input": "5 4 7",
"output": "2"
},
{
"input": "15 5 11",
"output": "5"
},
{
"input": "3 2 2",
"output": "2"
},
{
"input": "7 6 8",
"output": "5"
},
{
"input": "7 4 8",
"output": "3"
},
{
"input": "10 4 13",
"output": "1"
},
{
"input": "10 3 9",
"output": "3"
},
{
"input": "20 2 21",
"output": "1"
},
{
"input": "6 5 9",
"output": "2"
},
{
"input": "10 9 18",
"output": "1"
},
{
"input": "12 4 9",
"output": "4"
},
{
"input": "10 7 15",
"output": "2"
},
{
"input": "999999999 999999998 1500000000",
"output": "499999997"
},
{
"input": "20 5 20",
"output": "5"
},
{
"input": "4745 4574 4757",
"output": "4562"
},
{
"input": "10 7 12",
"output": "5"
},
{
"input": "17 15 18",
"output": "14"
},
{
"input": "3 1 3",
"output": "1"
},
{
"input": "100 3 7",
"output": "3"
},
{
"input": "6 2 7",
"output": "1"
},
{
"input": "8 5 10",
"output": "3"
},
{
"input": "3 3 3",
"output": "3"
},
{
"input": "9 5 10",
"output": "4"
},
{
"input": "10 6 13",
"output": "3"
},
{
"input": "13 10 14",
"output": "9"
},
{
"input": "13 12 15",
"output": "10"
},
{
"input": "10 4 12",
"output": "2"
},
{
"input": "41 3 3",
"output": "3"
},
{
"input": "1000000000 1000000000 1400000000",
"output": "600000000"
},
{
"input": "10 3 11",
"output": "2"
},
{
"input": "12 7 18",
"output": "1"
},
{
"input": "15 3 17",
"output": "1"
},
{
"input": "10 2 8",
"output": "2"
},
{
"input": "1000000000 1000 1000000999",
"output": "1"
},
{
"input": "5 5 9",
"output": "1"
},
{
"input": "100 3 6",
"output": "3"
},
{
"input": "100 5 50",
"output": "5"
},
{
"input": "10000 10 10000",
"output": "10"
},
{
"input": "1 1 1",
"output": "1"
},
{
"input": "6 4 4",
"output": "4"
},
{
"input": "9979797 555554 10101010",
"output": "434341"
},
{
"input": "13 5 12",
"output": "5"
},
{
"input": "9 4 10",
"output": "3"
},
{
"input": "7 5 10",
"output": "2"
},
{
"input": "100000000 10000000 100005000",
"output": "9995000"
},
{
"input": "100000 50000 100001",
"output": "49999"
},
{
"input": "15 10 20",
"output": "5"
},
{
"input": "4 4 5",
"output": "3"
},
{
"input": "5 3 3",
"output": "3"
},
{
"input": "30 5 30",
"output": "5"
},
{
"input": "200000 10 200005",
"output": "5"
},
{
"input": "10 9 12",
"output": "7"
},
{
"input": "10 6 15",
"output": "1"
},
{
"input": "1000000000 10 1000000000",
"output": "10"
},
{
"input": "7 5 11",
"output": "1"
},
{
"input": "9 4 4",
"output": "4"
},
{
"input": "14 3 15",
"output": "2"
},
{
"input": "1000000000 100000000 1000000000",
"output": "100000000"
},
{
"input": "40 10 22",
"output": "10"
},
{
"input": "50 10 51",
"output": "9"
},
{
"input": "999999997 999999995 1999999991",
"output": "1"
},
{
"input": "92 79 144",
"output": "27"
},
{
"input": "8 4 4",
"output": "4"
}
] | 1,504,536,215 | 515 |
Python 3
|
TIME_LIMIT_EXCEEDED
|
TESTS
| 7 | 1,000 | 0 |
a,b,c=map(int,input().split())
if c>=b and c<=a:
print(b)
elif c<b:
print(c)
else:
for i in range(c-a):
b=b-1
print(b)
|
Title: Arpa and a research in Mexican wave
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Arpa is researching the Mexican wave.
There are *n* spectators in the stadium, labeled from 1 to *n*. They start the Mexican wave at time 0.
- At time 1, the first spectator stands. - At time 2, the second spectator stands. - ... - At time *k*, the *k*-th spectator stands. - At time *k*<=+<=1, the (*k*<=+<=1)-th spectator stands and the first spectator sits. - At time *k*<=+<=2, the (*k*<=+<=2)-th spectator stands and the second spectator sits. - ... - At time *n*, the *n*-th spectator stands and the (*n*<=-<=*k*)-th spectator sits. - At time *n*<=+<=1, the (*n*<=+<=1<=-<=*k*)-th spectator sits. - ... - At time *n*<=+<=*k*, the *n*-th spectator sits.
Arpa wants to know how many spectators are standing at time *t*.
Input Specification:
The first line contains three integers *n*, *k*, *t* (1<=≤<=*n*<=≤<=109, 1<=≤<=*k*<=≤<=*n*, 1<=≤<=*t*<=<<=*n*<=+<=*k*).
Output Specification:
Print single integer: how many spectators are standing at time *t*.
Demo Input:
['10 5 3\n', '10 5 7\n', '10 5 12\n']
Demo Output:
['3\n', '5\n', '3\n']
Note:
In the following a sitting spectator is represented as -, a standing spectator is represented as ^.
- At *t* = 0 ---------- <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/4d97e684117250a9afe9be022ab8a63653dd15aa.png" style="max-width: 100.0%;max-height: 100.0%;"/> number of standing spectators = 0. - At *t* = 1 ^--------- <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/4d97e684117250a9afe9be022ab8a63653dd15aa.png" style="max-width: 100.0%;max-height: 100.0%;"/> number of standing spectators = 1. - At *t* = 2 ^^-------- <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/4d97e684117250a9afe9be022ab8a63653dd15aa.png" style="max-width: 100.0%;max-height: 100.0%;"/> number of standing spectators = 2. - At *t* = 3 ^^^------- <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/4d97e684117250a9afe9be022ab8a63653dd15aa.png" style="max-width: 100.0%;max-height: 100.0%;"/> number of standing spectators = 3. - At *t* = 4 ^^^^------ <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/4d97e684117250a9afe9be022ab8a63653dd15aa.png" style="max-width: 100.0%;max-height: 100.0%;"/> number of standing spectators = 4. - At *t* = 5 ^^^^^----- <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/4d97e684117250a9afe9be022ab8a63653dd15aa.png" style="max-width: 100.0%;max-height: 100.0%;"/> number of standing spectators = 5. - At *t* = 6 -^^^^^---- <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/4d97e684117250a9afe9be022ab8a63653dd15aa.png" style="max-width: 100.0%;max-height: 100.0%;"/> number of standing spectators = 5. - At *t* = 7 --^^^^^--- <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/4d97e684117250a9afe9be022ab8a63653dd15aa.png" style="max-width: 100.0%;max-height: 100.0%;"/> number of standing spectators = 5. - At *t* = 8 ---^^^^^-- <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/4d97e684117250a9afe9be022ab8a63653dd15aa.png" style="max-width: 100.0%;max-height: 100.0%;"/> number of standing spectators = 5. - At *t* = 9 ----^^^^^- <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/4d97e684117250a9afe9be022ab8a63653dd15aa.png" style="max-width: 100.0%;max-height: 100.0%;"/> number of standing spectators = 5. - At *t* = 10 -----^^^^^ <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/4d97e684117250a9afe9be022ab8a63653dd15aa.png" style="max-width: 100.0%;max-height: 100.0%;"/> number of standing spectators = 5. - At *t* = 11 ------^^^^ <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/4d97e684117250a9afe9be022ab8a63653dd15aa.png" style="max-width: 100.0%;max-height: 100.0%;"/> number of standing spectators = 4. - At *t* = 12 -------^^^ <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/4d97e684117250a9afe9be022ab8a63653dd15aa.png" style="max-width: 100.0%;max-height: 100.0%;"/> number of standing spectators = 3. - At *t* = 13 --------^^ <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/4d97e684117250a9afe9be022ab8a63653dd15aa.png" style="max-width: 100.0%;max-height: 100.0%;"/> number of standing spectators = 2. - At *t* = 14 ---------^ <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/4d97e684117250a9afe9be022ab8a63653dd15aa.png" style="max-width: 100.0%;max-height: 100.0%;"/> number of standing spectators = 1. - At *t* = 15 ---------- <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/4d97e684117250a9afe9be022ab8a63653dd15aa.png" style="max-width: 100.0%;max-height: 100.0%;"/> number of standing spectators = 0.
|
```python
a,b,c=map(int,input().split())
if c>=b and c<=a:
print(b)
elif c<b:
print(c)
else:
for i in range(c-a):
b=b-1
print(b)
```
| 0 |
|
522 |
A
|
Reposts
|
PROGRAMMING
| 1,200 |
[
"*special",
"dfs and similar",
"dp",
"graphs",
"trees"
] | null | null |
One day Polycarp published a funny picture in a social network making a poll about the color of his handle. Many of his friends started reposting Polycarp's joke to their news feed. Some of them reposted the reposts and so on.
These events are given as a sequence of strings "name1 reposted name2", where name1 is the name of the person who reposted the joke, and name2 is the name of the person from whose news feed the joke was reposted. It is guaranteed that for each string "name1 reposted name2" user "name1" didn't have the joke in his feed yet, and "name2" already had it in his feed by the moment of repost. Polycarp was registered as "Polycarp" and initially the joke was only in his feed.
Polycarp measures the popularity of the joke as the length of the largest repost chain. Print the popularity of Polycarp's joke.
|
The first line of the input contains integer *n* (1<=≤<=*n*<=≤<=200) — the number of reposts. Next follow the reposts in the order they were made. Each of them is written on a single line and looks as "name1 reposted name2". All the names in the input consist of lowercase or uppercase English letters and/or digits and have lengths from 2 to 24 characters, inclusive.
We know that the user names are case-insensitive, that is, two names that only differ in the letter case correspond to the same social network user.
|
Print a single integer — the maximum length of a repost chain.
|
[
"5\ntourist reposted Polycarp\nPetr reposted Tourist\nWJMZBMR reposted Petr\nsdya reposted wjmzbmr\nvepifanov reposted sdya\n",
"6\nMike reposted Polycarp\nMax reposted Polycarp\nEveryOne reposted Polycarp\n111 reposted Polycarp\nVkCup reposted Polycarp\nCodeforces reposted Polycarp\n",
"1\nSoMeStRaNgEgUe reposted PoLyCaRp\n"
] |
[
"6\n",
"2\n",
"2\n"
] |
none
| 500 |
[
{
"input": "5\ntourist reposted Polycarp\nPetr reposted Tourist\nWJMZBMR reposted Petr\nsdya reposted wjmzbmr\nvepifanov reposted sdya",
"output": "6"
},
{
"input": "6\nMike reposted Polycarp\nMax reposted Polycarp\nEveryOne reposted Polycarp\n111 reposted Polycarp\nVkCup reposted Polycarp\nCodeforces reposted Polycarp",
"output": "2"
},
{
"input": "1\nSoMeStRaNgEgUe reposted PoLyCaRp",
"output": "2"
},
{
"input": "1\niuNtwVf reposted POlYcarP",
"output": "2"
},
{
"input": "10\ncs reposted poLYCaRp\nAFIkDrY7Of4V7Mq reposted CS\nsoBiwyN7KOvoFUfbhux reposted aFikDry7Of4v7MQ\nvb6LbwA reposted sObIWYN7KOvoFufBHUx\nDtWKIcVwIHgj4Rcv reposted vb6lbwa\nkt reposted DTwKicvwihgJ4rCV\n75K reposted kT\njKzyxx1 reposted 75K\nuoS reposted jkZyXX1\npZJskHTCIqE3YyZ5ME reposted uoS",
"output": "11"
},
{
"input": "10\nvxrUpCXvx8Isq reposted pOLYcaRP\nICb1 reposted vXRUpCxvX8ISq\nJFMt4b8jZE7iF2m8by7y2 reposted Icb1\nqkG6ZkMIf9QRrBFQU reposted ICb1\nnawsNfcR2palIMnmKZ reposted pOlYcaRP\nKksyH reposted jFMT4b8JzE7If2M8by7y2\nwJtWwQS5FvzN0h8CxrYyL reposted NawsNfcR2paLIMnmKz\nDpBcBPYAcTXEdhldI6tPl reposted NaWSnFCr2pALiMnmkZ\nlEnwTVnlwdQg2vaIRQry reposted kKSYh\nQUVFgwllaWO reposted Wjtwwqs5FVzN0H8cxRyyl",
"output": "6"
},
{
"input": "10\nkkuLGEiHv reposted POLYcArp\n3oX1AoUqyw1eR3nCADY9hLwd reposted kkuLGeIHV\nwf97dqq5bx1dPIchCoT reposted 3OX1AOuQYW1eR3ncAdY9hLwD\nWANr8h reposted Wf97dQQ5bx1dpIcHcoT\n3Fb736lkljZK2LtSbfL reposted wANR8h\n6nq9xLOn reposted 3fB736lKlJZk2LtSbFL\nWL reposted 3Fb736lKLjZk2LTSbfl\ndvxn4Xtc6SBcvKf1 reposted wF97DQq5bX1dPiChCOt\nMCcPLIMISqxDzrj reposted 6nQ9XLOn\nxsQL4Z2Iu reposted MCcpLiMiSqxdzrj",
"output": "9"
},
{
"input": "10\nsMA4 reposted pOLyCARP\nlq3 reposted pOlycARp\nEa16LSFTQxLJnE reposted polYcARp\nkvZVZhJwXcWsnC7NA1DV2WvS reposted polYCArp\nEYqqlrjRwddI reposted pOlyCArP\nsPqQCA67Y6PBBbcaV3EhooO reposted ea16LSFTqxLJne\njjPnneZdF6WLZ3v reposted Ea16LSFTqxLjNe\nWEoi6UpnfBUx79 reposted ea16LSFtqXljNe\nqi4yra reposted eYqqlRJrWDDI\ncw7E1UCSUD reposted eYqqLRJRwDdI",
"output": "3"
}
] | 1,651,297,429 | 2,147,483,647 |
Python 3
|
OK
|
TESTS
| 36 | 46 | 0 |
n=int(input())
a=[["POLYCARP",1]]
maxim=1
for i in range(n):
s=input().split()
for i in range(len(s[0])):
if(s[0][i]>='a'):
s[0]=s[0][:i]+chr(ord(s[0][i])-(ord('a')-ord('A')))+s[0][i+1:]
for i in range(len(s[2])):
if(s[2][i]>='a'):
s[2]=s[2][:i]+chr(ord(s[2][i])-(ord('a')-ord('A')))+s[2][i+1:]
x=-1
for i in range(len(a)):
if a[i][0]==s[2]:
a.append([s[0],a[i][1]+1])
maxim=max(maxim,a[i][1]+1)
break
print(maxim)
|
Title: Reposts
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
One day Polycarp published a funny picture in a social network making a poll about the color of his handle. Many of his friends started reposting Polycarp's joke to their news feed. Some of them reposted the reposts and so on.
These events are given as a sequence of strings "name1 reposted name2", where name1 is the name of the person who reposted the joke, and name2 is the name of the person from whose news feed the joke was reposted. It is guaranteed that for each string "name1 reposted name2" user "name1" didn't have the joke in his feed yet, and "name2" already had it in his feed by the moment of repost. Polycarp was registered as "Polycarp" and initially the joke was only in his feed.
Polycarp measures the popularity of the joke as the length of the largest repost chain. Print the popularity of Polycarp's joke.
Input Specification:
The first line of the input contains integer *n* (1<=≤<=*n*<=≤<=200) — the number of reposts. Next follow the reposts in the order they were made. Each of them is written on a single line and looks as "name1 reposted name2". All the names in the input consist of lowercase or uppercase English letters and/or digits and have lengths from 2 to 24 characters, inclusive.
We know that the user names are case-insensitive, that is, two names that only differ in the letter case correspond to the same social network user.
Output Specification:
Print a single integer — the maximum length of a repost chain.
Demo Input:
['5\ntourist reposted Polycarp\nPetr reposted Tourist\nWJMZBMR reposted Petr\nsdya reposted wjmzbmr\nvepifanov reposted sdya\n', '6\nMike reposted Polycarp\nMax reposted Polycarp\nEveryOne reposted Polycarp\n111 reposted Polycarp\nVkCup reposted Polycarp\nCodeforces reposted Polycarp\n', '1\nSoMeStRaNgEgUe reposted PoLyCaRp\n']
Demo Output:
['6\n', '2\n', '2\n']
Note:
none
|
```python
n=int(input())
a=[["POLYCARP",1]]
maxim=1
for i in range(n):
s=input().split()
for i in range(len(s[0])):
if(s[0][i]>='a'):
s[0]=s[0][:i]+chr(ord(s[0][i])-(ord('a')-ord('A')))+s[0][i+1:]
for i in range(len(s[2])):
if(s[2][i]>='a'):
s[2]=s[2][:i]+chr(ord(s[2][i])-(ord('a')-ord('A')))+s[2][i+1:]
x=-1
for i in range(len(a)):
if a[i][0]==s[2]:
a.append([s[0],a[i][1]+1])
maxim=max(maxim,a[i][1]+1)
break
print(maxim)
```
| 3 |
|
592 |
C
|
The Big Race
|
PROGRAMMING
| 1,800 |
[
"math"
] | null | null |
Vector Willman and Array Bolt are the two most famous athletes of Byteforces. They are going to compete in a race with a distance of *L* meters today.
Willman and Bolt have exactly the same speed, so when they compete the result is always a tie. That is a problem for the organizers because they want a winner.
While watching previous races the organizers have noticed that Willman can perform only steps of length equal to *w* meters, and Bolt can perform only steps of length equal to *b* meters. Organizers decided to slightly change the rules of the race. Now, at the end of the racetrack there will be an abyss, and the winner will be declared the athlete, who manages to run farther from the starting point of the the racetrack (which is not the subject to change by any of the athletes).
Note that none of the athletes can run infinitely far, as they both will at some moment of time face the point, such that only one step further will cause them to fall in the abyss. In other words, the athlete will not fall into the abyss if the total length of all his steps will be less or equal to the chosen distance *L*.
Since the organizers are very fair, the are going to set the length of the racetrack as an integer chosen randomly and uniformly in range from 1 to *t* (both are included). What is the probability that Willman and Bolt tie again today?
|
The first line of the input contains three integers *t*, *w* and *b* (1<=≤<=*t*,<=*w*,<=*b*<=≤<=5·1018) — the maximum possible length of the racetrack, the length of Willman's steps and the length of Bolt's steps respectively.
|
Print the answer to the problem as an irreducible fraction . Follow the format of the samples output.
The fraction (*p* and *q* are integers, and both *p*<=≥<=0 and *q*<=><=0 holds) is called irreducible, if there is no such integer *d*<=><=1, that both *p* and *q* are divisible by *d*.
|
[
"10 3 2\n",
"7 1 2\n"
] |
[
"3/10\n",
"3/7\n"
] |
In the first sample Willman and Bolt will tie in case 1, 6 or 7 are chosen as the length of the racetrack.
| 1,500 |
[
{
"input": "10 3 2",
"output": "3/10"
},
{
"input": "7 1 2",
"output": "3/7"
},
{
"input": "1 1 1",
"output": "1/1"
},
{
"input": "5814 31 7",
"output": "94/2907"
},
{
"input": "94268 813 766",
"output": "765/94268"
},
{
"input": "262610 5583 4717",
"output": "2358/131305"
},
{
"input": "3898439 96326 71937",
"output": "71936/3898439"
},
{
"input": "257593781689876390 32561717 4411677",
"output": "7914548537/257593781689876390"
},
{
"input": "111319886766128339 7862842484895022 3003994959686829",
"output": "3003994959686828/111319886766128339"
},
{
"input": "413850294331656955 570110918058849723 409853735661743839",
"output": "409853735661743838/413850294331656955"
},
{
"input": "3000000000000000000 2999999999999999873 2999999999999999977",
"output": "23437499999999999/23437500000000000"
},
{
"input": "9 6 1",
"output": "1/9"
},
{
"input": "32 9 2",
"output": "3/32"
},
{
"input": "976 5 6",
"output": "41/244"
},
{
"input": "5814 31 7",
"output": "94/2907"
},
{
"input": "94268 714 345",
"output": "689/94268"
},
{
"input": "262610 5583 4717",
"output": "2358/131305"
},
{
"input": "3898439 96326 71937",
"output": "71936/3898439"
},
{
"input": "54682301 778668 253103",
"output": "253102/54682301"
},
{
"input": "329245015 1173508 8918834",
"output": "1173507/329245015"
},
{
"input": "321076647734423976 7 7",
"output": "1/1"
},
{
"input": "455227494055672047 92 28",
"output": "19792499741550983/455227494055672047"
},
{
"input": "595779167455745259 6954 8697",
"output": "205511958419723/595779167455745259"
},
{
"input": "1000000000000000000 1000000000 2000000000",
"output": "1/2"
},
{
"input": "462643382718281828 462643382718281507 462643382718281701",
"output": "33045955908448679/33045955908448702"
},
{
"input": "4000000000000000000 9999999999999997 99999999999999999",
"output": "2499999999999999/1000000000000000000"
},
{
"input": "4003000100004000000 9999999099999999 99999999999999999",
"output": "4999999549999999/2001500050002000000"
},
{
"input": "4903000100004000000 58997960959949999 99933992929999999",
"output": "29498980479974999/2451500050002000000"
},
{
"input": "257593781689876390 32561717 4411677",
"output": "7914548537/257593781689876390"
},
{
"input": "111319886766128339 7862842484895022 3003994959686829",
"output": "3003994959686828/111319886766128339"
},
{
"input": "413850294331656955 570110918058849723 409853735661743839",
"output": "409853735661743838/413850294331656955"
},
{
"input": "232 17 83",
"output": "2/29"
},
{
"input": "5496272 63 200",
"output": "13765/2748136"
},
{
"input": "180 174 53",
"output": "13/45"
},
{
"input": "1954 190 537",
"output": "189/1954"
},
{
"input": "146752429 510 514",
"output": "571199/146752429"
},
{
"input": "579312860 55 70",
"output": "10344881/144828215"
},
{
"input": "1 9 9",
"output": "1/1"
},
{
"input": "95 19 19",
"output": "1/1"
},
{
"input": "404 63 441",
"output": "31/202"
},
{
"input": "5566 4798 4798",
"output": "1/1"
},
{
"input": "118289676 570846883 570846883",
"output": "1/1"
},
{
"input": "763 358 358",
"output": "1/1"
},
{
"input": "85356138 7223 482120804",
"output": "3611/42678069"
},
{
"input": "674664088 435395270 5",
"output": "9/674664088"
},
{
"input": "762200126044291557 370330636048898430 6",
"output": "17/762200126044291557"
},
{
"input": "917148533938841535 47 344459175789842163",
"output": "28/183429706787768307"
},
{
"input": "360212127113008697 877228952036215545 5259",
"output": "5258/360212127113008697"
},
{
"input": "683705963104411677 89876390 116741460012229240",
"output": "539258339/683705963104411677"
},
{
"input": "573003994959686829 275856334120822851 1319886766128339",
"output": "3959660298385016/573003994959686829"
},
{
"input": "409853735661743839 413850294331656955 413850294331656955",
"output": "1/1"
},
{
"input": "19 1 19",
"output": "1/19"
},
{
"input": "576 18 32",
"output": "1/16"
},
{
"input": "9540 10 954",
"output": "1/477"
},
{
"input": "101997840 6 16999640",
"output": "1/8499820"
},
{
"input": "955944 1278 748",
"output": "1/639"
},
{
"input": "482120804 66748 7223",
"output": "1/66748"
},
{
"input": "370330636048898430 61721772674816405 6",
"output": "1/61721772674816405"
},
{
"input": "344459175789842163 7328918633826429 47",
"output": "1/7328918633826429"
},
{
"input": "877228952036215545 166805277055755 5259",
"output": "1/55601759018585"
},
{
"input": "116741460012229240 1298911316 89876390",
"output": "1/649455658"
},
{
"input": "275856334120822851 209 1319886766128339",
"output": "1/1319886766128339"
},
{
"input": "413850294331656955 1 413850294331656955",
"output": "1/413850294331656955"
},
{
"input": "54682301 778668 253103",
"output": "253102/54682301"
},
{
"input": "329245015 3931027 6443236",
"output": "357366/29931365"
},
{
"input": "321076647734423976 7 8",
"output": "1672274206950125/13378193655600999"
},
{
"input": "455227494055672047 71 60",
"output": "6411654845854559/455227494055672047"
},
{
"input": "595779167455745259 9741 9331",
"output": "61162012885196/595779167455745259"
},
{
"input": "6470 80 160",
"output": "327/647"
},
{
"input": "686325 828 1656",
"output": "114511/228775"
},
{
"input": "4535304 2129 4258",
"output": "755973/1511768"
},
{
"input": "40525189 6365 12730",
"output": "20265394/40525189"
},
{
"input": "675297075 25986 51972",
"output": "112553659/225099025"
},
{
"input": "5681598412 75376 226128",
"output": "1893897375/5681598412"
},
{
"input": "384118571739435733 619773000 1859319000",
"output": "128039524053435733/384118571739435733"
},
{
"input": "391554751752251913 625743359 1877230077",
"output": "130518250652782079/391554751752251913"
},
{
"input": "390728504279201198 625082797 1250165594",
"output": "195364252413988195/390728504279201198"
},
{
"input": "389902265396085075 624421544 1248843088",
"output": "64983710976697837/129967421798695025"
},
{
"input": "734812071040507372 857211800 2571635400",
"output": "61234339274051543/183703017760126843"
},
{
"input": "1 1 2",
"output": "0/1"
},
{
"input": "3 1 4",
"output": "0/1"
},
{
"input": "8 2 3",
"output": "3/8"
},
{
"input": "64 32 16",
"output": "1/2"
},
{
"input": "1 1 1000000000",
"output": "0/1"
},
{
"input": "1000000000 1 1",
"output": "1/1"
},
{
"input": "1000000000 1000000000 1000000000",
"output": "1/1"
},
{
"input": "1000000000 2 4",
"output": "1/2"
},
{
"input": "1000000000 123 456",
"output": "6579023/1000000000"
},
{
"input": "1000000000 123123 654",
"output": "24851/1000000000"
},
{
"input": "123456 123 456",
"output": "215/30864"
},
{
"input": "123456 1234567 123",
"output": "61/61728"
},
{
"input": "314159265 271 8281",
"output": "37939/314159265"
},
{
"input": "11071994 4231 1324",
"output": "2647/11071994"
},
{
"input": "961748927 961748941 982451653",
"output": "1/1"
},
{
"input": "15485221 1259 90863",
"output": "1258/15485221"
},
{
"input": "5000000000000000000 4999999999999999837 4999999999999999963",
"output": "1249999999999999959/1250000000000000000"
},
{
"input": "4000000000000000000 3999999999999999691 3999999999999999887",
"output": "399999999999999969/400000000000000000"
},
{
"input": "999999999999999999 999999999999999709 999999999999999737",
"output": "333333333333333236/333333333333333333"
},
{
"input": "799999999999999999 799999999999999969 799999999999999991",
"output": "799999999999999968/799999999999999999"
},
{
"input": "812312312312312222 812312312312311897 812312312312312029",
"output": "406156156156155948/406156156156156111"
},
{
"input": "500000000000000000 499999999999999927 499999999999999931",
"output": "249999999999999963/250000000000000000"
},
{
"input": "555555555555555555 555555555555555083 555555555555555229",
"output": "50505050505050462/50505050505050505"
},
{
"input": "199419941994199419 199419941994199369 199419941994199391",
"output": "66473313998066456/66473313998066473"
},
{
"input": "145685485411238588 145685485411238483 145685485411238573",
"output": "72842742705619241/72842742705619294"
},
{
"input": "314159265358979323 314159265358979167 314159265358979213",
"output": "314159265358979166/314159265358979323"
},
{
"input": "10 1000000000000000000 1000000000000000001",
"output": "1/1"
},
{
"input": "5 100000000000000000 99999999999999999",
"output": "1/1"
},
{
"input": "5 1000000000000 1000000000001",
"output": "1/1"
},
{
"input": "5 1000000000000000000 1000000000000000001",
"output": "1/1"
},
{
"input": "2 1000000000000000000 1000000000000000001",
"output": "1/1"
},
{
"input": "2 10 11",
"output": "1/1"
},
{
"input": "10 123456789123456789 723456789123456781",
"output": "1/1"
},
{
"input": "12345678910 123456789101112131 123456789101112132",
"output": "1/1"
},
{
"input": "5 499999999999999999 499999999999999998",
"output": "1/1"
}
] | 1,572,313,999 | 2,599 |
Python 3
|
WRONG_ANSWER
|
TESTS
| 20 | 124 | 0 |
from sys import stdin
t,w,b=map(int,stdin.readline().strip().split())
from math import gcd
def lcm(a,b):
return (a*b)//gcd(a,b)
x=min(w,b)-1
y=t//lcm(w,b)
ans=y+y*x+x
g=gcd(ans,t)
while g!=1:
ans=ans//g
t=t//g
g=gcd(ans,t)
print(str(ans)+"/"+str(t))
|
Title: The Big Race
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Vector Willman and Array Bolt are the two most famous athletes of Byteforces. They are going to compete in a race with a distance of *L* meters today.
Willman and Bolt have exactly the same speed, so when they compete the result is always a tie. That is a problem for the organizers because they want a winner.
While watching previous races the organizers have noticed that Willman can perform only steps of length equal to *w* meters, and Bolt can perform only steps of length equal to *b* meters. Organizers decided to slightly change the rules of the race. Now, at the end of the racetrack there will be an abyss, and the winner will be declared the athlete, who manages to run farther from the starting point of the the racetrack (which is not the subject to change by any of the athletes).
Note that none of the athletes can run infinitely far, as they both will at some moment of time face the point, such that only one step further will cause them to fall in the abyss. In other words, the athlete will not fall into the abyss if the total length of all his steps will be less or equal to the chosen distance *L*.
Since the organizers are very fair, the are going to set the length of the racetrack as an integer chosen randomly and uniformly in range from 1 to *t* (both are included). What is the probability that Willman and Bolt tie again today?
Input Specification:
The first line of the input contains three integers *t*, *w* and *b* (1<=≤<=*t*,<=*w*,<=*b*<=≤<=5·1018) — the maximum possible length of the racetrack, the length of Willman's steps and the length of Bolt's steps respectively.
Output Specification:
Print the answer to the problem as an irreducible fraction . Follow the format of the samples output.
The fraction (*p* and *q* are integers, and both *p*<=≥<=0 and *q*<=><=0 holds) is called irreducible, if there is no such integer *d*<=><=1, that both *p* and *q* are divisible by *d*.
Demo Input:
['10 3 2\n', '7 1 2\n']
Demo Output:
['3/10\n', '3/7\n']
Note:
In the first sample Willman and Bolt will tie in case 1, 6 or 7 are chosen as the length of the racetrack.
|
```python
from sys import stdin
t,w,b=map(int,stdin.readline().strip().split())
from math import gcd
def lcm(a,b):
return (a*b)//gcd(a,b)
x=min(w,b)-1
y=t//lcm(w,b)
ans=y+y*x+x
g=gcd(ans,t)
while g!=1:
ans=ans//g
t=t//g
g=gcd(ans,t)
print(str(ans)+"/"+str(t))
```
| 0 |
|
237 |
B
|
Young Table
|
PROGRAMMING
| 1,500 |
[
"implementation",
"sortings"
] | null | null |
You've got table *a*, consisting of *n* rows, numbered from 1 to *n*. The *i*-th line of table *a* contains *c**i* cells, at that for all *i* (1<=<<=*i*<=≤<=*n*) holds *c**i*<=≤<=*c**i*<=-<=1.
Let's denote *s* as the total number of cells of table *a*, that is, . We know that each cell of the table contains a single integer from 1 to *s*, at that all written integers are distinct.
Let's assume that the cells of the *i*-th row of table *a* are numbered from 1 to *c**i*, then let's denote the number written in the *j*-th cell of the *i*-th row as *a**i*,<=*j*. Your task is to perform several swap operations to rearrange the numbers in the table so as to fulfill the following conditions:
1. for all *i*,<=*j* (1<=<<=*i*<=≤<=*n*; 1<=≤<=*j*<=≤<=*c**i*) holds *a**i*,<=*j*<=><=*a**i*<=-<=1,<=*j*; 1. for all *i*,<=*j* (1<=≤<=*i*<=≤<=*n*; 1<=<<=*j*<=≤<=*c**i*) holds *a**i*,<=*j*<=><=*a**i*,<=*j*<=-<=1.
In one swap operation you are allowed to choose two different cells of the table and swap the recorded there numbers, that is the number that was recorded in the first of the selected cells before the swap, is written in the second cell after it. Similarly, the number that was recorded in the second of the selected cells, is written in the first cell after the swap.
Rearrange the numbers in the required manner. Note that you are allowed to perform any number of operations, but not more than *s*. You do not have to minimize the number of operations.
|
The first line contains a single integer *n* (1<=≤<=*n*<=≤<=50) that shows the number of rows in the table. The second line contains *n* space-separated integers *c**i* (1<=≤<=*c**i*<=≤<=50; *c**i*<=≤<=*c**i*<=-<=1) — the numbers of cells on the corresponding rows.
Next *n* lines contain table *а*. The *i*-th of them contains *c**i* space-separated integers: the *j*-th integer in this line represents *a**i*,<=*j*.
It is guaranteed that all the given numbers *a**i*,<=*j* are positive and do not exceed *s*. It is guaranteed that all *a**i*,<=*j* are distinct.
|
In the first line print a single integer *m* (0<=≤<=*m*<=≤<=*s*), representing the number of performed swaps.
In the next *m* lines print the description of these swap operations. In the *i*-th line print four space-separated integers *x**i*,<=*y**i*,<=*p**i*,<=*q**i* (1<=≤<=*x**i*,<=*p**i*<=≤<=*n*; 1<=≤<=*y**i*<=≤<=*c**x**i*; 1<=≤<=*q**i*<=≤<=*c**p**i*). The printed numbers denote swapping the contents of cells *a**x**i*,<=*y**i* and *a**p**i*,<=*q**i*. Note that a swap operation can change the contents of distinct table cells. Print the swaps in the order, in which they should be executed.
|
[
"3\n3 2 1\n4 3 5\n6 1\n2\n",
"1\n4\n4 3 2 1\n"
] |
[
"2\n1 1 2 2\n2 1 3 1\n",
"2\n1 1 1 4\n1 2 1 3\n"
] |
none
| 1,000 |
[
{
"input": "3\n3 2 1\n4 3 5\n6 1\n2",
"output": "2\n1 1 2 2\n2 1 3 1"
},
{
"input": "1\n4\n4 3 2 1",
"output": "2\n1 1 1 4\n1 2 1 3"
},
{
"input": "5\n4 4 3 3 1\n14 13 4 15\n11 1 2 5\n7 6 10\n8 9 3\n12",
"output": "13\n1 1 2 2\n1 2 2 3\n1 3 4 3\n1 4 4 3\n2 1 2 4\n2 2 3 2\n2 3 3 1\n2 4 4 1\n3 1 4 2\n3 2 3 3\n3 3 4 1\n4 1 5 1\n4 3 5 1"
},
{
"input": "2\n8 6\n1 2 3 13 10 4 11 7\n9 12 8 5 14 6",
"output": "7\n1 4 1 6\n1 5 2 4\n1 6 2 6\n1 7 1 8\n1 8 2 3\n2 2 2 4\n2 5 2 6"
},
{
"input": "6\n10 9 7 6 4 3\n18 20 29 19 5 28 31 30 32 15\n38 33 11 8 39 2 6 9 3\n13 37 27 24 26 1 17\n36 10 35 21 7 16\n22 23 4 12\n34 25 14",
"output": "33\n1 1 3 6\n1 2 2 6\n1 3 2 9\n1 4 5 3\n1 6 2 7\n1 7 4 5\n1 8 2 4\n1 9 2 8\n1 10 4 2\n2 1 2 3\n2 2 5 4\n2 3 3 1\n2 4 6 3\n2 5 4 2\n2 6 4 6\n2 7 3 7\n2 8 3 6\n2 9 5 3\n3 1 4 6\n3 2 4 4\n3 3 5 1\n3 4 5 2\n3 5 5 2\n3 6 6 2\n3 7 5 2\n4 1 5 1\n4 2 5 2\n4 3 5 3\n4 4 6 3\n4 6 6 2\n5 1 5 4\n5 2 6 1\n6 1 6 3"
},
{
"input": "8\n2 2 2 2 1 1 1 1\n10 9\n11 5\n7 3\n2 6\n12\n1\n8\n4",
"output": "9\n1 1 6 1\n1 2 4 1\n2 1 3 2\n2 2 8 1\n3 1 8 1\n3 2 4 2\n4 1 8 1\n4 2 7 1\n5 1 8 1"
},
{
"input": "4\n3 3 3 2\n6 3 11\n10 7 1\n9 4 5\n2 8",
"output": "8\n1 1 2 3\n1 2 4 1\n1 3 4 1\n2 1 3 2\n2 2 3 3\n3 1 3 3\n3 2 4 2\n4 1 4 2"
},
{
"input": "1\n1\n1",
"output": "0"
},
{
"input": "2\n35 7\n6 8 35 9 28 25 10 41 33 39 19 24 5 12 30 40 18 2 4 11 32 13 31 21 14 27 3 34 37 16 17 29 1 42 36\n20 23 38 15 26 7 22",
"output": "39\n1 1 1 33\n1 2 1 18\n1 3 1 27\n1 4 1 19\n1 5 1 13\n1 6 1 33\n1 7 2 6\n1 8 1 18\n1 9 1 19\n1 10 2 6\n1 11 1 20\n1 12 1 14\n1 13 1 22\n1 14 1 25\n1 15 2 4\n1 16 1 30\n1 17 1 31\n1 18 1 31\n1 19 1 20\n1 20 2 1\n1 21 1 24\n1 22 2 7\n1 23 2 2\n1 24 1 25\n1 25 1 33\n1 26 2 5\n1 27 2 5\n1 28 2 7\n1 29 1 32\n1 30 2 4\n1 31 2 2\n1 32 1 33\n1 33 2 1\n1 34 2 7\n1 35 2 5\n2 1 2 5\n2 2 2 5\n2 4 2 6\n2 5 2 6"
},
{
"input": "3\n36 28 14\n46 15 35 60 41 65 73 33 18 20 68 22 28 23 67 44 2 24 21 51 37 3 48 69 12 50 32 72 45 53 17 47 56 52 29 57\n8 62 10 19 26 64 7 49 6 25 34 63 74 31 14 43 30 4 11 76 16 55 36 5 70 61 77 27\n38 40 1 78 58 42 66 71 75 59 54 9 39 13",
"output": "73\n1 1 3 3\n1 2 1 17\n1 3 1 22\n1 4 2 18\n1 5 2 24\n1 6 2 9\n1 7 2 7\n1 8 2 1\n1 9 3 12\n1 10 2 3\n1 11 2 19\n1 12 1 25\n1 13 3 14\n1 14 2 15\n1 15 1 17\n1 16 2 21\n1 17 1 31\n1 18 3 12\n1 19 2 4\n1 20 2 3\n1 21 2 4\n1 22 1 25\n1 23 2 15\n1 24 3 12\n1 25 2 10\n1 26 2 5\n1 27 2 28\n1 28 3 14\n1 29 1 35\n1 30 2 17\n1 31 2 14\n1 32 2 28\n1 33 2 1\n1 34 2 11\n1 35 2 10\n1 36 2 23\n2 1 2 4\n2 2 3 1\n2 3 3 13\n2 4 3 2\n2 5 2 24\n2 6 3 6\n2 7 2 16\n2 8 2 21\n2 9 2 10\n2 10 3 3\n2 11 2 28\n2 12 2 15\n2 13 2 21\n2..."
},
{
"input": "4\n40 40 24 5\n56 14 59 76 92 34 43 96 33 44 72 37 81 27 42 5 7 95 22 4 60 18 61 103 74 84 93 55 3 62 70 82 77 51 86 102 29 67 91 9\n71 53 21 64 17 45 46 101 97 30 109 100 57 16 80 87 28 12 94 23 39 98 32 52 54 10 19 41 90 11 66 65 99 89 40 36 58 20 78 108\n35 88 73 75 104 63 79 31 1 26 2 50 24 83 15 49 106 48 105 47 8 68 107 38\n69 85 13 25 6",
"output": "106\n1 1 3 9\n1 2 3 11\n1 3 1 29\n1 4 1 20\n1 5 1 16\n1 6 4 5\n1 7 1 17\n1 8 3 21\n1 9 1 40\n1 10 2 26\n1 11 2 30\n1 12 2 18\n1 13 4 3\n1 14 3 11\n1 15 3 15\n1 16 2 14\n1 17 2 5\n1 18 1 22\n1 19 2 27\n1 20 2 38\n1 21 2 3\n1 22 2 27\n1 23 2 20\n1 24 3 13\n1 25 4 4\n1 26 3 10\n1 27 3 11\n1 28 2 17\n1 29 1 37\n1 30 2 10\n1 31 3 8\n1 32 2 23\n1 33 1 40\n1 34 4 5\n1 35 3 1\n1 36 2 36\n1 37 2 18\n1 38 3 24\n1 39 2 21\n1 40 2 35\n2 1 2 28\n2 2 3 15\n2 3 2 5\n2 4 2 26\n2 5 2 6\n2 6 2 7\n2 7 3 20\n2 8 3 18\n2 9 3 1..."
},
{
"input": "50\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1\n6\n42\n43\n50\n36\n39\n13\n44\n16\n25\n11\n23\n15\n46\n10\n45\n1\n37\n20\n5\n8\n48\n35\n12\n38\n40\n2\n4\n21\n31\n22\n18\n27\n26\n41\n34\n9\n14\n24\n17\n30\n28\n32\n47\n33\n49\n19\n3\n29\n7",
"output": "48\n1 1 17 1\n2 1 27 1\n3 1 48 1\n4 1 28 1\n5 1 20 1\n6 1 17 1\n7 1 50 1\n8 1 21 1\n9 1 37 1\n10 1 15 1\n12 1 24 1\n13 1 50 1\n14 1 38 1\n15 1 50 1\n16 1 37 1\n17 1 40 1\n18 1 32 1\n19 1 47 1\n20 1 47 1\n21 1 29 1\n22 1 31 1\n23 1 24 1\n24 1 39 1\n25 1 50 1\n26 1 34 1\n27 1 33 1\n28 1 42 1\n29 1 49 1\n30 1 41 1\n31 1 41 1\n32 1 43 1\n33 1 45 1\n34 1 36 1\n35 1 39 1\n36 1 47 1\n37 1 43 1\n38 1 50 1\n39 1 40 1\n40 1 47 1\n41 1 47 1\n42 1 45 1\n43 1 48 1\n44 1 49 1\n45 1 48 1\n46 1 50 1\n47 1 49 1\n48 1 49 1\n..."
},
{
"input": "49\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1\n71 11\n56 27\n72 51\n65 46\n36 55\n34 60\n31 18\n22 52\n63 59\n37 17\n3 48\n35 69\n8 29\n4 19\n10 1\n33 32\n62 26\n9 64\n12 57\n30 25\n7 38\n15 14\n61 68\n50 28\n21\n58\n47\n2\n13\n44\n20\n23\n73\n49\n43\n54\n70\n16\n39\n41\n42\n66\n5\n6\n53\n24\n67\n45\n40",
"output": "67\n1 1 15 2\n1 2 28 1\n2 1 11 1\n2 2 14 1\n3 1 43 1\n3 2 44 1\n4 1 21 1\n4 2 13 1\n5 1 18 1\n5 2 15 1\n6 1 28 1\n6 2 19 1\n7 1 29 1\n7 2 22 2\n8 1 22 1\n8 2 38 1\n9 1 10 2\n9 2 22 2\n10 1 14 2\n10 2 31 1\n11 1 25 1\n11 2 22 1\n12 1 32 1\n12 2 46 1\n13 1 20 2\n13 2 17 2\n14 2 24 2\n15 1 17 2\n15 2 20 1\n16 1 29 1\n17 1 29 1\n17 2 28 1\n18 1 32 1\n18 2 32 1\n19 1 24 2\n19 2 21 2\n20 1 39 1\n20 2 49 1\n21 1 40 1\n21 2 41 1\n22 1 35 1\n22 2 30 1\n23 1 48 1\n23 2 49 1\n24 1 27 1\n24 2 35 1\n25 1 34 1\n26 1 27 ..."
},
{
"input": "48\n3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 2 2 2 2 2 2 2 2 2 2 2 2 2 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1\n90 26 28\n70 20 1\n11 10 9\n69 84 30\n73 63 61\n17 58 41\n54 57 51\n88 4 32\n85 33 34\n40 80 77\n93 7 3\n38 75 53\n79 74 81\n91 76 87\n22 2 59\n86 82 60\n24 52\n92 72\n49 6\n8 65\n50 25\n46 16\n42 48\n78 37\n39 71\n31 5\n19 43\n64 67\n36 45\n18\n89\n55\n15\n56\n13\n27\n47\n23\n14\n68\n62\n83\n66\n29\n35\n44\n21\n12",
"output": "88\n1 1 2 3\n1 2 15 2\n1 3 11 3\n2 1 8 2\n2 2 26 2\n2 3 19 2\n3 1 11 2\n3 2 20 1\n4 1 20 1\n4 2 11 2\n4 3 48 1\n5 1 35 1\n5 2 39 1\n5 3 33 1\n6 1 22 2\n6 2 22 2\n6 3 30 1\n7 1 27 1\n7 2 26 2\n7 3 47 1\n8 1 15 1\n8 2 38 1\n8 3 17 1\n9 1 21 2\n9 2 15 2\n9 3 36 1\n10 1 11 3\n10 2 44 1\n10 3 48 1\n11 1 26 1\n11 2 17 1\n11 3 15 2\n12 1 36 1\n12 2 45 1\n12 3 29 1\n13 1 24 2\n13 2 36 1\n13 3 25 1\n14 1 15 2\n14 2 30 1\n14 3 23 1\n15 1 27 2\n15 2 46 1\n15 3 29 2\n16 1 22 1\n16 2 37 1\n16 3 23 2\n17 1 19 1\n17 2 21..."
},
{
"input": "5\n5 2 2 2 1\n1 3 4 5 12\n2 6\n8 9\n7 10\n11",
"output": "8\n1 2 2 1\n1 3 2 1\n1 4 2 1\n1 5 2 1\n2 1 2 2\n2 2 4 1\n4 1 4 2\n4 2 5 1"
},
{
"input": "5\n5 4 3 2 1\n1 2 3 4 5\n6 7 8 9\n10 11 12\n13 14\n15",
"output": "0"
},
{
"input": "1\n1\n1",
"output": "0"
},
{
"input": "4\n4 4 2 2\n1 2 3 4\n5 6 7 8\n9 10\n11 12",
"output": "0"
},
{
"input": "1\n50\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50",
"output": "0"
}
] | 1,593,190,303 | 2,147,483,647 |
Python 3
|
OK
|
TESTS
| 55 | 218 | 6,963,200 |
n = int(input())
c = [0] + list(map(int, input().split()))
m = sum(c)
p, q, r, t = [0] * (m + 1), {}, [0] * m, []
k = 0
for i in range(1, n + 1):
s = str(i) + ' '
for j in range(1, c[i] + 1):
r[k] = s + str(j)
k += 1
k = 0
for i in range(n):
for x in tuple(map(int, input().split())):
p[x], q[r[k]] = r[k], x
k += 1
k = 1
for y in r:
a, b = q[y], p[k]
if p[k] != y:
t.append(y + ' ' + b)
p[a], q[b] = b, a
k += 1
print(len(t))
print('\n'.join(t))
|
Title: Young Table
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You've got table *a*, consisting of *n* rows, numbered from 1 to *n*. The *i*-th line of table *a* contains *c**i* cells, at that for all *i* (1<=<<=*i*<=≤<=*n*) holds *c**i*<=≤<=*c**i*<=-<=1.
Let's denote *s* as the total number of cells of table *a*, that is, . We know that each cell of the table contains a single integer from 1 to *s*, at that all written integers are distinct.
Let's assume that the cells of the *i*-th row of table *a* are numbered from 1 to *c**i*, then let's denote the number written in the *j*-th cell of the *i*-th row as *a**i*,<=*j*. Your task is to perform several swap operations to rearrange the numbers in the table so as to fulfill the following conditions:
1. for all *i*,<=*j* (1<=<<=*i*<=≤<=*n*; 1<=≤<=*j*<=≤<=*c**i*) holds *a**i*,<=*j*<=><=*a**i*<=-<=1,<=*j*; 1. for all *i*,<=*j* (1<=≤<=*i*<=≤<=*n*; 1<=<<=*j*<=≤<=*c**i*) holds *a**i*,<=*j*<=><=*a**i*,<=*j*<=-<=1.
In one swap operation you are allowed to choose two different cells of the table and swap the recorded there numbers, that is the number that was recorded in the first of the selected cells before the swap, is written in the second cell after it. Similarly, the number that was recorded in the second of the selected cells, is written in the first cell after the swap.
Rearrange the numbers in the required manner. Note that you are allowed to perform any number of operations, but not more than *s*. You do not have to minimize the number of operations.
Input Specification:
The first line contains a single integer *n* (1<=≤<=*n*<=≤<=50) that shows the number of rows in the table. The second line contains *n* space-separated integers *c**i* (1<=≤<=*c**i*<=≤<=50; *c**i*<=≤<=*c**i*<=-<=1) — the numbers of cells on the corresponding rows.
Next *n* lines contain table *а*. The *i*-th of them contains *c**i* space-separated integers: the *j*-th integer in this line represents *a**i*,<=*j*.
It is guaranteed that all the given numbers *a**i*,<=*j* are positive and do not exceed *s*. It is guaranteed that all *a**i*,<=*j* are distinct.
Output Specification:
In the first line print a single integer *m* (0<=≤<=*m*<=≤<=*s*), representing the number of performed swaps.
In the next *m* lines print the description of these swap operations. In the *i*-th line print four space-separated integers *x**i*,<=*y**i*,<=*p**i*,<=*q**i* (1<=≤<=*x**i*,<=*p**i*<=≤<=*n*; 1<=≤<=*y**i*<=≤<=*c**x**i*; 1<=≤<=*q**i*<=≤<=*c**p**i*). The printed numbers denote swapping the contents of cells *a**x**i*,<=*y**i* and *a**p**i*,<=*q**i*. Note that a swap operation can change the contents of distinct table cells. Print the swaps in the order, in which they should be executed.
Demo Input:
['3\n3 2 1\n4 3 5\n6 1\n2\n', '1\n4\n4 3 2 1\n']
Demo Output:
['2\n1 1 2 2\n2 1 3 1\n', '2\n1 1 1 4\n1 2 1 3\n']
Note:
none
|
```python
n = int(input())
c = [0] + list(map(int, input().split()))
m = sum(c)
p, q, r, t = [0] * (m + 1), {}, [0] * m, []
k = 0
for i in range(1, n + 1):
s = str(i) + ' '
for j in range(1, c[i] + 1):
r[k] = s + str(j)
k += 1
k = 0
for i in range(n):
for x in tuple(map(int, input().split())):
p[x], q[r[k]] = r[k], x
k += 1
k = 1
for y in r:
a, b = q[y], p[k]
if p[k] != y:
t.append(y + ' ' + b)
p[a], q[b] = b, a
k += 1
print(len(t))
print('\n'.join(t))
```
| 3 |
|
78 |
B
|
Easter Eggs
|
PROGRAMMING
| 1,200 |
[
"constructive algorithms",
"implementation"
] |
B. Easter Eggs
|
2
|
256
|
The Easter Rabbit laid *n* eggs in a circle and is about to paint them.
Each egg should be painted one color out of 7: red, orange, yellow, green, blue, indigo or violet. Also, the following conditions should be satisfied:
- Each of the seven colors should be used to paint at least one egg. - Any four eggs lying sequentially should be painted different colors.
Help the Easter Rabbit paint the eggs in the required manner. We know that it is always possible.
|
The only line contains an integer *n* — the amount of eggs (7<=≤<=*n*<=≤<=100).
|
Print one line consisting of *n* characters. The *i*-th character should describe the color of the *i*-th egg in the order they lie in the circle. The colors should be represented as follows: "R" stands for red, "O" stands for orange, "Y" stands for yellow, "G" stands for green, "B" stands for blue, "I" stands for indigo, "V" stands for violet.
If there are several answers, print any of them.
|
[
"8\n",
"13\n"
] |
[
"ROYGRBIV\n",
"ROYGBIVGBIVYG\n"
] |
The way the eggs will be painted in the first sample is shown on the picture:
| 1,000 |
[
{
"input": "8",
"output": "ROYGBIVG"
},
{
"input": "13",
"output": "ROYGBIVOYGBIV"
},
{
"input": "7",
"output": "ROYGBIV"
},
{
"input": "10",
"output": "ROYGBIVYGB"
},
{
"input": "14",
"output": "ROYGBIVROYGBIV"
},
{
"input": "50",
"output": "ROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVG"
},
{
"input": "9",
"output": "ROYGBIVGB"
},
{
"input": "11",
"output": "ROYGBIVYGBI"
},
{
"input": "12",
"output": "ROYGBIVOYGBI"
},
{
"input": "15",
"output": "ROYGBIVROYGBIVG"
},
{
"input": "16",
"output": "ROYGBIVROYGBIVGB"
},
{
"input": "17",
"output": "ROYGBIVROYGBIVYGB"
},
{
"input": "18",
"output": "ROYGBIVROYGBIVYGBI"
},
{
"input": "19",
"output": "ROYGBIVROYGBIVOYGBI"
},
{
"input": "20",
"output": "ROYGBIVROYGBIVOYGBIV"
},
{
"input": "21",
"output": "ROYGBIVROYGBIVROYGBIV"
},
{
"input": "22",
"output": "ROYGBIVROYGBIVROYGBIVG"
},
{
"input": "23",
"output": "ROYGBIVROYGBIVROYGBIVGB"
},
{
"input": "24",
"output": "ROYGBIVROYGBIVROYGBIVYGB"
},
{
"input": "25",
"output": "ROYGBIVROYGBIVROYGBIVYGBI"
},
{
"input": "28",
"output": "ROYGBIVROYGBIVROYGBIVROYGBIV"
},
{
"input": "29",
"output": "ROYGBIVROYGBIVROYGBIVROYGBIVG"
},
{
"input": "34",
"output": "ROYGBIVROYGBIVROYGBIVROYGBIVOYGBIV"
},
{
"input": "43",
"output": "ROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVG"
},
{
"input": "61",
"output": "ROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVOYGBI"
},
{
"input": "79",
"output": "ROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVGB"
},
{
"input": "81",
"output": "ROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVYGBI"
},
{
"input": "92",
"output": "ROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVG"
},
{
"input": "95",
"output": "ROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVYGBI"
},
{
"input": "96",
"output": "ROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVOYGBI"
},
{
"input": "97",
"output": "ROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVOYGBIV"
},
{
"input": "98",
"output": "ROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIV"
},
{
"input": "99",
"output": "ROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVG"
},
{
"input": "100",
"output": "ROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVROYGBIVGB"
}
] | 1,614,775,972 | 2,147,483,647 |
Python 3
|
WRONG_ANSWER
|
TESTS
| 0 | 62 | 0 |
n=int(input())
s="VIBGYOR"
print(s*(n//7)+s[:n%7+1])
|
Title: Easter Eggs
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
The Easter Rabbit laid *n* eggs in a circle and is about to paint them.
Each egg should be painted one color out of 7: red, orange, yellow, green, blue, indigo or violet. Also, the following conditions should be satisfied:
- Each of the seven colors should be used to paint at least one egg. - Any four eggs lying sequentially should be painted different colors.
Help the Easter Rabbit paint the eggs in the required manner. We know that it is always possible.
Input Specification:
The only line contains an integer *n* — the amount of eggs (7<=≤<=*n*<=≤<=100).
Output Specification:
Print one line consisting of *n* characters. The *i*-th character should describe the color of the *i*-th egg in the order they lie in the circle. The colors should be represented as follows: "R" stands for red, "O" stands for orange, "Y" stands for yellow, "G" stands for green, "B" stands for blue, "I" stands for indigo, "V" stands for violet.
If there are several answers, print any of them.
Demo Input:
['8\n', '13\n']
Demo Output:
['ROYGRBIV\n', 'ROYGBIVGBIVYG\n']
Note:
The way the eggs will be painted in the first sample is shown on the picture:
|
```python
n=int(input())
s="VIBGYOR"
print(s*(n//7)+s[:n%7+1])
```
| 0 |
556 |
A
|
Case of the Zeros and Ones
|
PROGRAMMING
| 900 |
[
"greedy"
] | null | null |
Andrewid the Android is a galaxy-famous detective. In his free time he likes to think about strings containing zeros and ones.
Once he thought about a string of length *n* consisting of zeroes and ones. Consider the following operation: we choose any two adjacent positions in the string, and if one them contains 0, and the other contains 1, then we are allowed to remove these two digits from the string, obtaining a string of length *n*<=-<=2 as a result.
Now Andreid thinks about what is the minimum length of the string that can remain after applying the described operation several times (possibly, zero)? Help him to calculate this number.
|
First line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=2·105), the length of the string that Andreid has.
The second line contains the string of length *n* consisting only from zeros and ones.
|
Output the minimum length of the string that may remain after applying the described operations several times.
|
[
"4\n1100\n",
"5\n01010\n",
"8\n11101111\n"
] |
[
"0\n",
"1\n",
"6\n"
] |
In the first sample test it is possible to change the string like the following: <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/10df55364c21c6e8d5da31b6ab6f6294c4fc26b3.png" style="max-width: 100.0%;max-height: 100.0%;"/>.
In the second sample test it is possible to change the string like the following: <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/19ec5dcd85f0b5cf757aa076ace72df39634de2d.png" style="max-width: 100.0%;max-height: 100.0%;"/>.
In the third sample test it is possible to change the string like the following: <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/dc34a159e4230375fa325555527ebc748811f188.png" style="max-width: 100.0%;max-height: 100.0%;"/>.
| 250 |
[
{
"input": "4\n1100",
"output": "0"
},
{
"input": "5\n01010",
"output": "1"
},
{
"input": "8\n11101111",
"output": "6"
},
{
"input": "1\n0",
"output": "1"
},
{
"input": "1\n1",
"output": "1"
},
{
"input": "2\n00",
"output": "2"
},
{
"input": "2\n01",
"output": "0"
},
{
"input": "2\n10",
"output": "0"
},
{
"input": "2\n11",
"output": "2"
},
{
"input": "3\n001",
"output": "1"
},
{
"input": "6\n110110",
"output": "2"
},
{
"input": "7\n0000011",
"output": "3"
},
{
"input": "6\n110010",
"output": "0"
},
{
"input": "6\n110100",
"output": "0"
},
{
"input": "3\n100",
"output": "1"
},
{
"input": "6\n010111",
"output": "2"
},
{
"input": "8\n01011100",
"output": "0"
},
{
"input": "6\n001011",
"output": "0"
},
{
"input": "7\n1110000",
"output": "1"
},
{
"input": "9\n011111101",
"output": "5"
}
] | 1,692,987,505 | 2,147,483,647 |
Python 3
|
TIME_LIMIT_EXCEEDED
|
TESTS
| 11 | 1,000 | 409,600 |
def main():
l=int(input())
s=input()
while True:
if '01' in s : s=s.replace('01','');
elif '10' in s: s=s.replace('10','');
else: return len(s)
print(main())
|
Title: Case of the Zeros and Ones
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Andrewid the Android is a galaxy-famous detective. In his free time he likes to think about strings containing zeros and ones.
Once he thought about a string of length *n* consisting of zeroes and ones. Consider the following operation: we choose any two adjacent positions in the string, and if one them contains 0, and the other contains 1, then we are allowed to remove these two digits from the string, obtaining a string of length *n*<=-<=2 as a result.
Now Andreid thinks about what is the minimum length of the string that can remain after applying the described operation several times (possibly, zero)? Help him to calculate this number.
Input Specification:
First line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=2·105), the length of the string that Andreid has.
The second line contains the string of length *n* consisting only from zeros and ones.
Output Specification:
Output the minimum length of the string that may remain after applying the described operations several times.
Demo Input:
['4\n1100\n', '5\n01010\n', '8\n11101111\n']
Demo Output:
['0\n', '1\n', '6\n']
Note:
In the first sample test it is possible to change the string like the following: <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/10df55364c21c6e8d5da31b6ab6f6294c4fc26b3.png" style="max-width: 100.0%;max-height: 100.0%;"/>.
In the second sample test it is possible to change the string like the following: <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/19ec5dcd85f0b5cf757aa076ace72df39634de2d.png" style="max-width: 100.0%;max-height: 100.0%;"/>.
In the third sample test it is possible to change the string like the following: <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/dc34a159e4230375fa325555527ebc748811f188.png" style="max-width: 100.0%;max-height: 100.0%;"/>.
|
```python
def main():
l=int(input())
s=input()
while True:
if '01' in s : s=s.replace('01','');
elif '10' in s: s=s.replace('10','');
else: return len(s)
print(main())
```
| 0 |
|
746 |
B
|
Decoding
|
PROGRAMMING
| 900 |
[
"implementation",
"strings"
] | null | null |
Polycarp is mad about coding, that is why he writes Sveta encoded messages. He calls the median letter in a word the letter which is in the middle of the word. If the word's length is even, the median letter is the left of the two middle letters. In the following examples, the median letter is highlighted: contest, info. If the word consists of single letter, then according to above definition this letter is the median letter.
Polycarp encodes each word in the following way: he writes down the median letter of the word, then deletes it and repeats the process until there are no letters left. For example, he encodes the word volga as logva.
You are given an encoding *s* of some word, your task is to decode it.
|
The first line contains a positive integer *n* (1<=≤<=*n*<=≤<=2000) — the length of the encoded word.
The second line contains the string *s* of length *n* consisting of lowercase English letters — the encoding.
|
Print the word that Polycarp encoded.
|
[
"5\nlogva\n",
"2\nno\n",
"4\nabba\n"
] |
[
"volga\n",
"no\n",
"baba\n"
] |
In the first example Polycarp encoded the word volga. At first, he wrote down the letter l from the position 3, after that his word looked like voga. After that Polycarp wrote down the letter o from the position 2, his word became vga. Then Polycarp wrote down the letter g which was at the second position, the word became va. Then he wrote down the letter v, then the letter a. Thus, the encoding looked like logva.
In the second example Polycarp encoded the word no. He wrote down the letter n, the word became o, and he wrote down the letter o. Thus, in this example, the word and its encoding are the same.
In the third example Polycarp encoded the word baba. At first, he wrote down the letter a, which was at the position 2, after that the word looked like bba. Then he wrote down the letter b, which was at the position 2, his word looked like ba. After that he wrote down the letter b, which was at the position 1, the word looked like a, and he wrote down that letter a. Thus, the encoding is abba.
| 1,000 |
[
{
"input": "5\nlogva",
"output": "volga"
},
{
"input": "2\nno",
"output": "no"
},
{
"input": "4\nabba",
"output": "baba"
},
{
"input": "51\nkfsmpaeviowvkdbuhdagquxxqniselafnfbrgbhmsugcbbnlrvv",
"output": "vlbcumbrfflsnxugdudvovamfkspeiwkbhaqxqieanbghsgbnrv"
},
{
"input": "1\nw",
"output": "w"
},
{
"input": "2\ncb",
"output": "cb"
},
{
"input": "3\nqok",
"output": "oqk"
},
{
"input": "4\naegi",
"output": "gaei"
},
{
"input": "5\noqquy",
"output": "uqoqy"
},
{
"input": "6\nulhpnm",
"output": "nhulpm"
},
{
"input": "7\nijvxljt",
"output": "jxjivlt"
},
{
"input": "8\nwwmiwkeo",
"output": "ewmwwiko"
},
{
"input": "9\ngmwqmpfow",
"output": "opqmgwmfw"
},
{
"input": "10\nhncmexsslh",
"output": "lsechnmxsh"
},
{
"input": "20\nrtcjbjlbtjfmvzdqutuw",
"output": "uudvftlbcrtjjbjmzqtw"
},
{
"input": "21\ngjyiqoebcnpsdegxnsauh",
"output": "usxesnboijgyqecpdgnah"
},
{
"input": "30\nudotcwvcwxajkadxqvxvwgmwmnqrby",
"output": "bqmmwxqdkawvcoudtwcxjaxvvgwnry"
},
{
"input": "31\nipgfrxxcgckksfgexlicjvtnhvrfbmb",
"output": "mfvnvclefkccxfpigrxgksgxijthrbb"
},
{
"input": "50\nwobervhvvkihcuyjtmqhaaigvahheoqleromusrartldojsjvy",
"output": "vsolrruoeqehviaqtycivhrbwoevvkhujmhagaholrmsatdjjy"
},
{
"input": "200\nhvayscqiwpcfykibwyudkzuzdkgqqvbnrfeupjefevlvojngmlcjwzijrkzbsaovabkvvwmjgoonyhuiphwmqdoiuueuyqtychbsklflnvghipdgaxhuhiiqlqocpvhldgvnsrtcwxpidrjffwvwcirluyyxzxrglheczeuouklzkvnyubsvgvmdbrylimztotdbmjph",
"output": "pmdoziybmgsunkluuzelrzyurcvfjdpwtsvdhpolihhadignfkbctyeuoqwpuyogmvkaoszriwcmnoleeperbqgdukuwiycwqsahvycipfkbydzzkqvnfujfvvjgljzjkbavbvwjonhihmdiuuqyhsllvhpgxuiqqcvlgnrcxirfwwilyxxghceokzvybvvdrlmttbjh"
},
{
"input": "201\nrpkghhfibtmlkpdiklegblbuyshfirheatjkfoqkfayfbxeeqijwqdwkkrkbdxlhzkhyiifemsghwovorlqedngldskfbhmwrnzmtjuckxoqdszmsdnbuqnlqzswdfhagasmfswanifrjjcuwdsplytvmnfarchgqteedgfpumkssindxndliozojzlpznwedodzwrrus",
"output": "urzoenpzoolndismpgetgcanvypdujriasmaafwzlqbdmsqxcjmnwhfslneloohseiykhxbrkdwiexfakokterfsulglipltihgprkhfbmkdkebbyhihajfqfybeqjqwkkdlzhifmgwvrqdgdkbmrztukodzsnunqsdhgsfwnfjcwsltmfrhqedfuksnxdizjlzwddwrs"
},
{
"input": "500\naopxumqciwxewxvlxzebsztskjvjzwyewjztqrsuvamtvklhqrbodtncqdchjrlpywvmtgnkkwtvpggktewdgvnhydkexwoxkgltaesrtifbwpciqsvrgjtqrdnyqkgqwrryacluaqmgdwxinqieiblolyekcbzahlhxdwqcgieyfgmicvgbbitbzhejkshjunzjteyyfngigjwyqqndtjrdykzrnrpinkwtrlchhxvycrhstpecadszilicrqdeyyidohqvzfnsqfyuemigacysxvtrgxyjcvejkjstsnatfqlkeytxgsksgpcooypsmqgcluzwofaupegxppbupvtumjerohdteuenwcmqaoazohkilgpkjavcrjcslhzkyjcgfzxxzjfufichxcodcawonkxhbqgfimmlycswdzwbnmjwhbwihfoftpcqplncavmbxuwnsabiyvpcrhfgtqyaguoaigknushbqjwqmmyvsxwabrub",
"output": "ubwsymwqhukiogytfrpybswxmanpctohwhjnwdsymigbxnwcoxcffzxfcyzlcrvjplkoaamweedoemtpbpgpaozlgmpocgkgtelfasskecygtxyaieyqnzqoiydriisaethcvhcrwnpnzyrtnqwggfytzuhkeztbgcmfegqdhhzcelliinxdmalarwgqnrtgvqcwftsalkoxkyngwtgptkntvyljcqndbqlvmvsqzwyzvktsexvwxiqupaoxmcwexlzbzsjjwejtruatkhrotcdhrpwmgkwvgkedvhdewxgteribpisrjqdykqrycuqgwiqeboykbalxwciygivbibhjsjnjeynijyqdjdkrriktlhxyrspcdzlcqeydhvfsfumgcsvrxjvjjtntqkyxsspoysqcuwfuexpuvujrhtuncqozhigkacjshkjgzxjuihcdaokhqfmlcwzbmwbiffpqlcvbunaivchgqauagnsbjqmvxarb"
},
{
"input": "501\noilesjbgowlnayckhpoaitijewsyhgavnthycaecwnvzpxgjqfjyxnjcjknvvsmjbjwtcoyfbegmnnheeamvtfjkigqoanhvgdfrjchdqgowrstlmrjmcsuuwvvoeucfyhnxivosrxblfoqwikfxjnnyejdiihpenfcahtjwcnzwvxxseicvdfgqhtvefswznuyohmmljlnxubhevywpmnitnkhecsgccpstxkmdzabsnwxkokdfsogzbpnfvgudvqlstxojzfzugxbfrozveaiofrzksegdelxsdhcjlqwqlgjcqiujptoenxozhkqhcpkarretqzfkwuvbmfdcdoqliyzmlfrfhzrnkbhofuctkpeacqejwvdrlyvepudrlzncbhwrgmxrczphsoymvtuzqjscvbtqpymogupgzctepccravjcrfsadueyraqvwasravkubebojqspdntewnjohvccamvoxdauyakvehjhabpdyzyme",
"output": "mzdbhhvaudomcvonenpqoeuvravayuafcvrcecguoyqbcjztmohzrmrhczrueyrvjqaptuobnzffmylocfbukztraphkzxetjicgqqjhsldekroavofxufjxsqdgfpzofkkwsadktpcsektnpyebxllmouzsetqfvisxwnwtafehijynxkwolxsvxhfuovusmrlswgdcrdvnogkfvaenmefotjjsvkcnyfjxzncaytvgywjtapkynwgjeiolsbolachoiieshanhcewvpgqjxjjnvmbwcybgnhemtjiqahgfjhqortmjcuwvecyniorbfqifjnedipnchjczvxecdghvfwnyhmjnuhvwminhcgcsxmzbnxodsgbnvuvltozzgbrzeifzsgexdclwljquponohqckreqfwvmddqizlrhrkhfckecewdlvpdlnbwgxcpsyvuqsvtpmgpztpcajrsderqwsakbbjsdtwjhcavxaykejapyye"
}
] | 1,692,806,471 | 2,147,483,647 |
Python 3
|
OK
|
TESTS
| 34 | 46 | 307,200 |
from collections import deque
a=int(input())
b=input()
req=deque([b[0]])
if a%2:
for i in range(1,len(b)):
if i%2:
req.appendleft(b[i])
else:
req.append(b[i])
print("".join(req))
else:
for i in range(1,len(b)):
if i%2:
req.append(b[i])
else:
req.appendleft(b[i])
print("".join(req))
|
Title: Decoding
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Polycarp is mad about coding, that is why he writes Sveta encoded messages. He calls the median letter in a word the letter which is in the middle of the word. If the word's length is even, the median letter is the left of the two middle letters. In the following examples, the median letter is highlighted: contest, info. If the word consists of single letter, then according to above definition this letter is the median letter.
Polycarp encodes each word in the following way: he writes down the median letter of the word, then deletes it and repeats the process until there are no letters left. For example, he encodes the word volga as logva.
You are given an encoding *s* of some word, your task is to decode it.
Input Specification:
The first line contains a positive integer *n* (1<=≤<=*n*<=≤<=2000) — the length of the encoded word.
The second line contains the string *s* of length *n* consisting of lowercase English letters — the encoding.
Output Specification:
Print the word that Polycarp encoded.
Demo Input:
['5\nlogva\n', '2\nno\n', '4\nabba\n']
Demo Output:
['volga\n', 'no\n', 'baba\n']
Note:
In the first example Polycarp encoded the word volga. At first, he wrote down the letter l from the position 3, after that his word looked like voga. After that Polycarp wrote down the letter o from the position 2, his word became vga. Then Polycarp wrote down the letter g which was at the second position, the word became va. Then he wrote down the letter v, then the letter a. Thus, the encoding looked like logva.
In the second example Polycarp encoded the word no. He wrote down the letter n, the word became o, and he wrote down the letter o. Thus, in this example, the word and its encoding are the same.
In the third example Polycarp encoded the word baba. At first, he wrote down the letter a, which was at the position 2, after that the word looked like bba. Then he wrote down the letter b, which was at the position 2, his word looked like ba. After that he wrote down the letter b, which was at the position 1, the word looked like a, and he wrote down that letter a. Thus, the encoding is abba.
|
```python
from collections import deque
a=int(input())
b=input()
req=deque([b[0]])
if a%2:
for i in range(1,len(b)):
if i%2:
req.appendleft(b[i])
else:
req.append(b[i])
print("".join(req))
else:
for i in range(1,len(b)):
if i%2:
req.append(b[i])
else:
req.appendleft(b[i])
print("".join(req))
```
| 3 |
|
604 |
A
|
Uncowed Forces
|
PROGRAMMING
| 1,000 |
[
"implementation"
] | null | null |
Kevin Sun has just finished competing in Codeforces Round #334! The round was 120 minutes long and featured five problems with maximum point values of 500, 1000, 1500, 2000, and 2500, respectively. Despite the challenging tasks, Kevin was uncowed and bulldozed through all of them, distinguishing himself from the herd as the best cowmputer scientist in all of Bovinia. Kevin knows his submission time for each problem, the number of wrong submissions that he made on each problem, and his total numbers of successful and unsuccessful hacks. Because Codeforces scoring is complicated, Kevin wants you to write a program to compute his final score.
Codeforces scores are computed as follows: If the maximum point value of a problem is *x*, and Kevin submitted correctly at minute *m* but made *w* wrong submissions, then his score on that problem is . His total score is equal to the sum of his scores for each problem. In addition, Kevin's total score gets increased by 100 points for each successful hack, but gets decreased by 50 points for each unsuccessful hack.
All arithmetic operations are performed with absolute precision and no rounding. It is guaranteed that Kevin's final score is an integer.
|
The first line of the input contains five space-separated integers *m*1, *m*2, *m*3, *m*4, *m*5, where *m**i* (0<=≤<=*m**i*<=≤<=119) is the time of Kevin's last submission for problem *i*. His last submission is always correct and gets accepted.
The second line contains five space-separated integers *w*1, *w*2, *w*3, *w*4, *w*5, where *w**i* (0<=≤<=*w**i*<=≤<=10) is Kevin's number of wrong submissions on problem *i*.
The last line contains two space-separated integers *h**s* and *h**u* (0<=≤<=*h**s*,<=*h**u*<=≤<=20), denoting the Kevin's numbers of successful and unsuccessful hacks, respectively.
|
Print a single integer, the value of Kevin's final score.
|
[
"20 40 60 80 100\n0 1 2 3 4\n1 0\n",
"119 119 119 119 119\n0 0 0 0 0\n10 0\n"
] |
[
"4900\n",
"4930\n"
] |
In the second sample, Kevin takes 119 minutes on all of the problems. Therefore, he gets <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/42158dc2bc78cd21fa679530ae9ef8b9ea298d15.png" style="max-width: 100.0%;max-height: 100.0%;"/> of the points on each problem. So his score from solving problems is <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/fdf392d8508500b57f8057ac0c4c892ab5f925a2.png" style="max-width: 100.0%;max-height: 100.0%;"/>. Adding in 10·100 = 1000 points from hacks, his total score becomes 3930 + 1000 = 4930.
| 500 |
[
{
"input": "20 40 60 80 100\n0 1 2 3 4\n1 0",
"output": "4900"
},
{
"input": "119 119 119 119 119\n0 0 0 0 0\n10 0",
"output": "4930"
},
{
"input": "3 6 13 38 60\n6 10 10 3 8\n9 9",
"output": "5088"
},
{
"input": "21 44 11 68 75\n6 2 4 8 4\n2 8",
"output": "4522"
},
{
"input": "16 112 50 114 68\n1 4 8 4 9\n19 11",
"output": "5178"
},
{
"input": "55 66 75 44 47\n6 0 6 6 10\n19 0",
"output": "6414"
},
{
"input": "47 11 88 5 110\n6 10 4 2 3\n10 6",
"output": "5188"
},
{
"input": "5 44 61 103 92\n9 0 10 4 8\n15 7",
"output": "4914"
},
{
"input": "115 53 96 62 110\n7 8 1 7 9\n7 16",
"output": "3416"
},
{
"input": "102 83 26 6 11\n3 4 1 8 3\n17 14",
"output": "6704"
},
{
"input": "36 102 73 101 19\n5 9 2 2 6\n4 13",
"output": "4292"
},
{
"input": "40 115 93 107 113\n5 7 2 6 8\n6 17",
"output": "2876"
},
{
"input": "53 34 53 107 81\n4 3 1 10 8\n7 7",
"output": "4324"
},
{
"input": "113 37 4 84 66\n2 0 10 3 0\n20 19",
"output": "6070"
},
{
"input": "10 53 101 62 1\n8 0 9 7 9\n0 11",
"output": "4032"
},
{
"input": "45 45 75 36 76\n6 2 2 0 0\n8 17",
"output": "5222"
},
{
"input": "47 16 44 78 111\n7 9 8 0 2\n1 19",
"output": "3288"
},
{
"input": "7 54 39 102 31\n6 0 2 10 1\n18 3",
"output": "6610"
},
{
"input": "0 46 86 72 40\n1 5 5 5 9\n6 5",
"output": "4924"
},
{
"input": "114 4 45 78 113\n0 4 8 10 2\n10 12",
"output": "4432"
},
{
"input": "56 56 96 105 107\n4 9 10 4 8\n2 1",
"output": "3104"
},
{
"input": "113 107 59 50 56\n3 7 10 6 3\n10 12",
"output": "4586"
},
{
"input": "96 104 9 94 84\n6 10 7 8 3\n14 11",
"output": "4754"
},
{
"input": "98 15 116 43 55\n4 3 0 9 3\n10 7",
"output": "5400"
},
{
"input": "0 26 99 108 35\n0 4 3 0 10\n9 5",
"output": "5388"
},
{
"input": "89 24 51 49 84\n5 6 2 2 9\n2 14",
"output": "4066"
},
{
"input": "57 51 76 45 96\n1 0 4 3 6\n12 15",
"output": "5156"
},
{
"input": "79 112 37 36 116\n2 8 4 7 5\n4 12",
"output": "3872"
},
{
"input": "71 42 60 20 7\n7 1 1 10 6\n1 7",
"output": "5242"
},
{
"input": "86 10 66 80 55\n0 2 5 10 5\n15 6",
"output": "5802"
},
{
"input": "66 109 22 22 62\n3 1 5 4 5\n10 5",
"output": "5854"
},
{
"input": "97 17 43 84 58\n2 8 3 8 6\n10 7",
"output": "5028"
},
{
"input": "109 83 5 114 104\n6 0 3 9 5\n5 2",
"output": "4386"
},
{
"input": "94 18 24 91 105\n2 0 7 10 3\n1 4",
"output": "4118"
},
{
"input": "64 17 86 59 45\n8 0 10 2 2\n4 4",
"output": "5144"
},
{
"input": "70 84 31 57 2\n7 0 0 2 7\n12 5",
"output": "6652"
},
{
"input": "98 118 117 86 4\n2 10 9 7 5\n11 15",
"output": "4476"
},
{
"input": "103 110 101 97 70\n4 2 1 0 5\n7 5",
"output": "4678"
},
{
"input": "78 96 6 97 62\n7 7 9 2 9\n10 3",
"output": "4868"
},
{
"input": "95 28 3 31 115\n1 9 0 7 3\n10 13",
"output": "5132"
},
{
"input": "45 17 116 58 3\n8 8 7 6 4\n3 19",
"output": "3992"
},
{
"input": "19 12 0 113 77\n3 0 10 9 2\n8 6",
"output": "5040"
},
{
"input": "0 0 0 0 0\n0 0 0 0 0\n0 0",
"output": "7500"
},
{
"input": "0 0 0 0 0\n0 0 0 0 0\n20 0",
"output": "9500"
},
{
"input": "119 119 119 119 119\n10 10 10 10 10\n0 20",
"output": "1310"
},
{
"input": "0 0 0 0 0\n10 10 10 10 10\n0 20",
"output": "4150"
},
{
"input": "119 0 0 0 0\n10 0 0 0 0\n5 5",
"output": "7400"
},
{
"input": "0 119 0 0 0\n0 10 0 0 0\n5 5",
"output": "7050"
},
{
"input": "0 0 119 0 0\n0 0 10 0 0\n0 0",
"output": "6450"
},
{
"input": "0 0 0 119 0\n0 0 0 10 0\n5 5",
"output": "6350"
},
{
"input": "0 0 0 0 119\n0 0 0 0 10\n5 5",
"output": "6060"
},
{
"input": "119 0 0 0 0\n2 0 0 0 0\n5 5",
"output": "7412"
},
{
"input": "0 119 0 0 0\n0 2 0 0 0\n5 5",
"output": "7174"
},
{
"input": "0 0 119 0 0\n0 0 2 0 0\n5 5",
"output": "6936"
},
{
"input": "0 0 0 119 0\n0 0 0 2 0\n5 5",
"output": "6698"
},
{
"input": "0 0 0 0 119\n0 0 0 0 2\n5 5",
"output": "6460"
},
{
"input": "119 0 0 0 0\n0 0 0 0 0\n4 9",
"output": "7212"
}
] | 1,590,436,613 | 2,147,483,647 |
Python 3
|
OK
|
TESTS
| 57 | 108 | 307,200 |
m = list(map(int,input().split(' ')))
w = list(map(int,input().split(' ')))
h = list(map(int,input().split(' ')))
x = [500, 1000, 1500, 2000, 2500]
r = []
result = 0
for i in range(5):
r.append(max(0.3 * x[i], ((1 - (m[i]/250)) * x[i]) - 50 * w[i]))
for i in r:
result += i
print(int( result + h[0] * 100 - h[1] * 50))
|
Title: Uncowed Forces
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Kevin Sun has just finished competing in Codeforces Round #334! The round was 120 minutes long and featured five problems with maximum point values of 500, 1000, 1500, 2000, and 2500, respectively. Despite the challenging tasks, Kevin was uncowed and bulldozed through all of them, distinguishing himself from the herd as the best cowmputer scientist in all of Bovinia. Kevin knows his submission time for each problem, the number of wrong submissions that he made on each problem, and his total numbers of successful and unsuccessful hacks. Because Codeforces scoring is complicated, Kevin wants you to write a program to compute his final score.
Codeforces scores are computed as follows: If the maximum point value of a problem is *x*, and Kevin submitted correctly at minute *m* but made *w* wrong submissions, then his score on that problem is . His total score is equal to the sum of his scores for each problem. In addition, Kevin's total score gets increased by 100 points for each successful hack, but gets decreased by 50 points for each unsuccessful hack.
All arithmetic operations are performed with absolute precision and no rounding. It is guaranteed that Kevin's final score is an integer.
Input Specification:
The first line of the input contains five space-separated integers *m*1, *m*2, *m*3, *m*4, *m*5, where *m**i* (0<=≤<=*m**i*<=≤<=119) is the time of Kevin's last submission for problem *i*. His last submission is always correct and gets accepted.
The second line contains five space-separated integers *w*1, *w*2, *w*3, *w*4, *w*5, where *w**i* (0<=≤<=*w**i*<=≤<=10) is Kevin's number of wrong submissions on problem *i*.
The last line contains two space-separated integers *h**s* and *h**u* (0<=≤<=*h**s*,<=*h**u*<=≤<=20), denoting the Kevin's numbers of successful and unsuccessful hacks, respectively.
Output Specification:
Print a single integer, the value of Kevin's final score.
Demo Input:
['20 40 60 80 100\n0 1 2 3 4\n1 0\n', '119 119 119 119 119\n0 0 0 0 0\n10 0\n']
Demo Output:
['4900\n', '4930\n']
Note:
In the second sample, Kevin takes 119 minutes on all of the problems. Therefore, he gets <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/42158dc2bc78cd21fa679530ae9ef8b9ea298d15.png" style="max-width: 100.0%;max-height: 100.0%;"/> of the points on each problem. So his score from solving problems is <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/fdf392d8508500b57f8057ac0c4c892ab5f925a2.png" style="max-width: 100.0%;max-height: 100.0%;"/>. Adding in 10·100 = 1000 points from hacks, his total score becomes 3930 + 1000 = 4930.
|
```python
m = list(map(int,input().split(' ')))
w = list(map(int,input().split(' ')))
h = list(map(int,input().split(' ')))
x = [500, 1000, 1500, 2000, 2500]
r = []
result = 0
for i in range(5):
r.append(max(0.3 * x[i], ((1 - (m[i]/250)) * x[i]) - 50 * w[i]))
for i in r:
result += i
print(int( result + h[0] * 100 - h[1] * 50))
```
| 3 |
|
50 |
A
|
Domino piling
|
PROGRAMMING
| 800 |
[
"greedy",
"math"
] |
A. Domino piling
|
2
|
256
|
You are given a rectangular board of *M*<=×<=*N* squares. Also you are given an unlimited number of standard domino pieces of 2<=×<=1 squares. You are allowed to rotate the pieces. You are asked to place as many dominoes as possible on the board so as to meet the following conditions:
1. Each domino completely covers two squares.
2. No two dominoes overlap.
3. Each domino lies entirely inside the board. It is allowed to touch the edges of the board.
Find the maximum number of dominoes, which can be placed under these restrictions.
|
In a single line you are given two integers *M* and *N* — board sizes in squares (1<=≤<=*M*<=≤<=*N*<=≤<=16).
|
Output one number — the maximal number of dominoes, which can be placed.
|
[
"2 4\n",
"3 3\n"
] |
[
"4\n",
"4\n"
] |
none
| 500 |
[
{
"input": "2 4",
"output": "4"
},
{
"input": "3 3",
"output": "4"
},
{
"input": "1 5",
"output": "2"
},
{
"input": "1 6",
"output": "3"
},
{
"input": "1 15",
"output": "7"
},
{
"input": "1 16",
"output": "8"
},
{
"input": "2 5",
"output": "5"
},
{
"input": "2 6",
"output": "6"
},
{
"input": "2 7",
"output": "7"
},
{
"input": "2 14",
"output": "14"
},
{
"input": "2 15",
"output": "15"
},
{
"input": "1 4",
"output": "2"
},
{
"input": "2 16",
"output": "16"
},
{
"input": "3 5",
"output": "7"
},
{
"input": "3 6",
"output": "9"
},
{
"input": "3 10",
"output": "15"
},
{
"input": "3 14",
"output": "21"
},
{
"input": "3 15",
"output": "22"
},
{
"input": "3 16",
"output": "24"
},
{
"input": "5 7",
"output": "17"
},
{
"input": "16 16",
"output": "128"
},
{
"input": "15 16",
"output": "120"
},
{
"input": "2 3",
"output": "3"
},
{
"input": "15 15",
"output": "112"
},
{
"input": "14 16",
"output": "112"
},
{
"input": "11 13",
"output": "71"
},
{
"input": "5 16",
"output": "40"
},
{
"input": "8 15",
"output": "60"
},
{
"input": "2 2",
"output": "2"
},
{
"input": "3 4",
"output": "6"
},
{
"input": "4 4",
"output": "8"
},
{
"input": "1 1",
"output": "0"
},
{
"input": "1 2",
"output": "1"
},
{
"input": "1 3",
"output": "1"
},
{
"input": "14 15",
"output": "105"
}
] | 1,694,756,092 | 2,147,483,647 |
Python 3
|
WRONG_ANSWER
|
TESTS
| 4 | 62 | 0 |
tablero = str(input())
m = int(tablero[0])
n = int(tablero[2])
if 1 <= m <= n <= 16:
multiplo = m*n
fichas = multiplo // 2
print(fichas)
|
Title: Domino piling
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
You are given a rectangular board of *M*<=×<=*N* squares. Also you are given an unlimited number of standard domino pieces of 2<=×<=1 squares. You are allowed to rotate the pieces. You are asked to place as many dominoes as possible on the board so as to meet the following conditions:
1. Each domino completely covers two squares.
2. No two dominoes overlap.
3. Each domino lies entirely inside the board. It is allowed to touch the edges of the board.
Find the maximum number of dominoes, which can be placed under these restrictions.
Input Specification:
In a single line you are given two integers *M* and *N* — board sizes in squares (1<=≤<=*M*<=≤<=*N*<=≤<=16).
Output Specification:
Output one number — the maximal number of dominoes, which can be placed.
Demo Input:
['2 4\n', '3 3\n']
Demo Output:
['4\n', '4\n']
Note:
none
|
```python
tablero = str(input())
m = int(tablero[0])
n = int(tablero[2])
if 1 <= m <= n <= 16:
multiplo = m*n
fichas = multiplo // 2
print(fichas)
```
| 0 |
855 |
A
|
Tom Riddle's Diary
|
PROGRAMMING
| 800 |
[
"brute force",
"implementation",
"strings"
] | null | null |
Harry Potter is on a mission to destroy You-Know-Who's Horcruxes. The first Horcrux that he encountered in the Chamber of Secrets is Tom Riddle's diary. The diary was with Ginny and it forced her to open the Chamber of Secrets. Harry wants to know the different people who had ever possessed the diary to make sure they are not under its influence.
He has names of *n* people who possessed the diary in order. You need to tell, for each person, if he/she possessed the diary at some point before or not.
Formally, for a name *s**i* in the *i*-th line, output "YES" (without quotes) if there exists an index *j* such that *s**i*<==<=*s**j* and *j*<=<<=*i*, otherwise, output "NO" (without quotes).
|
First line of input contains an integer *n* (1<=≤<=*n*<=≤<=100) — the number of names in the list.
Next *n* lines each contain a string *s**i*, consisting of lowercase English letters. The length of each string is between 1 and 100.
|
Output *n* lines each containing either "YES" or "NO" (without quotes), depending on whether this string was already present in the stream or not.
You can print each letter in any case (upper or lower).
|
[
"6\ntom\nlucius\nginny\nharry\nginny\nharry\n",
"3\na\na\na\n"
] |
[
"NO\nNO\nNO\nNO\nYES\nYES\n",
"NO\nYES\nYES\n"
] |
In test case 1, for *i* = 5 there exists *j* = 3 such that *s*<sub class="lower-index">*i*</sub> = *s*<sub class="lower-index">*j*</sub> and *j* < *i*, which means that answer for *i* = 5 is "YES".
| 500 |
[
{
"input": "6\ntom\nlucius\nginny\nharry\nginny\nharry",
"output": "NO\nNO\nNO\nNO\nYES\nYES"
},
{
"input": "3\na\na\na",
"output": "NO\nYES\nYES"
},
{
"input": "1\nzn",
"output": "NO"
},
{
"input": "9\nliyzmbjwnzryjokufuxcqtzwworjeoxkbaqrujrhdidqdvwdfzilwszgnzglnnbogaclckfnbqovtziuhwvyrqwmskx\nliyzmbjwnzryjokufuxcqtzwworjeoxkbaqrujrhdidqdvwdfzilwszgnzglnnbogaclckfnbqovtziuhwvyrqwmskx\nliyzmbjwnzryjokufuxcqtzwworjeoxkbaqrujrhdidqdvwdfzilwszgnzglnnbogaclckfnbqovtziuhwvyrqwmskx\nhrtm\nssjqvixduertmotgagizamvfucfwtxqnhuowbqbzctgznivehelpcyigwrbbdsxnewfqvcf\nhyrtxvozpbveexfkgalmguozzakitjiwsduqxonb\nwcyxteiwtcyuztaguilqpbiwcwjaiq\nwcyxteiwtcyuztaguilqpbiwcwjaiq\nbdbivqzvhggth",
"output": "NO\nYES\nYES\nNO\nNO\nNO\nNO\nYES\nNO"
},
{
"input": "10\nkkiubdktydpdcbbttwpfdplhhjhrpqmpg\nkkiubdktydpdcbbttwpfdplhhjhrpqmpg\nmvutw\nqooeqoxzxwetlpecqiwgdbogiqqulttysyohwhzxzphvsfmnplizxoebzcvvfyppqbhxjksuzepuezqqzxlfmdanoeaoqmor\nmvutw\nvchawxjoreboqzuklifv\nvchawxjoreboqzuklifv\nnivijte\nrflybruq\nvchawxjoreboqzuklifv",
"output": "NO\nYES\nNO\nNO\nYES\nNO\nYES\nNO\nNO\nYES"
},
{
"input": "1\nz",
"output": "NO"
},
{
"input": "9\nl\ny\nm\nj\nn\nr\nj\nk\nf",
"output": "NO\nNO\nNO\nNO\nNO\nNO\nYES\nNO\nNO"
},
{
"input": "14\nw\na\nh\np\nk\nw\ny\nv\ns\nf\nx\nd\nk\nr",
"output": "NO\nNO\nNO\nNO\nNO\nYES\nNO\nNO\nNO\nNO\nNO\nNO\nYES\nNO"
},
{
"input": "25\np\nk\nu\nl\nf\nt\nc\ns\nq\nd\nb\nq\no\ni\ni\nd\ni\nw\nn\ng\nw\nt\na\ne\ni",
"output": "NO\nNO\nNO\nNO\nNO\nNO\nNO\nNO\nNO\nNO\nNO\nYES\nNO\nNO\nYES\nYES\nYES\nNO\nNO\nNO\nYES\nYES\nNO\nNO\nYES"
},
{
"input": "20\nd\nh\ng\no\np\ne\nt\nj\nv\ni\nt\nh\ns\ni\nw\nf\nx\na\nl\ni",
"output": "NO\nNO\nNO\nNO\nNO\nNO\nNO\nNO\nNO\nNO\nYES\nYES\nNO\nYES\nNO\nNO\nNO\nNO\nNO\nYES"
},
{
"input": "3\nbbbbbbb\nbbbbbbbbb\nbbbbbbbbbbbbbbbbbbbbbbbbbbbb",
"output": "NO\nNO\nNO"
},
{
"input": "2\nab\nba",
"output": "NO\nNO"
},
{
"input": "6\ntom\nlucius\nginnys\nharpy\nginny\nharry",
"output": "NO\nNO\nNO\nNO\nNO\nNO"
},
{
"input": "2\nabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcde\nabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcde",
"output": "NO\nYES"
},
{
"input": "42\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na",
"output": "NO\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES"
}
] | 1,619,584,956 | 2,147,483,647 |
Python 3
|
COMPILATION_ERROR
|
TESTS
| 0 | 0 | 0 |
n = int(input())
i = 0
s= []
while i < n:
name = input()
s.append(name)
for x in s:
if x = name
print(YES\n)
else:
print(NO\n)
i += 1
|
Title: Tom Riddle's Diary
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Harry Potter is on a mission to destroy You-Know-Who's Horcruxes. The first Horcrux that he encountered in the Chamber of Secrets is Tom Riddle's diary. The diary was with Ginny and it forced her to open the Chamber of Secrets. Harry wants to know the different people who had ever possessed the diary to make sure they are not under its influence.
He has names of *n* people who possessed the diary in order. You need to tell, for each person, if he/she possessed the diary at some point before or not.
Formally, for a name *s**i* in the *i*-th line, output "YES" (without quotes) if there exists an index *j* such that *s**i*<==<=*s**j* and *j*<=<<=*i*, otherwise, output "NO" (without quotes).
Input Specification:
First line of input contains an integer *n* (1<=≤<=*n*<=≤<=100) — the number of names in the list.
Next *n* lines each contain a string *s**i*, consisting of lowercase English letters. The length of each string is between 1 and 100.
Output Specification:
Output *n* lines each containing either "YES" or "NO" (without quotes), depending on whether this string was already present in the stream or not.
You can print each letter in any case (upper or lower).
Demo Input:
['6\ntom\nlucius\nginny\nharry\nginny\nharry\n', '3\na\na\na\n']
Demo Output:
['NO\nNO\nNO\nNO\nYES\nYES\n', 'NO\nYES\nYES\n']
Note:
In test case 1, for *i* = 5 there exists *j* = 3 such that *s*<sub class="lower-index">*i*</sub> = *s*<sub class="lower-index">*j*</sub> and *j* < *i*, which means that answer for *i* = 5 is "YES".
|
```python
n = int(input())
i = 0
s= []
while i < n:
name = input()
s.append(name)
for x in s:
if x = name
print(YES\n)
else:
print(NO\n)
i += 1
```
| -1 |
|
802 |
G
|
Fake News (easy)
|
PROGRAMMING
| 800 |
[
"implementation",
"strings"
] | null | null |
As it's the first of April, Heidi is suspecting that the news she reads today are fake, and she does not want to look silly in front of all the contestants. She knows that a newspiece is fake if it contains heidi as a subsequence. Help Heidi assess whether the given piece is true, but please be discreet about it...
|
The first and only line of input contains a single nonempty string *s* of length at most 1000 composed of lowercase letters (a-z).
|
Output YES if the string *s* contains heidi as a subsequence and NO otherwise.
|
[
"abcheaibcdi\n",
"hiedi\n"
] |
[
"YES",
"NO"
] |
A string *s* contains another string *p* as a subsequence if it is possible to delete some characters from *s* and obtain *p*.
| 0 |
[
{
"input": "abcheaibcdi",
"output": "YES"
},
{
"input": "hiedi",
"output": "NO"
},
{
"input": "ihied",
"output": "NO"
},
{
"input": "diehi",
"output": "NO"
},
{
"input": "deiih",
"output": "NO"
},
{
"input": "iheid",
"output": "NO"
},
{
"input": "eihdi",
"output": "NO"
},
{
"input": "ehdii",
"output": "NO"
},
{
"input": "edhii",
"output": "NO"
},
{
"input": "deiih",
"output": "NO"
},
{
"input": "ehdii",
"output": "NO"
},
{
"input": "eufyajkssayhjhqcwxmctecaeepjwmfoscqprpcxsqfwnlgzsmmuwuoruantipholrauvxydfvftwfzhnckxswussvlidcojiciflpvkcxkkcmmvtfvxrkwcpeelwsuzqgamamdtdgzscmikvojfvqehblmjczkvtdeymgertgkwfwfukafqlfdhtedcctixhyetdypswgagrpyto",
"output": "YES"
},
{
"input": "arfbvxgdvqzuloojjrwoyqqbxamxybaqltfimofulusfebodjkwwrgwcppkwiodtpjaraglyplgerrpqjkpoggjmfxhwtqrijpijrcyxnoodvwpyjfpvqaoazllbrpzananbrvvybboedidtuvqquklkpeflfaltukjhzjgiofombhbmqbihgtapswykfvlgdoapjqntvqsaohmbvnphvyyhvhavslamczuqifxnwknkaenqmlvetrqogqxmlptgrmqvxzdxdmwobjesmgxckpmawtioavwdngyiwkzypfnxcovwzdohshwlavwsthdssiadhiwmhpvgkrbezm",
"output": "YES"
},
{
"input": "zcectngbqnejjjtsfrluummmqabzqbyccshjqbrjthzhlbmzjfxugvjouwhumsgrnopiyakfadjnbsesamhynsbfbfunupwbxvohfmpwlcpxhovwpfpciclatgmiufwdvtsqrsdcymvkldpnhfeisrzhyhhlkwdzthgprvkpyldeysvbmcibqkpudyrraqdlxpjecvwcvuiklcrsbgvqasmxmtxqzmawcjtozioqlfflinnxpeexbzloaeqjvglbdeufultpjqexvjjjkzemtzuzmxvawilcqdrcjzpqyhtwfphuonzwkotthsaxrmwtnlmcdylxqcfffyndqeouztluqwlhnkkvzwcfiscikv",
"output": "YES"
},
{
"input": "plqaykgovxkvsiahdbglktdlhcqwelxxmtlyymrsyubxdskvyjkrowvcbpdofpjqspsrgpakdczletxujzlsegepzleipiyycpinzxgwjsgslnxsotouddgfcybozfpjhhocpybfjbaywsehbcfrayvancbrumdfngqytnhihyxnlvilrqyhnxeckprqafofelospffhtwguzjbbjlzbqrtiielbvzutzgpqxosiaqznndgobcluuqlhmffiowkjdlkokehtjdyjvmxsiyxureflmdomerfekxdvtitvwzmdsdzplkpbtafxqfpudnhfqpoiwvjnylanunmagoweobdvfjgepbsymfutrjarlxclhgavpytiiqwvojrptofuvlohzeguxdsrihsbucelhhuedltnnjgzxwyblbqvnoliiydfinzlogbvucwykryzcyibnniggbkdkdcdgcsbvvnavtyhtkanrblpvomvjs",
"output": "YES"
},
{
"input": "fbldqzggeunkpwcfirxanmntbfrudijltoertsdvcvcmbwodbibsrxendzebvxwydpasaqnisrijctsuatihxxygbeovhxjdptdcppkvfytdpjspvrannxavmkmisqtygntxkdlousdypyfkrpzapysfpdbyprufwzhunlsfugojddkmxzinatiwfxdqmgyrnjnxvrclhxyuwxtshoqdjptmeecvgmrlvuwqtmnfnfeeiwcavwnqmyustawbjodzwsqmnjxhpqmgpysierlwbbdzcwprpsexyvreewcmlbvaiytjlxdqdaqftefdlmtmmjcwvfejshymhnouoshdzqcwzxpzupkbcievodzqkqvyjuuxxwepxjalvkzufnveji",
"output": "YES"
},
{
"input": "htsyljgoelbbuipivuzrhmfpkgderqpoprlxdpasxhpmxvaztccldtmujjzjmcpdvsdghzpretlsyyiljhjznseaacruriufswuvizwwuvdioazophhyytvbiogttnnouauxllbdn",
"output": "YES"
},
{
"input": "ikmxzqdzxqlvgeojsnhqzciujslwjyzzexnregabdqztpplosdakimjxmuqccbnwvzbajoiqgdobccwnrwmixohrbdarhoeeelzbpigiybtesybwefpcfx",
"output": "YES"
},
{
"input": "bpvbpjvbdfiodsmahxpcubjxdykesubnypalhypantshkjffmxjmelblqnjdmtaltneuyudyevkgedkqrdmrfeemgpghwrifcwincfixokfgurhqbcfzeajrgkgpwqwsepudxulywowwxzdxkumsicsvnzfxspmjpaixgejeaoyoibegosqoyoydmphfpbutrrewyjecowjckvpcceoamtfbitdneuwqfvnagswlskmsmkhmxyfsrpqwhxzocyffiumcy",
"output": "YES"
},
{
"input": "vllsexwrazvlfvhvrtqeohvzzresjdiuhomfpgqcxpqdevplecuaepixhlijatxzegciizpvyvxuembiplwklahlqibykfideysjygagjbgqkbhdhkatddcwlxboinfuomnpc",
"output": "YES"
},
{
"input": "pnjdwpxmvfoqkjtbhquqcuredrkwqzzfjmdvpnbqtypzdovemhhclkvigjvtprrpzbrbcbatkucaqteuciuozytsptvsskkeplaxdaqmjkmef",
"output": "NO"
},
{
"input": "jpwfhvlxvsdhtuozvlmnfiotrgapgjxtcsgcjnodcztupysvvvmjpzqkpommadppdrykuqkcpzojcwvlogvkddedwbggkrhuvtsvdiokehlkdlnukcufjvqxnikcdawvexxwffxtriqbdmkahxdtygodzohwtdmmuvmatdkvweqvaehaxiefpevkvqpyxsrhtmgjsdfcwzqobibeduooldrmglbinrepmunizheqzvgqvpdskhxfidxfnbisyizhepwyrcykcmjxnkyfjgrqlkixcvysa",
"output": "YES"
},
{
"input": "aftcrvuumeqbfvaqlltscnuhkpcifrrhnutjinxdhhdbzvizlrapzjdatuaynoplgjketupgaejciosofuhcgcjdcucarfvtsofgubtphijciswsvidnvpztlaarydkeqxzwdhfbmullkimerukusbrdnnujviydldrwhdfllsjtziwfeaiqotbiprespmxjulnyunkdtcghrzvhtcychkwatqqmladxpvmvlkzscthylbzkpgwlzfjqwarqvdeyngekqvrhrftpxnkfcibbowvnqdkulcdydspcubwlgoyinpnzgidbgunparnueddzwtzdiavbprbbg",
"output": "YES"
},
{
"input": "oagjghsidigeh",
"output": "NO"
},
{
"input": "chdhzpfzabupskiusjoefrwmjmqkbmdgboicnszkhdrlegeqjsldurmbshijadlwsycselhlnudndpdhcnhruhhvsgbthpruiqfirxkhpqhzhqdfpyozolbionodypfcqfeqbkcgmqkizgeyyelzeoothexcoaahedgrvoemqcwccbvoeqawqeuusyjxmgjkpfwcdttfmwunzuwvsihliexlzygqcgpbdiawfvqukikhbjerjkyhpcknlndaystrgsinghlmekbvhntcpypmchcwoglsmwwdulqneuabuuuvtyrnjxfcgoothalwkzzfxakneusezgnnepkpipzromqubraiggqndliz",
"output": "YES"
},
{
"input": "lgirxqkrkgjcutpqitmffvbujcljkqardlalyigxorscczuzikoylcxenryhskoavymexysvmhbsvhtycjlmzhijpuvcjshyfeycvvcfyzytzoyvxajpqdjtfiatnvxnyeqtfcagfftafllhhjhplbdsrfpctkqpinpdfrtlzyjllfbeffputywcckupyslkbbzpgcnxgbmhtqeqqehpdaokkjtatrhyiuusjhwgiiiikxpzdueasemosmmccoakafgvxduwiuflovhhfhffgnnjhoperhhjtvocpqytjxkmrknnknqeglffhfuplopmktykxuvcmbwpoeisrlyyhdpxfvzseucofyhziuiikihpqheqdyzwigeaqzhxzvporgisxgvhyicqyejovqloibhbunsvsunpvmdckkbuokitdzleilfwutcvuuytpupizinfjrzhxudsmjcjyfcpfgthujjowdwtgbvi",
"output": "YES"
},
{
"input": "uuehrvufgerqbzyzksmqnewacotuimawhlbycdbsmhshrsbqwybbkwjwsrkwptvlbbwjiivqugzrxxwgidrcrhrwsmwgeoleptfamzefgaeyxouxocrpvomjrazmxrnffdwrrmblgdiabdncvfougtmjgvvazasnygdrigbsrieoonirlivfyodvulouslxosswgpdexuldmkdbpdlgutiotvxjyecbrsvbmqxrlcpcipjjncduyqtohlzybvlemmfdeubihwlwqglkgjvnwrbgydcpwklmjeewqklmqdbajqgrpnynaxfvxjzgibqerxyhnxenrmcdqaaeksbzyrcaepozqpetaurlhjuxxhwppuhgoihxdxbmxeiahyaqkbknktlzkheaarjoqqrsyeducvoygwalgarldcdlqogfvsncejssmx",
"output": "YES"
},
{
"input": "iiopulfjxoitgiusqrhgbkiyzinphjtclodbkkydetylvuimkhdkklmyoacmekdvjpuxcrvqnjhqhhbfenlpzpwijtykqziocilvtpqhxuyrphdlamawjuzgjwiebkqyrzyqgtkcrhntjxqmcgkrqcslogjegfrivzidfedeegwbbsopvxvdoididlpypjogxaodtueebbwuwilacunqpozczcgrpaxxrtogpxgfkudtxchoravrrdtimhenwmnafxaruuojduxxglefejycfcyxllfimkszmbrhcwpnwjqgwvzysmlaaifdxfjjpgjmcksiigpanappjdloiolojmcqbnpnjjzaufdpjaknylmyvolhwypygwepmqwpiglpcnpypnudhdzpdvgzosyjthzcwtytxq",
"output": "YES"
}
] | 1,619,412,843 | 2,147,483,647 |
PyPy 3
|
RUNTIME_ERROR
|
TESTS
| 2 | 109 | 2,150,400 |
a = input()
if len(a) < 5:
print("NO")
else:
l = list("heidi")
for x in a:
if x == l[0]:
l.pop(0)
if l == []:
print("YES")
else:
print("NO")
|
Title: Fake News (easy)
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
As it's the first of April, Heidi is suspecting that the news she reads today are fake, and she does not want to look silly in front of all the contestants. She knows that a newspiece is fake if it contains heidi as a subsequence. Help Heidi assess whether the given piece is true, but please be discreet about it...
Input Specification:
The first and only line of input contains a single nonempty string *s* of length at most 1000 composed of lowercase letters (a-z).
Output Specification:
Output YES if the string *s* contains heidi as a subsequence and NO otherwise.
Demo Input:
['abcheaibcdi\n', 'hiedi\n']
Demo Output:
['YES', 'NO']
Note:
A string *s* contains another string *p* as a subsequence if it is possible to delete some characters from *s* and obtain *p*.
|
```python
a = input()
if len(a) < 5:
print("NO")
else:
l = list("heidi")
for x in a:
if x == l[0]:
l.pop(0)
if l == []:
print("YES")
else:
print("NO")
```
| -1 |
|
144 |
A
|
Arrival of the General
|
PROGRAMMING
| 800 |
[
"implementation"
] | null | null |
A Ministry for Defense sent a general to inspect the Super Secret Military Squad under the command of the Colonel SuperDuper. Having learned the news, the colonel ordered to all *n* squad soldiers to line up on the parade ground.
By the military charter the soldiers should stand in the order of non-increasing of their height. But as there's virtually no time to do that, the soldiers lined up in the arbitrary order. However, the general is rather short-sighted and he thinks that the soldiers lined up correctly if the first soldier in the line has the maximum height and the last soldier has the minimum height. Please note that the way other solders are positioned does not matter, including the case when there are several soldiers whose height is maximum or minimum. Only the heights of the first and the last soldier are important.
For example, the general considers the sequence of heights (4, 3, 4, 2, 1, 1) correct and the sequence (4, 3, 1, 2, 2) wrong.
Within one second the colonel can swap any two neighboring soldiers. Help him count the minimum time needed to form a line-up which the general will consider correct.
|
The first input line contains the only integer *n* (2<=≤<=*n*<=≤<=100) which represents the number of soldiers in the line. The second line contains integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=100) the values of the soldiers' heights in the order of soldiers' heights' increasing in the order from the beginning of the line to its end. The numbers are space-separated. Numbers *a*1,<=*a*2,<=...,<=*a**n* are not necessarily different.
|
Print the only integer — the minimum number of seconds the colonel will need to form a line-up the general will like.
|
[
"4\n33 44 11 22\n",
"7\n10 10 58 31 63 40 76\n"
] |
[
"2\n",
"10\n"
] |
In the first sample the colonel will need to swap the first and second soldier and then the third and fourth soldier. That will take 2 seconds. The resulting position of the soldiers is (44, 33, 22, 11).
In the second sample the colonel may swap the soldiers in the following sequence:
1. (10, 10, 58, 31, 63, 40, 76) 1. (10, 58, 10, 31, 63, 40, 76) 1. (10, 58, 10, 31, 63, 76, 40) 1. (10, 58, 10, 31, 76, 63, 40) 1. (10, 58, 31, 10, 76, 63, 40) 1. (10, 58, 31, 76, 10, 63, 40) 1. (10, 58, 31, 76, 63, 10, 40) 1. (10, 58, 76, 31, 63, 10, 40) 1. (10, 76, 58, 31, 63, 10, 40) 1. (76, 10, 58, 31, 63, 10, 40) 1. (76, 10, 58, 31, 63, 40, 10)
| 500 |
[
{
"input": "4\n33 44 11 22",
"output": "2"
},
{
"input": "7\n10 10 58 31 63 40 76",
"output": "10"
},
{
"input": "2\n88 89",
"output": "1"
},
{
"input": "5\n100 95 100 100 88",
"output": "0"
},
{
"input": "7\n48 48 48 48 45 45 45",
"output": "0"
},
{
"input": "10\n68 47 67 29 63 71 71 65 54 56",
"output": "10"
},
{
"input": "15\n77 68 96 60 92 75 61 60 66 79 80 65 60 95 92",
"output": "4"
},
{
"input": "3\n1 2 1",
"output": "1"
},
{
"input": "20\n30 30 30 14 30 14 30 30 30 14 30 14 14 30 14 14 30 14 14 14",
"output": "0"
},
{
"input": "35\n37 41 46 39 47 39 44 47 44 42 44 43 47 39 46 39 38 42 39 37 40 44 41 42 41 42 39 42 36 36 42 36 42 42 42",
"output": "7"
},
{
"input": "40\n99 99 99 99 99 99 99 99 99 99 99 99 99 99 99 99 99 99 99 99 99 99 99 99 98 99 99 99 99 99 99 99 99 100 99 99 99 99 99 99",
"output": "47"
},
{
"input": "50\n48 52 44 54 53 56 62 49 39 41 53 39 40 64 53 50 62 48 40 52 51 48 40 52 61 62 62 61 48 64 55 57 56 40 48 58 41 60 60 56 64 50 64 45 48 45 46 63 59 57",
"output": "50"
},
{
"input": "57\n7 24 17 19 6 19 10 11 12 22 14 5 5 11 13 10 24 19 24 24 24 11 21 20 4 14 24 24 18 13 24 3 20 3 3 3 3 9 3 9 22 22 16 3 3 3 15 11 3 3 8 17 10 13 3 14 13",
"output": "3"
},
{
"input": "65\n58 50 35 44 35 37 36 58 38 36 58 56 56 49 48 56 58 43 40 44 52 44 58 58 57 50 43 35 55 39 38 49 53 56 50 42 41 56 34 57 49 38 34 51 56 38 58 40 53 46 48 34 38 43 49 49 58 56 41 43 44 34 38 48 36",
"output": "3"
},
{
"input": "69\n70 48 49 48 49 71 48 53 55 69 48 53 54 58 53 63 48 48 69 67 72 75 71 75 74 74 57 63 65 60 48 48 65 48 48 51 50 49 62 53 76 68 76 56 76 76 64 76 76 57 61 76 73 51 59 76 65 50 69 50 76 67 76 63 62 74 74 58 73",
"output": "73"
},
{
"input": "75\n70 65 64 71 71 64 71 64 68 71 65 64 65 68 71 66 66 69 68 63 69 65 71 69 68 68 71 67 71 65 65 65 71 71 65 69 63 66 62 67 64 63 62 64 67 65 62 69 62 64 69 62 67 64 67 70 64 63 64 64 69 62 62 64 70 62 62 68 67 69 62 64 66 70 68",
"output": "7"
},
{
"input": "84\n92 95 84 85 94 80 90 86 80 92 95 84 86 83 86 83 93 91 95 92 84 88 82 84 84 84 80 94 93 80 94 80 95 83 85 80 95 95 80 84 86 92 83 81 90 87 81 89 92 93 80 87 90 85 93 85 93 94 93 89 94 83 93 91 80 83 90 94 95 80 95 92 85 84 93 94 94 82 91 95 95 89 85 94",
"output": "15"
},
{
"input": "90\n86 87 72 77 82 71 75 78 61 67 79 90 64 94 94 74 85 87 73 76 71 71 60 69 77 73 76 80 82 57 62 57 57 83 76 72 75 87 72 94 77 85 59 82 86 69 62 80 95 73 83 94 79 85 91 68 85 74 93 95 68 75 89 93 83 78 95 78 83 77 81 85 66 92 63 65 75 78 67 91 77 74 59 86 77 76 90 67 70 64",
"output": "104"
},
{
"input": "91\n94 98 96 94 95 98 98 95 98 94 94 98 95 95 99 97 97 94 95 98 94 98 96 98 96 98 97 95 94 94 94 97 94 96 98 98 98 94 96 95 94 95 97 97 97 98 94 98 96 95 98 96 96 98 94 97 96 98 97 95 97 98 94 95 94 94 97 94 96 97 97 93 94 95 95 94 96 98 97 96 94 98 98 96 96 96 96 96 94 96 97",
"output": "33"
},
{
"input": "92\n44 28 32 29 41 41 36 39 40 39 41 35 41 28 35 27 41 34 28 38 43 43 41 38 27 26 28 36 30 29 39 32 35 35 32 30 39 30 37 27 41 41 28 30 43 31 35 33 36 28 44 40 41 35 31 42 37 38 37 34 39 40 27 40 33 33 44 43 34 33 34 34 35 38 38 37 30 39 35 41 45 42 41 32 33 33 31 30 43 41 43 43",
"output": "145"
},
{
"input": "93\n46 32 52 36 39 30 57 63 63 30 32 44 27 59 46 38 40 45 44 62 35 36 51 48 39 58 36 51 51 51 48 58 59 36 29 35 31 49 64 60 34 38 42 56 33 42 52 31 63 34 45 51 35 45 33 53 33 62 31 38 66 29 51 54 28 61 32 45 57 41 36 34 47 36 31 28 67 48 52 46 32 40 64 58 27 53 43 57 34 66 43 39 26",
"output": "76"
},
{
"input": "94\n56 55 54 31 32 42 46 29 24 54 40 40 20 45 35 56 32 33 51 39 26 56 21 56 51 27 29 39 56 52 54 43 43 55 48 51 44 49 52 49 23 19 19 28 20 26 45 33 35 51 42 36 25 25 38 23 21 35 54 50 41 20 37 28 42 20 22 43 37 34 55 21 24 38 19 41 45 34 19 33 44 54 38 31 23 53 35 32 47 40 39 31 20 34",
"output": "15"
},
{
"input": "95\n57 71 70 77 64 64 76 81 81 58 63 75 81 77 71 71 71 60 70 70 69 67 62 64 78 64 69 62 76 76 57 70 68 77 70 68 73 77 79 73 60 57 69 60 74 65 58 75 75 74 73 73 65 75 72 57 81 62 62 70 67 58 76 57 79 81 68 64 58 77 70 59 79 64 80 58 71 59 81 71 80 64 78 80 78 65 70 68 78 80 57 63 64 76 81",
"output": "11"
},
{
"input": "96\n96 95 95 95 96 97 95 97 96 95 98 96 97 95 98 96 98 96 98 96 98 95 96 95 95 95 97 97 95 95 98 98 95 96 96 95 97 96 98 96 95 97 97 95 97 97 95 94 96 96 97 96 97 97 96 94 94 97 95 95 95 96 95 96 95 97 97 95 97 96 95 94 97 97 97 96 97 95 96 94 94 95 97 94 94 97 97 97 95 97 97 95 94 96 95 95",
"output": "13"
},
{
"input": "97\n14 15 12 12 13 15 12 15 12 12 12 12 12 14 15 15 13 12 15 15 12 12 12 13 14 15 15 13 14 15 14 14 14 14 12 13 12 13 13 12 15 12 13 13 15 12 15 13 12 13 13 13 14 13 12 15 14 13 14 15 13 14 14 13 14 12 15 12 14 12 13 14 15 14 13 15 13 12 15 15 15 13 15 15 13 14 16 16 16 13 15 13 15 14 15 15 15",
"output": "104"
},
{
"input": "98\n37 69 35 70 58 69 36 47 41 63 60 54 49 35 55 50 35 53 52 43 35 41 40 49 38 35 48 70 42 35 35 65 56 54 44 59 59 48 51 49 59 67 35 60 69 35 58 50 35 44 48 69 41 58 44 45 35 47 70 61 49 47 37 39 35 51 44 70 72 65 36 41 63 63 48 66 45 50 50 71 37 52 72 67 72 39 72 39 36 64 48 72 69 49 45 72 72 67",
"output": "100"
},
{
"input": "99\n31 31 16 15 19 31 19 22 29 27 12 22 28 30 25 33 26 25 19 22 34 21 17 33 31 22 16 26 22 30 31 17 13 33 13 17 28 25 18 33 27 22 31 22 13 27 20 22 23 15 24 32 29 13 16 20 32 33 14 33 19 27 16 28 25 17 17 28 18 26 32 33 19 23 30 13 14 23 24 28 14 28 22 20 30 14 24 23 17 29 18 28 29 21 28 18 16 24 32",
"output": "107"
},
{
"input": "100\n37 54 39 29 32 49 21 13 34 21 16 42 34 27 16 26 7 34 51 9 11 27 16 40 36 7 48 52 30 42 42 52 51 11 32 26 6 7 28 54 48 51 6 54 42 20 51 48 46 4 4 31 47 6 9 16 8 23 36 50 49 30 47 37 45 24 48 26 8 50 18 24 27 13 39 7 37 34 5 43 42 19 34 23 52 38 35 6 29 11 53 49 21 29 36 22 45 33 51 22",
"output": "50"
},
{
"input": "100\n41 5 20 23 5 47 28 28 64 5 12 14 34 56 22 48 6 52 39 55 62 40 24 54 39 28 56 27 35 51 14 24 38 10 55 20 39 62 52 2 30 55 49 48 15 23 59 44 31 28 66 29 62 59 31 13 28 12 50 45 41 47 29 27 64 66 14 39 62 22 44 63 24 5 63 17 42 7 25 41 49 33 31 51 63 3 37 66 19 9 2 40 16 45 56 21 34 29 39 61",
"output": "59"
},
{
"input": "100\n66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 66 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95 95",
"output": "99"
},
{
"input": "100\n81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 81 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10 10",
"output": "0"
},
{
"input": "3\n2 1 2",
"output": "1"
},
{
"input": "2\n100 99",
"output": "0"
},
{
"input": "100\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100",
"output": "197"
},
{
"input": "100\n87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87 87",
"output": "0"
},
{
"input": "100\n100 99 98 97 96 95 94 93 92 91 90 89 88 87 86 85 84 83 82 81 80 79 78 77 76 75 74 73 72 71 70 69 68 67 66 65 64 63 62 61 60 59 58 57 56 55 54 53 52 51 50 49 48 47 46 45 44 43 42 41 40 39 38 37 36 35 34 33 32 31 30 29 28 27 26 25 24 23 22 21 20 19 18 17 16 15 14 13 12 11 10 9 8 7 6 5 4 3 2 1",
"output": "0"
},
{
"input": "2\n1 1",
"output": "0"
},
{
"input": "3\n2 2 2",
"output": "0"
},
{
"input": "3\n1 3 2",
"output": "2"
}
] | 1,693,981,874 | 2,147,483,647 |
Python 3
|
WRONG_ANSWER
|
TESTS
| 1 | 60 | 0 |
n = int(input())
heights = list(map(int, input().split()))
max_height = max(heights)
min_height = min(heights)
s = heights.index(max_height) + heights[::-1].index(min_height)
print(s)
|
Title: Arrival of the General
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
A Ministry for Defense sent a general to inspect the Super Secret Military Squad under the command of the Colonel SuperDuper. Having learned the news, the colonel ordered to all *n* squad soldiers to line up on the parade ground.
By the military charter the soldiers should stand in the order of non-increasing of their height. But as there's virtually no time to do that, the soldiers lined up in the arbitrary order. However, the general is rather short-sighted and he thinks that the soldiers lined up correctly if the first soldier in the line has the maximum height and the last soldier has the minimum height. Please note that the way other solders are positioned does not matter, including the case when there are several soldiers whose height is maximum or minimum. Only the heights of the first and the last soldier are important.
For example, the general considers the sequence of heights (4, 3, 4, 2, 1, 1) correct and the sequence (4, 3, 1, 2, 2) wrong.
Within one second the colonel can swap any two neighboring soldiers. Help him count the minimum time needed to form a line-up which the general will consider correct.
Input Specification:
The first input line contains the only integer *n* (2<=≤<=*n*<=≤<=100) which represents the number of soldiers in the line. The second line contains integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=100) the values of the soldiers' heights in the order of soldiers' heights' increasing in the order from the beginning of the line to its end. The numbers are space-separated. Numbers *a*1,<=*a*2,<=...,<=*a**n* are not necessarily different.
Output Specification:
Print the only integer — the minimum number of seconds the colonel will need to form a line-up the general will like.
Demo Input:
['4\n33 44 11 22\n', '7\n10 10 58 31 63 40 76\n']
Demo Output:
['2\n', '10\n']
Note:
In the first sample the colonel will need to swap the first and second soldier and then the third and fourth soldier. That will take 2 seconds. The resulting position of the soldiers is (44, 33, 22, 11).
In the second sample the colonel may swap the soldiers in the following sequence:
1. (10, 10, 58, 31, 63, 40, 76) 1. (10, 58, 10, 31, 63, 40, 76) 1. (10, 58, 10, 31, 63, 76, 40) 1. (10, 58, 10, 31, 76, 63, 40) 1. (10, 58, 31, 10, 76, 63, 40) 1. (10, 58, 31, 76, 10, 63, 40) 1. (10, 58, 31, 76, 63, 10, 40) 1. (10, 58, 76, 31, 63, 10, 40) 1. (10, 76, 58, 31, 63, 10, 40) 1. (76, 10, 58, 31, 63, 10, 40) 1. (76, 10, 58, 31, 63, 40, 10)
|
```python
n = int(input())
heights = list(map(int, input().split()))
max_height = max(heights)
min_height = min(heights)
s = heights.index(max_height) + heights[::-1].index(min_height)
print(s)
```
| 0 |
|
57 |
B
|
Martian Architecture
|
PROGRAMMING
| 1,600 |
[
"implementation"
] |
B. Martian Architecture
|
2
|
256
|
Chris the Rabbit found the traces of an ancient Martian civilization. The brave astronomer managed to see through a small telescope an architecture masterpiece — "A Road to the Sun". The building stands on cubical stones of the same size. The foundation divides the entire "road" into cells, into which the cubical stones are fit tightly. Thus, to any cell of the foundation a coordinate can be assigned. To become the leader of the tribe, a Martian should build a Road to the Sun, that is to build from those cubical stones on a given foundation a stairway. The stairway should be described by the number of stones in the initial coordinate and the coordinates of the stairway's beginning and end. Each following cell in the coordinate's increasing order should contain one cubical stone more than the previous one. At that if the cell has already got stones, they do not count in this building process, the stairways were simply built on them. In other words, let us assume that a stairway is built with the initial coordinate of *l*, the final coordinate of *r* and the number of stones in the initial coordinate *x*. That means that *x* stones will be added in the cell *l*, *x*<=+<=1 stones will be added in the cell *l*<=+<=1, ..., *x*<=+<=*r*<=-<=*l* stones will be added in the cell *r*.
Chris managed to find an ancient manuscript, containing the descriptions of all the stairways. Now he wants to compare the data to be sure that he has really found "A Road to the Sun". For that he chose some road cells and counted the total number of cubical stones that has been accumulated throughout the Martian history and then asked you to count using the manuscript to what the sum should ideally total.
|
The first line contains three space-separated integers: *n*,<=*m*,<=*k* (1<=≤<=*n*,<=*m*<=≤<=105,<=1<=≤<=*k*<=≤<=*min*(*n*,<=100)) which is the number of cells, the number of "Roads to the Sun" and the number of cells in the query correspondingly. Each of the following *m* roads contain three space-separated integers: *a**i*,<=*b**i*,<=*c**i* (1<=≤<=*a**i*<=≤<=*b**i*<=≤<=*n*,<=1<=≤<=*c**i*<=≤<=1000) which are the stairway's description, its beginning, end and the initial cell's height. Then follow a line, containing *k* different space-separated integers *b**i*. All these numbers ranging from 1 to *n* are cells, the number of stones in which interests Chris.
|
You have to print a single number on a single line which is the sum of stones in all the cells Chris is interested in.
Please, do not use %lld specificator to read or write 64-bit integers in C++. It is preffered to use cin (also you may use %I64d).
|
[
"5 2 1\n1 5 1\n2 4 1\n3\n",
"3 2 1\n1 3 1\n1 3 1\n2\n",
"3 2 1\n1 3 1\n1 3 1\n3\n"
] |
[
"5\n",
"4\n",
"6\n"
] |
none
| 1,000 |
[
{
"input": "5 2 1\n1 5 1\n2 4 1\n3",
"output": "5"
},
{
"input": "3 2 1\n1 3 1\n1 3 1\n2",
"output": "4"
},
{
"input": "3 2 1\n1 3 1\n1 3 1\n3",
"output": "6"
},
{
"input": "10 10 3\n6 10 74\n7 9 35\n3 6 63\n2 4 80\n2 10 78\n10 10 13\n4 10 16\n1 2 13\n3 7 17\n4 6 67\n9 8 10",
"output": "635"
},
{
"input": "10 10 6\n5 9 618\n4 8 717\n4 7 815\n7 10 22\n4 6 186\n8 10 205\n2 6 424\n5 10 267\n2 3 512\n1 6 967\n5 8 9 1 3 2",
"output": "11745"
},
{
"input": "10 10 1\n4 9 6\n4 5 5\n1 5 6\n4 5 6\n8 10 5\n7 10 1\n2 3 6\n4 8 4\n5 8 7\n7 8 6\n1",
"output": "6"
},
{
"input": "100 10 19\n75 86 9\n3 16 49\n12 94 58\n67 78 98\n32 54 30\n34 36 46\n39 89 4\n7 75 38\n6 85 73\n11 66 79\n91 69 65 43 82 19 96 50 97 20 58 49 8 83 85 73 70 56 57",
"output": "6666"
},
{
"input": "272 10 10\n16 29 2\n43 269 2\n146 265 2\n198 267 8\n38 140 3\n172 187 1\n2 172 4\n142 230 1\n12 199 5\n15 27 8\n70 3 190 83 81 17 16 148 15 107",
"output": "1994"
},
{
"input": "986 10 20\n249 846 37\n110 335 5\n170 568 34\n399 668 30\n118 832 42\n294 336 62\n335 713 60\n245 671 18\n263 512 61\n94 417 75\n63 641 553 61 818 339 254 784 673 572 932 657 432 257 335 971 223 548 758 79",
"output": "21557"
}
] | 1,447,363,738 | 2,147,483,647 |
Python 3
|
TIME_LIMIT_EXCEEDED
|
TESTS
| 25 | 2,000 | 7,270,400 |
n, m, k = map(int, input().split())
data = [ tuple(map(int, input().split())) for i in range(m) ]
points = list(map(int, input().split()))
counts = [ 0 for i in range(k) ]
for begin, end, initial in data:
for i, point in enumerate(points):
if point < begin or point > end:
continue
counts[i] += initial + point - begin
print(sum(counts))
|
Title: Martian Architecture
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Chris the Rabbit found the traces of an ancient Martian civilization. The brave astronomer managed to see through a small telescope an architecture masterpiece — "A Road to the Sun". The building stands on cubical stones of the same size. The foundation divides the entire "road" into cells, into which the cubical stones are fit tightly. Thus, to any cell of the foundation a coordinate can be assigned. To become the leader of the tribe, a Martian should build a Road to the Sun, that is to build from those cubical stones on a given foundation a stairway. The stairway should be described by the number of stones in the initial coordinate and the coordinates of the stairway's beginning and end. Each following cell in the coordinate's increasing order should contain one cubical stone more than the previous one. At that if the cell has already got stones, they do not count in this building process, the stairways were simply built on them. In other words, let us assume that a stairway is built with the initial coordinate of *l*, the final coordinate of *r* and the number of stones in the initial coordinate *x*. That means that *x* stones will be added in the cell *l*, *x*<=+<=1 stones will be added in the cell *l*<=+<=1, ..., *x*<=+<=*r*<=-<=*l* stones will be added in the cell *r*.
Chris managed to find an ancient manuscript, containing the descriptions of all the stairways. Now he wants to compare the data to be sure that he has really found "A Road to the Sun". For that he chose some road cells and counted the total number of cubical stones that has been accumulated throughout the Martian history and then asked you to count using the manuscript to what the sum should ideally total.
Input Specification:
The first line contains three space-separated integers: *n*,<=*m*,<=*k* (1<=≤<=*n*,<=*m*<=≤<=105,<=1<=≤<=*k*<=≤<=*min*(*n*,<=100)) which is the number of cells, the number of "Roads to the Sun" and the number of cells in the query correspondingly. Each of the following *m* roads contain three space-separated integers: *a**i*,<=*b**i*,<=*c**i* (1<=≤<=*a**i*<=≤<=*b**i*<=≤<=*n*,<=1<=≤<=*c**i*<=≤<=1000) which are the stairway's description, its beginning, end and the initial cell's height. Then follow a line, containing *k* different space-separated integers *b**i*. All these numbers ranging from 1 to *n* are cells, the number of stones in which interests Chris.
Output Specification:
You have to print a single number on a single line which is the sum of stones in all the cells Chris is interested in.
Please, do not use %lld specificator to read or write 64-bit integers in C++. It is preffered to use cin (also you may use %I64d).
Demo Input:
['5 2 1\n1 5 1\n2 4 1\n3\n', '3 2 1\n1 3 1\n1 3 1\n2\n', '3 2 1\n1 3 1\n1 3 1\n3\n']
Demo Output:
['5\n', '4\n', '6\n']
Note:
none
|
```python
n, m, k = map(int, input().split())
data = [ tuple(map(int, input().split())) for i in range(m) ]
points = list(map(int, input().split()))
counts = [ 0 for i in range(k) ]
for begin, end, initial in data:
for i, point in enumerate(points):
if point < begin or point > end:
continue
counts[i] += initial + point - begin
print(sum(counts))
```
| 0 |
638 |
A
|
Home Numbers
|
PROGRAMMING
| 1,100 |
[
"*special",
"constructive algorithms",
"math"
] | null | null |
The main street of Berland is a straight line with *n* houses built along it (*n* is an even number). The houses are located at both sides of the street. The houses with odd numbers are at one side of the street and are numbered from 1 to *n*<=-<=1 in the order from the beginning of the street to the end (in the picture: from left to right). The houses with even numbers are at the other side of the street and are numbered from 2 to *n* in the order from the end of the street to its beginning (in the picture: from right to left). The corresponding houses with even and odd numbers are strictly opposite each other, that is, house 1 is opposite house *n*, house 3 is opposite house *n*<=-<=2, house 5 is opposite house *n*<=-<=4 and so on.
Vasya needs to get to house number *a* as quickly as possible. He starts driving from the beginning of the street and drives his car to house *a*. To get from the beginning of the street to houses number 1 and *n*, he spends exactly 1 second. He also spends exactly one second to drive the distance between two neighbouring houses. Vasya can park at any side of the road, so the distance between the beginning of the street at the houses that stand opposite one another should be considered the same.
Your task is: find the minimum time Vasya needs to reach house *a*.
|
The first line of the input contains two integers, *n* and *a* (1<=≤<=*a*<=≤<=*n*<=≤<=100<=000) — the number of houses on the street and the number of the house that Vasya needs to reach, correspondingly. It is guaranteed that number *n* is even.
|
Print a single integer — the minimum time Vasya needs to get from the beginning of the street to house *a*.
|
[
"4 2\n",
"8 5\n"
] |
[
"2\n",
"3\n"
] |
In the first sample there are only four houses on the street, two houses at each side. House 2 will be the last at Vasya's right.
The second sample corresponds to picture with *n* = 8. House 5 is the one before last at Vasya's left.
| 500 |
[
{
"input": "4 2",
"output": "2"
},
{
"input": "8 5",
"output": "3"
},
{
"input": "2 1",
"output": "1"
},
{
"input": "2 2",
"output": "1"
},
{
"input": "10 1",
"output": "1"
},
{
"input": "10 10",
"output": "1"
},
{
"input": "100000 100000",
"output": "1"
},
{
"input": "100000 2",
"output": "50000"
},
{
"input": "100000 3",
"output": "2"
},
{
"input": "100000 99999",
"output": "50000"
},
{
"input": "100 100",
"output": "1"
},
{
"input": "3000 34",
"output": "1484"
},
{
"input": "2000 1",
"output": "1"
},
{
"input": "100000 1",
"output": "1"
},
{
"input": "24842 1038",
"output": "11903"
},
{
"input": "1628 274",
"output": "678"
},
{
"input": "16186 337",
"output": "169"
},
{
"input": "24562 2009",
"output": "1005"
},
{
"input": "9456 3443",
"output": "1722"
},
{
"input": "5610 332",
"output": "2640"
},
{
"input": "1764 1288",
"output": "239"
},
{
"input": "28588 13902",
"output": "7344"
},
{
"input": "92480 43074",
"output": "24704"
},
{
"input": "40022 26492",
"output": "6766"
},
{
"input": "85766 64050",
"output": "10859"
},
{
"input": "67808 61809",
"output": "30905"
},
{
"input": "80124 68695",
"output": "34348"
},
{
"input": "95522 91716",
"output": "1904"
},
{
"input": "7752 2915",
"output": "1458"
},
{
"input": "5094 5058",
"output": "19"
},
{
"input": "6144 4792",
"output": "677"
},
{
"input": "34334 20793",
"output": "10397"
},
{
"input": "23538 10243",
"output": "5122"
},
{
"input": "9328 7933",
"output": "3967"
},
{
"input": "11110 9885",
"output": "4943"
},
{
"input": "26096 2778",
"output": "11660"
},
{
"input": "75062 5323",
"output": "2662"
},
{
"input": "94790 7722",
"output": "43535"
},
{
"input": "90616 32240",
"output": "29189"
},
{
"input": "96998 8992",
"output": "44004"
},
{
"input": "95130 19219",
"output": "9610"
},
{
"input": "92586 8812",
"output": "41888"
},
{
"input": "3266 3044",
"output": "112"
},
{
"input": "5026 4697",
"output": "2349"
},
{
"input": "3044 2904",
"output": "71"
},
{
"input": "6022 5396",
"output": "314"
},
{
"input": "31270 25522",
"output": "2875"
},
{
"input": "82156 75519",
"output": "37760"
},
{
"input": "34614 27913",
"output": "13957"
},
{
"input": "88024 61143",
"output": "30572"
},
{
"input": "91870 55672",
"output": "18100"
},
{
"input": "95718 4868",
"output": "45426"
},
{
"input": "99564 358",
"output": "49604"
},
{
"input": "89266 13047",
"output": "6524"
},
{
"input": "90904 16455",
"output": "8228"
},
{
"input": "94750 13761",
"output": "6881"
},
{
"input": "100000 23458",
"output": "38272"
},
{
"input": "100000 23457",
"output": "11729"
},
{
"input": "59140 24272",
"output": "17435"
},
{
"input": "9860 8516",
"output": "673"
},
{
"input": "25988 2733",
"output": "1367"
},
{
"input": "9412 5309",
"output": "2655"
},
{
"input": "25540 23601",
"output": "11801"
},
{
"input": "76260 6050",
"output": "35106"
},
{
"input": "92388 39118",
"output": "26636"
},
{
"input": "8516 5495",
"output": "2748"
},
{
"input": "91940 37847",
"output": "18924"
},
{
"input": "30518 286",
"output": "15117"
},
{
"input": "46646 19345",
"output": "9673"
}
] | 1,488,708,395 | 2,147,483,647 |
Python 3
|
OK
|
TESTS
| 69 | 62 | 4,608,000 |
n, a = map(int, input().split())
if a%2==0:
print((n-a)//2 + 1)
else:
print((a-1)//2+1)
|
Title: Home Numbers
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
The main street of Berland is a straight line with *n* houses built along it (*n* is an even number). The houses are located at both sides of the street. The houses with odd numbers are at one side of the street and are numbered from 1 to *n*<=-<=1 in the order from the beginning of the street to the end (in the picture: from left to right). The houses with even numbers are at the other side of the street and are numbered from 2 to *n* in the order from the end of the street to its beginning (in the picture: from right to left). The corresponding houses with even and odd numbers are strictly opposite each other, that is, house 1 is opposite house *n*, house 3 is opposite house *n*<=-<=2, house 5 is opposite house *n*<=-<=4 and so on.
Vasya needs to get to house number *a* as quickly as possible. He starts driving from the beginning of the street and drives his car to house *a*. To get from the beginning of the street to houses number 1 and *n*, he spends exactly 1 second. He also spends exactly one second to drive the distance between two neighbouring houses. Vasya can park at any side of the road, so the distance between the beginning of the street at the houses that stand opposite one another should be considered the same.
Your task is: find the minimum time Vasya needs to reach house *a*.
Input Specification:
The first line of the input contains two integers, *n* and *a* (1<=≤<=*a*<=≤<=*n*<=≤<=100<=000) — the number of houses on the street and the number of the house that Vasya needs to reach, correspondingly. It is guaranteed that number *n* is even.
Output Specification:
Print a single integer — the minimum time Vasya needs to get from the beginning of the street to house *a*.
Demo Input:
['4 2\n', '8 5\n']
Demo Output:
['2\n', '3\n']
Note:
In the first sample there are only four houses on the street, two houses at each side. House 2 will be the last at Vasya's right.
The second sample corresponds to picture with *n* = 8. House 5 is the one before last at Vasya's left.
|
```python
n, a = map(int, input().split())
if a%2==0:
print((n-a)//2 + 1)
else:
print((a-1)//2+1)
```
| 3 |
|
334 |
B
|
Eight Point Sets
|
PROGRAMMING
| 1,400 |
[
"sortings"
] | null | null |
Gerald is very particular to eight point sets. He thinks that any decent eight point set must consist of all pairwise intersections of three distinct integer vertical straight lines and three distinct integer horizontal straight lines, except for the average of these nine points. In other words, there must be three integers *x*1,<=*x*2,<=*x*3 and three more integers *y*1,<=*y*2,<=*y*3, such that *x*1<=<<=*x*2<=<<=*x*3, *y*1<=<<=*y*2<=<<=*y*3 and the eight point set consists of all points (*x**i*,<=*y**j*) (1<=≤<=*i*,<=*j*<=≤<=3), except for point (*x*2,<=*y*2).
You have a set of eight points. Find out if Gerald can use this set?
|
The input consists of eight lines, the *i*-th line contains two space-separated integers *x**i* and *y**i* (0<=≤<=*x**i*,<=*y**i*<=≤<=106). You do not have any other conditions for these points.
|
In a single line print word "respectable", if the given set of points corresponds to Gerald's decency rules, and "ugly" otherwise.
|
[
"0 0\n0 1\n0 2\n1 0\n1 2\n2 0\n2 1\n2 2\n",
"0 0\n1 0\n2 0\n3 0\n4 0\n5 0\n6 0\n7 0\n",
"1 1\n1 2\n1 3\n2 1\n2 2\n2 3\n3 1\n3 2\n"
] |
[
"respectable\n",
"ugly\n",
"ugly\n"
] |
none
| 1,000 |
[
{
"input": "0 0\n0 1\n0 2\n1 0\n1 2\n2 0\n2 1\n2 2",
"output": "respectable"
},
{
"input": "0 0\n1 0\n2 0\n3 0\n4 0\n5 0\n6 0\n7 0",
"output": "ugly"
},
{
"input": "1 1\n1 2\n1 3\n2 1\n2 2\n2 3\n3 1\n3 2",
"output": "ugly"
},
{
"input": "0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0",
"output": "ugly"
},
{
"input": "1000000 1000000\n1000000 999999\n1000000 999998\n999999 1000000\n999999 999998\n999998 1000000\n999998 999999\n999998 999998",
"output": "respectable"
},
{
"input": "0 0\n1 0\n0 1\n1 1\n0 2\n1 2\n0 3\n1 3",
"output": "ugly"
},
{
"input": "0 0\n2 1\n1 0\n0 2\n2 2\n1 0\n2 1\n0 2",
"output": "ugly"
},
{
"input": "0 0\n2 1\n1 0\n0 2\n2 2\n1 0\n2 1\n0 2",
"output": "ugly"
},
{
"input": "791649 383826\n10864 260573\n504506 185571\n899991 511500\n503197 876976\n688727 569035\n343255 961333\n439355 759581",
"output": "ugly"
},
{
"input": "750592 335292\n226387 434036\n299976 154633\n593197 600998\n62014 689355\n566268 571630\n381455 222817\n50555 288617",
"output": "ugly"
},
{
"input": "716334 42808\n211710 645370\n515258 96837\n14392 766713\n439265 939607\n430602 918570\n845044 187545\n957977 441674",
"output": "ugly"
},
{
"input": "337873 813442\n995185 863182\n375545 263618\n310042 130019\n358572 560779\n305725 729179\n377381 267545\n41376 312626",
"output": "ugly"
},
{
"input": "803784 428886\n995691 328351\n211844 386054\n375491 74073\n692402 660275\n366073 536431\n485832 941417\n96032 356022",
"output": "ugly"
},
{
"input": "999231 584954\n246553 267441\n697080 920011\n173593 403511\n58535 101909\n131124 924182\n779830 204560\n684576 533111",
"output": "ugly"
},
{
"input": "666888 741208\n685852 578759\n211123 826453\n244759 601804\n670436 748132\n976425 387060\n587850 804554\n430242 805528",
"output": "ugly"
},
{
"input": "71768 834717\n13140 834717\n13140 991083\n880763 386898\n71768 386898\n880763 991083\n880763 834717\n13140 386898",
"output": "ugly"
},
{
"input": "941532 913025\n941532 862399\n686271 913025\n686271 862399\n686271 461004\n941532 461004\n908398 862399\n908398 913025",
"output": "ugly"
},
{
"input": "251515 680236\n761697 669947\n251515 669947\n761697 680236\n251515 476629\n761697 476629\n453296 669947\n453296 476629",
"output": "ugly"
},
{
"input": "612573 554036\n195039 655769\n472305 655769\n612573 655769\n195039 160740\n472305 160740\n472305 554036\n612573 160740",
"output": "ugly"
},
{
"input": "343395 788566\n171702 674699\n171702 788566\n971214 788566\n343395 9278\n971214 9278\n343395 674699\n971214 674699",
"output": "ugly"
},
{
"input": "38184 589856\n281207 447136\n281207 42438\n38184 42438\n38184 447136\n880488 589856\n281207 589856\n880488 42438",
"output": "ugly"
},
{
"input": "337499 89260\n337499 565883\n603778 89260\n603778 565883\n234246 89260\n603778 17841\n337499 17841\n234246 17841",
"output": "ugly"
},
{
"input": "180952 311537\n180952 918548\n126568 918548\n180952 268810\n732313 918548\n126568 311537\n126568 268810\n732313 311537",
"output": "ugly"
},
{
"input": "323728 724794\n265581 165113\n323728 146453\n265581 146453\n591097 146453\n265581 724794\n323728 165113\n591097 165113",
"output": "ugly"
},
{
"input": "642921 597358\n922979 597358\n127181 616833\n642921 828316\n922979 828316\n127181 597358\n922979 616833\n127181 828316",
"output": "respectable"
},
{
"input": "69586 260253\n74916 203798\n985457 203798\n74916 943932\n985457 943932\n69586 943932\n985457 260253\n69586 203798",
"output": "respectable"
},
{
"input": "57930 637387\n883991 573\n57930 573\n57930 499963\n399327 573\n399327 637387\n883991 637387\n883991 499963",
"output": "respectable"
},
{
"input": "52820 216139\n52820 999248\n290345 216139\n290345 999248\n308639 216139\n308639 999248\n52820 477113\n308639 477113",
"output": "respectable"
},
{
"input": "581646 464672\n493402 649074\n581646 649074\n214619 649074\n581646 252709\n214619 252709\n214619 464672\n493402 252709",
"output": "respectable"
},
{
"input": "787948 77797\n421941 615742\n421941 77797\n400523 77797\n400523 111679\n787948 615742\n400523 615742\n787948 111679",
"output": "respectable"
},
{
"input": "583956 366985\n759621 567609\n756846 567609\n759621 176020\n583956 567609\n583956 176020\n759621 366985\n756846 176020",
"output": "respectable"
},
{
"input": "0 50000\n0 0\n0 1000000\n50000 0\n50000 1000000\n1000000 0\n1000000 50000\n1000000 1000000",
"output": "respectable"
},
{
"input": "0 8\n0 9\n0 10\n1 8\n3 8\n3 8\n3 9\n3 10",
"output": "ugly"
},
{
"input": "0 1\n0 1\n0 2\n1 1\n1 2\n2 1\n2 1\n2 2",
"output": "ugly"
},
{
"input": "1 2\n1 3\n1 4\n2 2\n2 4\n4 2\n4 2\n4 4",
"output": "ugly"
},
{
"input": "0 0\n0 1\n0 2\n0 0\n1 2\n2 0\n2 1\n2 2",
"output": "ugly"
},
{
"input": "0 0\n0 0\n0 0\n1 1\n1 1\n2 2\n2 2\n2 2",
"output": "ugly"
},
{
"input": "0 0\n0 0\n0 2\n1 1\n1 2\n2 0\n2 1\n2 2",
"output": "ugly"
},
{
"input": "0 0\n0 1\n0 3\n1 0\n1 3\n2 0\n2 2\n2 3",
"output": "ugly"
},
{
"input": "0 0\n0 1\n0 2\n1 0\n1 2\n3 0\n3 1\n3 2",
"output": "respectable"
},
{
"input": "1 1\n1 2\n1 5\n2 1\n2 5\n5 1\n5 2\n5 5",
"output": "respectable"
},
{
"input": "1 1\n1 2\n1 2\n2 3\n2 1\n3 3\n3 1\n3 3",
"output": "ugly"
},
{
"input": "0 0\n0 0\n1 0\n0 1\n2 1\n1 2\n2 2\n2 2",
"output": "ugly"
},
{
"input": "1 1\n1 1\n1 3\n2 1\n2 3\n3 2\n3 2\n3 3",
"output": "ugly"
},
{
"input": "1 0\n1 0\n1 0\n2 3\n2 3\n3 4\n3 4\n3 4",
"output": "ugly"
}
] | 1,606,494,057 | 2,147,483,647 |
Python 3
|
RUNTIME_ERROR
|
TESTS
| 5 | 218 | 307,200 |
a = []
x = []
y = []
for i in range(0, 8):
[n1, n2] = map(int, input().split())
a.append([n1, n2])
for i in range(0, 8):
x.append(a[i][0])
y.append(a[i][1])
dict = {}
for i in range(0, 8):
curX = x[i]
if(curX in dict):
dict[curX] = dict[curX] + 1
else:
dict[curX] = 1
for i in range(0, 8):
curY = y[i]
dict[curY] = dict[curY] + 1
countKeys = len(dict.keys())
if(countKeys != 3):
print("ugly")
exit()
for i, (key, value) in enumerate(dict.items()):
if(i == 1 and dict[key] != 4):
print("ugly")
exit()
if(i != 1 and dict[key] != 6):
print("ugly")
exit()
print("respectable")
|
Title: Eight Point Sets
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Gerald is very particular to eight point sets. He thinks that any decent eight point set must consist of all pairwise intersections of three distinct integer vertical straight lines and three distinct integer horizontal straight lines, except for the average of these nine points. In other words, there must be three integers *x*1,<=*x*2,<=*x*3 and three more integers *y*1,<=*y*2,<=*y*3, such that *x*1<=<<=*x*2<=<<=*x*3, *y*1<=<<=*y*2<=<<=*y*3 and the eight point set consists of all points (*x**i*,<=*y**j*) (1<=≤<=*i*,<=*j*<=≤<=3), except for point (*x*2,<=*y*2).
You have a set of eight points. Find out if Gerald can use this set?
Input Specification:
The input consists of eight lines, the *i*-th line contains two space-separated integers *x**i* and *y**i* (0<=≤<=*x**i*,<=*y**i*<=≤<=106). You do not have any other conditions for these points.
Output Specification:
In a single line print word "respectable", if the given set of points corresponds to Gerald's decency rules, and "ugly" otherwise.
Demo Input:
['0 0\n0 1\n0 2\n1 0\n1 2\n2 0\n2 1\n2 2\n', '0 0\n1 0\n2 0\n3 0\n4 0\n5 0\n6 0\n7 0\n', '1 1\n1 2\n1 3\n2 1\n2 2\n2 3\n3 1\n3 2\n']
Demo Output:
['respectable\n', 'ugly\n', 'ugly\n']
Note:
none
|
```python
a = []
x = []
y = []
for i in range(0, 8):
[n1, n2] = map(int, input().split())
a.append([n1, n2])
for i in range(0, 8):
x.append(a[i][0])
y.append(a[i][1])
dict = {}
for i in range(0, 8):
curX = x[i]
if(curX in dict):
dict[curX] = dict[curX] + 1
else:
dict[curX] = 1
for i in range(0, 8):
curY = y[i]
dict[curY] = dict[curY] + 1
countKeys = len(dict.keys())
if(countKeys != 3):
print("ugly")
exit()
for i, (key, value) in enumerate(dict.items()):
if(i == 1 and dict[key] != 4):
print("ugly")
exit()
if(i != 1 and dict[key] != 6):
print("ugly")
exit()
print("respectable")
```
| -1 |
|
897 |
A
|
Scarborough Fair
|
PROGRAMMING
| 800 |
[
"implementation"
] | null | null |
Parsley, sage, rosemary and thyme.
Remember me to one who lives there.
He once was the true love of mine.
Willem is taking the girl to the highest building in island No.28, however, neither of them knows how to get there.
Willem asks his friend, Grick for directions, Grick helped them, and gave them a task.
Although the girl wants to help, Willem insists on doing it by himself.
Grick gave Willem a string of length *n*.
Willem needs to do *m* operations, each operation has four parameters *l*,<=*r*,<=*c*1,<=*c*2, which means that all symbols *c*1 in range [*l*,<=*r*] (from *l*-th to *r*-th, including *l* and *r*) are changed into *c*2. String is 1-indexed.
Grick wants to know the final string after all the *m* operations.
|
The first line contains two integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=100).
The second line contains a string *s* of length *n*, consisting of lowercase English letters.
Each of the next *m* lines contains four parameters *l*,<=*r*,<=*c*1,<=*c*2 (1<=≤<=*l*<=≤<=*r*<=≤<=*n*, *c*1,<=*c*2 are lowercase English letters), separated by space.
|
Output string *s* after performing *m* operations described above.
|
[
"3 1\nioi\n1 1 i n\n",
"5 3\nwxhak\n3 3 h x\n1 5 x a\n1 3 w g\n"
] |
[
"noi",
"gaaak"
] |
For the second example:
After the first operation, the string is wxxak.
After the second operation, the string is waaak.
After the third operation, the string is gaaak.
| 500 |
[
{
"input": "3 1\nioi\n1 1 i n",
"output": "noi"
},
{
"input": "5 3\nwxhak\n3 3 h x\n1 5 x a\n1 3 w g",
"output": "gaaak"
},
{
"input": "9 51\nbhfbdcgff\n2 3 b b\n2 8 e f\n3 8 g f\n5 7 d a\n1 5 e b\n3 4 g b\n6 7 c d\n3 6 e g\n3 6 e h\n5 6 a e\n7 9 a c\n4 9 a h\n3 7 c b\n6 9 b g\n1 7 h b\n4 5 a e\n3 9 f a\n1 2 c h\n4 8 a c\n3 5 e d\n3 4 g f\n2 3 d h\n2 3 d e\n1 7 d g\n2 6 e g\n2 3 d g\n5 5 h h\n2 8 g d\n8 9 a f\n5 9 c e\n1 7 f d\n1 6 e e\n5 7 c a\n8 9 b b\n2 6 e b\n6 6 g h\n1 2 b b\n1 5 a f\n5 8 f h\n1 5 e g\n3 9 f h\n6 8 g a\n4 6 h g\n1 5 f a\n5 6 a c\n4 8 e d\n1 4 d g\n7 8 b f\n5 6 h b\n3 9 c e\n1 9 b a",
"output": "aahaddddh"
},
{
"input": "28 45\ndcbbaddjhbeefjadjchgkhgggfha\n10 25 c a\n13 19 a f\n12 28 e d\n12 27 e a\n9 20 b e\n7 17 g d\n22 26 j j\n8 16 c g\n14 16 a d\n3 10 f c\n10 26 d b\n8 17 i e\n10 19 d i\n6 21 c j\n7 22 b k\n17 19 a i\n4 18 j k\n8 25 a g\n10 27 j e\n9 18 g d\n16 23 h a\n17 26 k e\n8 16 h f\n1 15 d f\n22 28 k k\n11 20 c k\n6 11 b h\n17 17 e i\n15 22 g h\n8 18 c f\n4 16 e a\n8 25 b c\n6 24 d g\n5 9 f j\n12 19 i h\n4 25 e f\n15 25 c j\n15 27 e e\n11 20 b f\n19 27 e k\n2 21 d a\n9 27 k e\n14 24 b a\n3 6 i g\n2 26 k f",
"output": "fcbbajjfjaaefefehfahfagggfha"
},
{
"input": "87 5\nnfinedeojadjmgafnaogekfjkjfncnliagfchjfcmellgigjjcaaoeakdolchjcecljdeblmheimkibkgdkcdml\n47 56 a k\n51 81 o d\n5 11 j h\n48 62 j d\n16 30 k m",
"output": "nfinedeohadjmgafnaogemfjmjfncnliagfchjfcmellgigddckkdekkddlchdcecljdeblmheimkibkgdkcdml"
},
{
"input": "5 16\nacfbb\n1 2 e f\n2 5 a f\n2 3 b e\n4 4 f a\n2 3 f a\n1 2 b e\n4 5 c d\n2 4 e c\n1 4 e a\n1 3 d c\n3 5 e b\n3 5 e b\n2 2 e d\n1 3 e c\n3 3 a e\n1 5 a a",
"output": "acebb"
},
{
"input": "94 13\nbcaaaaaaccacddcdaacbdaabbcbaddbccbccbbbddbadddcccbddadddaadbdababadaacdcdbcdadabdcdcbcbcbcbbcd\n52 77 d d\n21 92 d b\n45 48 c b\n20 25 d a\n57 88 d b\n3 91 b d\n64 73 a a\n5 83 b d\n2 69 c c\n28 89 a b\n49 67 c b\n41 62 a c\n49 87 b c",
"output": "bcaaaaaaccacddcdaacddaaddcdbdddccdccddddddbdddddcdddcdddccdddcdcdcdcccdcddcdcdcddcdcdcdcdcdbcd"
},
{
"input": "67 39\nacbcbccccbabaabcabcaaaaaaccbcbbcbaaaacbbcccbcbabbcacccbbabbabbabaac\n4 36 a b\n25 38 a a\n3 44 b c\n35 57 b a\n4 8 a c\n20 67 c a\n30 66 b b\n27 40 a a\n2 56 a b\n10 47 c a\n22 65 c b\n29 42 a b\n1 46 c b\n57 64 b c\n20 29 b a\n14 51 c a\n12 55 b b\n20 20 a c\n2 57 c a\n22 60 c b\n16 51 c c\n31 64 a c\n17 30 c a\n23 36 c c\n28 67 a c\n37 40 a c\n37 50 b c\n29 48 c b\n2 34 b c\n21 53 b a\n26 63 a c\n23 28 c a\n51 56 c b\n32 61 b b\n64 67 b b\n21 67 b c\n8 53 c c\n40 62 b b\n32 38 c c",
"output": "accccccccaaaaaaaaaaaaaaaaaaaccccccccccccccccccccccccccccccccccccccc"
},
{
"input": "53 33\nhhcbhfafeececbhadfbdbehdfacfchbhdbfebdfeghebfcgdhehfh\n27 41 h g\n18 35 c b\n15 46 h f\n48 53 e g\n30 41 b c\n12 30 b f\n10 37 e f\n18 43 a h\n10 52 d a\n22 48 c e\n40 53 f d\n7 12 b h\n12 51 f a\n3 53 g a\n19 41 d h\n22 29 b h\n2 30 a b\n26 28 e h\n25 35 f a\n19 31 h h\n44 44 d e\n19 22 e c\n29 44 d h\n25 33 d h\n3 53 g c\n18 44 h b\n19 28 f e\n3 22 g h\n8 17 c a\n37 51 d d\n3 28 e h\n27 50 h h\n27 46 f b",
"output": "hhcbhfbfhfababbbbbbbbbbbbbbbbbeaaeaaeaaeabebdeaahahdh"
},
{
"input": "83 10\nfhbecdgadecabbbecedcgfdcefcbgechbedagecgdgfgdaahchdgchbeaedgafdefecdchceececfcdhcdh\n9 77 e e\n26 34 b g\n34 70 b a\n40 64 e g\n33 78 h f\n14 26 a a\n17 70 d g\n56 65 a c\n8 41 d c\n11 82 c b",
"output": "fhbecdgacebabbbebegbgfgbefbggebhgegagebgggfggaafbfggbfagbgggbfggfebgbfbeebebfbdhbdh"
},
{
"input": "1 4\ne\n1 1 c e\n1 1 e a\n1 1 e c\n1 1 d a",
"output": "a"
},
{
"input": "71 21\naaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa\n61 61 a a\n32 56 a a\n10 67 a a\n7 32 a a\n26 66 a a\n41 55 a a\n49 55 a a\n4 61 a a\n53 59 a a\n37 58 a a\n7 63 a a\n39 40 a a\n51 64 a a\n27 37 a a\n22 71 a a\n4 45 a a\n7 8 a a\n43 46 a a\n19 28 a a\n51 54 a a\n14 67 a a",
"output": "aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa"
},
{
"input": "30 4\neaaddabedcbbcccddbabdecadcecce\n2 17 c a\n16 29 e e\n16 21 c b\n7 11 b c",
"output": "eaaddacedacbaaaddbabdecadcecce"
},
{
"input": "48 30\naaaabaabbaababbbaabaabaababbabbbaabbbaabaaaaaaba\n3 45 a b\n1 14 a a\n15 32 a b\n37 47 a b\n9 35 a b\n36 39 b b\n6 26 a b\n36 44 a a\n28 44 b a\n29 31 b a\n20 39 a a\n45 45 a b\n21 32 b b\n7 43 a b\n14 48 a b\n14 33 a b\n39 44 a a\n9 36 b b\n4 23 b b\n9 42 b b\n41 41 b a\n30 47 a b\n8 42 b a\n14 38 b b\n3 15 a a\n35 47 b b\n14 34 a b\n38 43 a b\n1 35 b a\n16 28 b a",
"output": "aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaabbbbbbbbbbb"
},
{
"input": "89 29\nbabaabaaabaaaababbbbbbbabbbaaaaababbaababababbababaaabbababaaabbbbaaabaaaaaabaaabaabbabab\n39 70 b b\n3 56 b b\n5 22 b a\n4 39 a b\n41 87 b b\n34 41 a a\n10 86 a b\n29 75 a b\n2 68 a a\n27 28 b b\n42 51 b a\n18 61 a a\n6 67 b a\n47 63 a a\n8 68 a b\n4 74 b a\n19 65 a b\n8 55 a b\n5 30 a a\n3 65 a b\n16 57 a b\n34 56 b a\n1 70 a b\n59 68 b b\n29 57 b a\n47 49 b b\n49 73 a a\n32 61 b b\n29 42 a a",
"output": "bbbbbbbbbbbbbbbbbbbbbbbbbbbbaaaaaaaaaaaaaaaaaaaaaaaaaaaaabbbbbbbbbbbbbaaaabbbbbbbbbbbbbab"
},
{
"input": "59 14\nfbebcfabdefbaaedcefdeecababcabebadfbccaaedaebfdaefdbbcbebbe\n5 32 e f\n8 46 e e\n31 43 e f\n3 10 e a\n53 54 f d\n55 59 d a\n39 58 e b\n54 56 f a\n9 40 b e\n28 37 d a\n7 35 e b\n7 56 c f\n23 26 e a\n15 44 e d",
"output": "fbabcfabdffbaafdfffdfffababfabfbaafdffaafdabbfdabfdbbfbbbbe"
},
{
"input": "7 17\nbbaabab\n3 5 a b\n5 7 a a\n5 5 a a\n4 4 b a\n7 7 a a\n5 6 b b\n1 3 b a\n6 7 a b\n4 6 a b\n6 6 a a\n2 4 b a\n1 7 b a\n4 6 b b\n2 5 b b\n2 5 a b\n1 4 a a\n4 4 b a",
"output": "abbabaa"
},
{
"input": "100 1\ndebaaagbfdgehagadabfgheegggfghghgeeeabgceffeffggcbcegfgebbdhebhfagcgadcbdbabddbcadgbgdebdfehceehcaef\n13 99 f c",
"output": "debaaagbfdgehagadabcgheegggcghghgeeeabgcecceccggcbcegcgebbdhebhcagcgadcbdbabddbcadgbgdebdcehceehcaef"
},
{
"input": "1 1\na\n1 1 a b",
"output": "b"
},
{
"input": "100 1\naaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa\n1 100 a b",
"output": "bbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbb"
},
{
"input": "2 2\naa\n1 2 a b\n1 2 b c",
"output": "cc"
},
{
"input": "3 3\naaa\n1 3 a b\n1 3 b c\n1 3 c d",
"output": "ddd"
},
{
"input": "2 2\naa\n2 2 a b\n1 1 a b",
"output": "bb"
}
] | 1,616,654,343 | 2,147,483,647 |
Python 3
|
WRONG_ANSWER
|
TESTS
| 2 | 62 | 307,200 |
n=str(input()).split(" ")
name=str(input())
for _ in range(0,int(n[1])):
n1=str(input()).split(" ")
start = int(n1[0])-1
end = int(n1[1])
for val in name[start:end]:
if str(n1[2])==val:
index=name.index(val)
result=name[:index]+n1[3]+name[index+1:]
name=result
print(result)
|
Title: Scarborough Fair
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Parsley, sage, rosemary and thyme.
Remember me to one who lives there.
He once was the true love of mine.
Willem is taking the girl to the highest building in island No.28, however, neither of them knows how to get there.
Willem asks his friend, Grick for directions, Grick helped them, and gave them a task.
Although the girl wants to help, Willem insists on doing it by himself.
Grick gave Willem a string of length *n*.
Willem needs to do *m* operations, each operation has four parameters *l*,<=*r*,<=*c*1,<=*c*2, which means that all symbols *c*1 in range [*l*,<=*r*] (from *l*-th to *r*-th, including *l* and *r*) are changed into *c*2. String is 1-indexed.
Grick wants to know the final string after all the *m* operations.
Input Specification:
The first line contains two integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=100).
The second line contains a string *s* of length *n*, consisting of lowercase English letters.
Each of the next *m* lines contains four parameters *l*,<=*r*,<=*c*1,<=*c*2 (1<=≤<=*l*<=≤<=*r*<=≤<=*n*, *c*1,<=*c*2 are lowercase English letters), separated by space.
Output Specification:
Output string *s* after performing *m* operations described above.
Demo Input:
['3 1\nioi\n1 1 i n\n', '5 3\nwxhak\n3 3 h x\n1 5 x a\n1 3 w g\n']
Demo Output:
['noi', 'gaaak']
Note:
For the second example:
After the first operation, the string is wxxak.
After the second operation, the string is waaak.
After the third operation, the string is gaaak.
|
```python
n=str(input()).split(" ")
name=str(input())
for _ in range(0,int(n[1])):
n1=str(input()).split(" ")
start = int(n1[0])-1
end = int(n1[1])
for val in name[start:end]:
if str(n1[2])==val:
index=name.index(val)
result=name[:index]+n1[3]+name[index+1:]
name=result
print(result)
```
| 0 |
|
71 |
A
|
Way Too Long Words
|
PROGRAMMING
| 800 |
[
"strings"
] |
A. Way Too Long Words
|
1
|
256
|
Sometimes some words like "localization" or "internationalization" are so long that writing them many times in one text is quite tiresome.
Let's consider a word too long, if its length is strictly more than 10 characters. All too long words should be replaced with a special abbreviation.
This abbreviation is made like this: we write down the first and the last letter of a word and between them we write the number of letters between the first and the last letters. That number is in decimal system and doesn't contain any leading zeroes.
Thus, "localization" will be spelt as "l10n", and "internationalization» will be spelt as "i18n".
You are suggested to automatize the process of changing the words with abbreviations. At that all too long words should be replaced by the abbreviation and the words that are not too long should not undergo any changes.
|
The first line contains an integer *n* (1<=≤<=*n*<=≤<=100). Each of the following *n* lines contains one word. All the words consist of lowercase Latin letters and possess the lengths of from 1 to 100 characters.
|
Print *n* lines. The *i*-th line should contain the result of replacing of the *i*-th word from the input data.
|
[
"4\nword\nlocalization\ninternationalization\npneumonoultramicroscopicsilicovolcanoconiosis\n"
] |
[
"word\nl10n\ni18n\np43s\n"
] |
none
| 500 |
[
{
"input": "4\nword\nlocalization\ninternationalization\npneumonoultramicroscopicsilicovolcanoconiosis",
"output": "word\nl10n\ni18n\np43s"
},
{
"input": "5\nabcdefgh\nabcdefghi\nabcdefghij\nabcdefghijk\nabcdefghijklm",
"output": "abcdefgh\nabcdefghi\nabcdefghij\na9k\na11m"
},
{
"input": "3\nnjfngnrurunrgunrunvurn\njfvnjfdnvjdbfvsbdubruvbubvkdb\nksdnvidnviudbvibd",
"output": "n20n\nj27b\nk15d"
},
{
"input": "1\ntcyctkktcctrcyvbyiuhihhhgyvyvyvyvjvytchjckt",
"output": "t41t"
},
{
"input": "24\nyou\nare\nregistered\nfor\npractice\nyou\ncan\nsolve\nproblems\nunofficially\nresults\ncan\nbe\nfound\nin\nthe\ncontest\nstatus\nand\nin\nthe\nbottom\nof\nstandings",
"output": "you\nare\nregistered\nfor\npractice\nyou\ncan\nsolve\nproblems\nu10y\nresults\ncan\nbe\nfound\nin\nthe\ncontest\nstatus\nand\nin\nthe\nbottom\nof\nstandings"
},
{
"input": "1\na",
"output": "a"
},
{
"input": "26\na\nb\nc\nd\ne\nf\ng\nh\ni\nj\nk\nl\nm\nn\no\np\nq\nr\ns\nt\nu\nv\nw\nx\ny\nz",
"output": "a\nb\nc\nd\ne\nf\ng\nh\ni\nj\nk\nl\nm\nn\no\np\nq\nr\ns\nt\nu\nv\nw\nx\ny\nz"
},
{
"input": "1\nabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghij",
"output": "a98j"
},
{
"input": "10\ngyartjdxxlcl\nfzsck\nuidwu\nxbymclornemdmtj\nilppyoapitawgje\ncibzc\ndrgbeu\nhezplmsdekhhbo\nfeuzlrimbqbytdu\nkgdco",
"output": "g10l\nfzsck\nuidwu\nx13j\ni13e\ncibzc\ndrgbeu\nh12o\nf13u\nkgdco"
},
{
"input": "20\nlkpmx\nkovxmxorlgwaomlswjxlpnbvltfv\nhykasjxqyjrmybejnmeumzha\ntuevlumpqbbhbww\nqgqsphvrmupxxc\ntrissbaf\nqfgrlinkzvzqdryckaizutd\nzzqtoaxkvwoscyx\noswytrlnhpjvvnwookx\nlpuzqgec\ngyzqfwxggtvpjhzmzmdw\nrlxjgmvdftvrmvbdwudra\nvsntnjpepnvdaxiporggmglhagv\nxlvcqkqgcrbgtgglj\nlyxwxbiszyhlsrgzeedzprbmcpduvq\nyrmqqvrkqskqukzqrwukpsifgtdc\nxpuohcsjhhuhvr\nvvlfrlxpvqejngwrbfbpmqeirxlw\nsvmasocxdvadmaxtrpakysmeaympy\nyuflqboqfdt",
"output": "lkpmx\nk26v\nh22a\nt13w\nq12c\ntrissbaf\nq21d\nz13x\no17x\nlpuzqgec\ng18w\nr19a\nv25v\nx15j\nl28q\ny26c\nx12r\nv26w\ns27y\ny9t"
},
{
"input": "100\nm\nz\ns\nv\nd\nr\nv\ny\ny\ne\np\nt\nc\na\nn\nm\np\ng\ni\nj\nc\na\nb\nq\ne\nn\nv\no\nk\nx\nf\ni\nl\na\nq\nr\nu\nb\ns\nl\nc\nl\ne\nv\nj\nm\nx\nb\na\nq\nb\na\nf\nj\nv\nm\nq\nc\nt\nt\nn\nx\no\ny\nr\nu\nh\nm\nj\np\nj\nq\nz\ns\nj\no\ng\nc\nm\nn\no\nm\nr\no\ns\nt\nh\nr\np\nk\nb\nz\ng\no\nc\nc\nz\nz\ng\nr",
"output": "m\nz\ns\nv\nd\nr\nv\ny\ny\ne\np\nt\nc\na\nn\nm\np\ng\ni\nj\nc\na\nb\nq\ne\nn\nv\no\nk\nx\nf\ni\nl\na\nq\nr\nu\nb\ns\nl\nc\nl\ne\nv\nj\nm\nx\nb\na\nq\nb\na\nf\nj\nv\nm\nq\nc\nt\nt\nn\nx\no\ny\nr\nu\nh\nm\nj\np\nj\nq\nz\ns\nj\no\ng\nc\nm\nn\no\nm\nr\no\ns\nt\nh\nr\np\nk\nb\nz\ng\no\nc\nc\nz\nz\ng\nr"
}
] | 1,690,857,665 | 2,147,483,647 |
Python 3
|
WRONG_ANSWER
|
TESTS
| 0 | 15 | 0 |
n = int(input())
A=[]
for i in range(n):
a=input()
A.append(a)
for k in A:
if len(k)<3:
print(k)
else:
print(k[0]+str(len(k)-2)+k[len(k)-1])
|
Title: Way Too Long Words
Time Limit: 1 seconds
Memory Limit: 256 megabytes
Problem Description:
Sometimes some words like "localization" or "internationalization" are so long that writing them many times in one text is quite tiresome.
Let's consider a word too long, if its length is strictly more than 10 characters. All too long words should be replaced with a special abbreviation.
This abbreviation is made like this: we write down the first and the last letter of a word and between them we write the number of letters between the first and the last letters. That number is in decimal system and doesn't contain any leading zeroes.
Thus, "localization" will be spelt as "l10n", and "internationalization» will be spelt as "i18n".
You are suggested to automatize the process of changing the words with abbreviations. At that all too long words should be replaced by the abbreviation and the words that are not too long should not undergo any changes.
Input Specification:
The first line contains an integer *n* (1<=≤<=*n*<=≤<=100). Each of the following *n* lines contains one word. All the words consist of lowercase Latin letters and possess the lengths of from 1 to 100 characters.
Output Specification:
Print *n* lines. The *i*-th line should contain the result of replacing of the *i*-th word from the input data.
Demo Input:
['4\nword\nlocalization\ninternationalization\npneumonoultramicroscopicsilicovolcanoconiosis\n']
Demo Output:
['word\nl10n\ni18n\np43s\n']
Note:
none
|
```python
n = int(input())
A=[]
for i in range(n):
a=input()
A.append(a)
for k in A:
if len(k)<3:
print(k)
else:
print(k[0]+str(len(k)-2)+k[len(k)-1])
```
| 0 |
445 |
A
|
DZY Loves Chessboard
|
PROGRAMMING
| 1,200 |
[
"dfs and similar",
"implementation"
] | null | null |
DZY loves chessboard, and he enjoys playing with it.
He has a chessboard of *n* rows and *m* columns. Some cells of the chessboard are bad, others are good. For every good cell, DZY wants to put a chessman on it. Each chessman is either white or black. After putting all chessmen, DZY wants that no two chessmen with the same color are on two adjacent cells. Two cells are adjacent if and only if they share a common edge.
You task is to find any suitable placement of chessmen on the given chessboard.
|
The first line contains two space-separated integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=100).
Each of the next *n* lines contains a string of *m* characters: the *j*-th character of the *i*-th string is either "." or "-". A "." means that the corresponding cell (in the *i*-th row and the *j*-th column) is good, while a "-" means it is bad.
|
Output must contain *n* lines, each line must contain a string of *m* characters. The *j*-th character of the *i*-th string should be either "W", "B" or "-". Character "W" means the chessman on the cell is white, "B" means it is black, "-" means the cell is a bad cell.
If multiple answers exist, print any of them. It is guaranteed that at least one answer exists.
|
[
"1 1\n.\n",
"2 2\n..\n..\n",
"3 3\n.-.\n---\n--."
] |
[
"B\n",
"BW\nWB\n",
"B-B\n---\n--B"
] |
In the first sample, DZY puts a single black chessman. Of course putting a white one is also OK.
In the second sample, all 4 cells are good. No two same chessmen share an edge in the sample output.
In the third sample, no good cells are adjacent. So you can just put 3 chessmen, no matter what their colors are.
| 500 |
[
{
"input": "1 1\n.",
"output": "B"
},
{
"input": "2 2\n..\n..",
"output": "BW\nWB"
},
{
"input": "3 3\n.-.\n---\n--.",
"output": "B-B\n---\n--B"
},
{
"input": "3 1\n-\n.\n.",
"output": "-\nW\nB"
},
{
"input": "11 11\n-----------\n-----------\n-----------\n-----------\n-----------\n-----------\n-----------\n-----------\n-----------\n-----------\n-----------",
"output": "-----------\n-----------\n-----------\n-----------\n-----------\n-----------\n-----------\n-----------\n-----------\n-----------\n-----------"
},
{
"input": "1 1\n-",
"output": "-"
},
{
"input": "4 2\n..\n..\n..\n..",
"output": "BW\nWB\nBW\nWB"
},
{
"input": "5 1\n.\n.\n.\n.\n.",
"output": "B\nW\nB\nW\nB"
}
] | 1,686,833,000 | 2,147,483,647 |
Python 3
|
RUNTIME_ERROR
|
TESTS
| 1 | 31 | 0 |
x=[]
y=[]
n,k=list(map(int,input().split()))
for i in range (n):
y.append(input().split())
x.append(y[i])
for j in range (k):
if y[i][j]=='-':
x[i][j]=('-')
elif y[i][j] =='.':
x[i][j]=('W')
if i>0 and j>0:
if x[i-1][j]==('W'):
x[i][j]='B'
if x[i][j-1]==('W'):
x[i][j]=('B')
elif i>0 and j==0:
if x[i-1][j]==('W'):
x[i][j]=('B')
elif j>0 and i==0:
if x[i][j-1]==('W'):
x[i][j]=('B')
for i in range (n):
for j in range (k):
print(x[i][j],end='')
print()
|
Title: DZY Loves Chessboard
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
DZY loves chessboard, and he enjoys playing with it.
He has a chessboard of *n* rows and *m* columns. Some cells of the chessboard are bad, others are good. For every good cell, DZY wants to put a chessman on it. Each chessman is either white or black. After putting all chessmen, DZY wants that no two chessmen with the same color are on two adjacent cells. Two cells are adjacent if and only if they share a common edge.
You task is to find any suitable placement of chessmen on the given chessboard.
Input Specification:
The first line contains two space-separated integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=100).
Each of the next *n* lines contains a string of *m* characters: the *j*-th character of the *i*-th string is either "." or "-". A "." means that the corresponding cell (in the *i*-th row and the *j*-th column) is good, while a "-" means it is bad.
Output Specification:
Output must contain *n* lines, each line must contain a string of *m* characters. The *j*-th character of the *i*-th string should be either "W", "B" or "-". Character "W" means the chessman on the cell is white, "B" means it is black, "-" means the cell is a bad cell.
If multiple answers exist, print any of them. It is guaranteed that at least one answer exists.
Demo Input:
['1 1\n.\n', '2 2\n..\n..\n', '3 3\n.-.\n---\n--.']
Demo Output:
['B\n', 'BW\nWB\n', 'B-B\n---\n--B']
Note:
In the first sample, DZY puts a single black chessman. Of course putting a white one is also OK.
In the second sample, all 4 cells are good. No two same chessmen share an edge in the sample output.
In the third sample, no good cells are adjacent. So you can just put 3 chessmen, no matter what their colors are.
|
```python
x=[]
y=[]
n,k=list(map(int,input().split()))
for i in range (n):
y.append(input().split())
x.append(y[i])
for j in range (k):
if y[i][j]=='-':
x[i][j]=('-')
elif y[i][j] =='.':
x[i][j]=('W')
if i>0 and j>0:
if x[i-1][j]==('W'):
x[i][j]='B'
if x[i][j-1]==('W'):
x[i][j]=('B')
elif i>0 and j==0:
if x[i-1][j]==('W'):
x[i][j]=('B')
elif j>0 and i==0:
if x[i][j-1]==('W'):
x[i][j]=('B')
for i in range (n):
for j in range (k):
print(x[i][j],end='')
print()
```
| -1 |
|
25 |
E
|
Test
|
PROGRAMMING
| 2,200 |
[
"hashing",
"strings"
] |
E. Test
|
2
|
256
|
Sometimes it is hard to prepare tests for programming problems. Now Bob is preparing tests to new problem about strings — input data to his problem is one string. Bob has 3 wrong solutions to this problem. The first gives the wrong answer if the input data contains the substring *s*1, the second enters an infinite loop if the input data contains the substring *s*2, and the third requires too much memory if the input data contains the substring *s*3. Bob wants these solutions to fail single test. What is the minimal length of test, which couldn't be passed by all three Bob's solutions?
|
There are exactly 3 lines in the input data. The *i*-th line contains string *s**i*. All the strings are non-empty, consists of lowercase Latin letters, the length of each string doesn't exceed 105.
|
Output one number — what is minimal length of the string, containing *s*1, *s*2 and *s*3 as substrings.
|
[
"ab\nbc\ncd\n",
"abacaba\nabaaba\nx\n"
] |
[
"4\n",
"11\n"
] |
none
| 0 |
[
{
"input": "ab\nbc\ncd",
"output": "4"
},
{
"input": "abacaba\nabaaba\nx",
"output": "11"
},
{
"input": "syvncqmfhautvxudqdhggz\nhrpxzeghsocjpicuixskfuzupytsgjsdiyb\nybcmnmnbpndbxlxbzhbfnqvwcffvrdhtickyqhupmcehls",
"output": "100"
},
{
"input": "jwdezvgfm\nmdoqvylpuvyk\nqylldbziva",
"output": "30"
},
{
"input": "ujgquqxdlowuwnqkmbd\nwdwkhkdgsujgqu\njlxqvcuivagmw",
"output": "40"
},
{
"input": "rdtevvmiqmfgvafkdypxjthzhfsbavmhgkavkfonscaokdxoscenpxrc\nijbvueenzsmgkmkrskjspvfchwkqdglkxnrdtevvmiqmfgvafkdypxjthz\nkqdglkxnrdtevvmiqmfgvafkdypxjthzhfsbavmhgkavkfonscaokdxoscenpxrcivydtkrxjy",
"output": "100"
},
{
"input": "xufuzdlsjxmevrtessfbwlnzzclcqwevnnucxyvhngnxhcbdfwq\nwlwobhnmmgtfolfaeckbrnnglylydxtgtvrlmeeszoiuatzzzxufuzdlsjxmevrt\nbrnnglylydxtgtvrlmeeszoiuatzzzx",
"output": "100"
},
{
"input": "iefouqzxoyuieqdzalfktehtvdbvjmeubju\nocotspetkkhvwfgaqynhovjwjhciefouqzxoyuieqdzalfktehtvdbvjmeubjubcmnvpwgdpnchqhzjrchyrfpvigubp\nycnhjwgbocotspetkkhvwfgaqynhovjwjhcief",
"output": "100"
}
] | 1,651,942,662 | 2,147,483,647 |
PyPy 3-64
|
RUNTIME_ERROR
|
TESTS
| 13 | 1,808 | 17,305,600 |
import sys
input = sys.stdin.readline
S1=input().strip()
S2=input().strip()
S3=input().strip()
# Rolling Hash
p=26 # 文字の種類
mod=(1<<30)+1 # Hashがぶつからない, pと互いに素な数を適当に指定
LEN=len(S1)
TABLE1=[0] # Rolling Hashのテーブル. 最初は0
for i in range(LEN):
TABLE1.append((p*TABLE1[-1]%mod+ord(S1[i])-97)%mod) # テーブルを埋める
def hash_ij1(i,j): # [i,j)のハッシュ値を求める
return (TABLE1[j]-TABLE1[i]*pow(p,j-i,mod))%mod
LEN=len(S2)
TABLE2=[0] # Rolling Hashのテーブル. 最初は0
for i in range(LEN):
TABLE2.append((p*TABLE2[-1]%mod+ord(S2[i])-97)%mod) # テーブルを埋める
def hash_ij2(i,j): # [i,j)のハッシュ値を求める
return (TABLE2[j]-TABLE2[i]*pow(p,j-i,mod))%mod
LEN=len(S3)
TABLE3=[0] # Rolling Hashのテーブル. 最初は0
for i in range(LEN):
TABLE3.append((p*TABLE3[-1]%mod+ord(S3[i])-97)%mod) # テーブルを埋める
def hash_ij3(i,j): # [i,j)のハッシュ値を求める
return (TABLE3[j]-TABLE3[i]*pow(p,j-i,mod))%mod
ty12=0
ty23=0
ty31=0
ty21=0
ty32=0
ty13=0
NO=[0,0,0]
for i in range(len(S1)):
if i+len(S2)<=len(S1) and hash_ij1(i,i+len(S2))==hash_ij2(0,len(S2)):
NO[1]=1
if i+len(S2)<=len(S1) and hash_ij1(i,i+len(S3))==hash_ij3(0,len(S3)):
NO[2]=1
for i in range(len(S2)):
if i+len(S1)<=len(S2) and hash_ij2(i,i+len(S1))==hash_ij1(0,len(S1)):
NO[0]=1
if i+len(S3)<=len(S2) and hash_ij2(i,i+len(S3))==hash_ij3(0,len(S3)):
NO[2]=1
for i in range(len(S3)):
if i+len(S1)<=len(S3) and hash_ij3(i,i+len(S1))==hash_ij1(0,len(S1)):
NO[0]=1
if i+len(S2)<=len(S3) and hash_ij3(i,i+len(S2))==hash_ij2(0,len(S2)):
NO[1]=1
for i in range(min(len(S1),len(S2))):
if hash_ij1(0,i)==hash_ij2(len(S2)-i,len(S2)):
ty21=i
if hash_ij2(0,i)==hash_ij1(len(S1)-i,len(S1)):
ty12=i
for i in range(min(len(S2),len(S3))):
if hash_ij2(0,i)==hash_ij3(len(S3)-i,len(S3)):
ty32=i
if hash_ij3(0,i)==hash_ij2(len(S2)-i,len(S2)):
ty23=i
for i in range(min(len(S1),len(S3))):
if hash_ij1(0,i)==hash_ij3(len(S3)-i,len(S3)):
ty31=i
if hash_ij3(0,i)==hash_ij1(len(S1)-i,len(S1)):
ty13=i
if sum(NO)>=2:
print(len(S1),len(S2),len(S3))
elif NO==[0,0,0]:
ANS=1<<63
ANS=min(ANS,len(S1)+len(S2)+len(S3)-ty12-ty23)
ANS=min(ANS,len(S1)+len(S2)+len(S3)-ty13-ty32)
ANS=min(ANS,len(S1)+len(S2)+len(S3)-ty21-ty13)
ANS=min(ANS,len(S1)+len(S2)+len(S3)-ty23-ty31)
ANS=min(ANS,len(S1)+len(S2)+len(S3)-ty31-ty12)
ANS=min(ANS,len(S1)+len(S2)+len(S3)-ty32-ty21)
print(ANS)
else:
ANS=1<<63
if NO[0]==1:
ANS=min(ANS,len(S2)+len(S3)-ty23)
ANS=min(ANS,len(S2)+len(S3)-ty32)
elif NO[1]==1:
ANS=min(ANS,len(S1)+len(S3)-ty13)
ANS=min(ANS,len(S1)+len(S3)-ty31)
else:
ANS=min(ANS,len(S1)+len(S2)-ty12)
ANS=min(ANS,len(S1)+len(S2)-ty21)
print(ANS)
|
Title: Test
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Sometimes it is hard to prepare tests for programming problems. Now Bob is preparing tests to new problem about strings — input data to his problem is one string. Bob has 3 wrong solutions to this problem. The first gives the wrong answer if the input data contains the substring *s*1, the second enters an infinite loop if the input data contains the substring *s*2, and the third requires too much memory if the input data contains the substring *s*3. Bob wants these solutions to fail single test. What is the minimal length of test, which couldn't be passed by all three Bob's solutions?
Input Specification:
There are exactly 3 lines in the input data. The *i*-th line contains string *s**i*. All the strings are non-empty, consists of lowercase Latin letters, the length of each string doesn't exceed 105.
Output Specification:
Output one number — what is minimal length of the string, containing *s*1, *s*2 and *s*3 as substrings.
Demo Input:
['ab\nbc\ncd\n', 'abacaba\nabaaba\nx\n']
Demo Output:
['4\n', '11\n']
Note:
none
|
```python
import sys
input = sys.stdin.readline
S1=input().strip()
S2=input().strip()
S3=input().strip()
# Rolling Hash
p=26 # 文字の種類
mod=(1<<30)+1 # Hashがぶつからない, pと互いに素な数を適当に指定
LEN=len(S1)
TABLE1=[0] # Rolling Hashのテーブル. 最初は0
for i in range(LEN):
TABLE1.append((p*TABLE1[-1]%mod+ord(S1[i])-97)%mod) # テーブルを埋める
def hash_ij1(i,j): # [i,j)のハッシュ値を求める
return (TABLE1[j]-TABLE1[i]*pow(p,j-i,mod))%mod
LEN=len(S2)
TABLE2=[0] # Rolling Hashのテーブル. 最初は0
for i in range(LEN):
TABLE2.append((p*TABLE2[-1]%mod+ord(S2[i])-97)%mod) # テーブルを埋める
def hash_ij2(i,j): # [i,j)のハッシュ値を求める
return (TABLE2[j]-TABLE2[i]*pow(p,j-i,mod))%mod
LEN=len(S3)
TABLE3=[0] # Rolling Hashのテーブル. 最初は0
for i in range(LEN):
TABLE3.append((p*TABLE3[-1]%mod+ord(S3[i])-97)%mod) # テーブルを埋める
def hash_ij3(i,j): # [i,j)のハッシュ値を求める
return (TABLE3[j]-TABLE3[i]*pow(p,j-i,mod))%mod
ty12=0
ty23=0
ty31=0
ty21=0
ty32=0
ty13=0
NO=[0,0,0]
for i in range(len(S1)):
if i+len(S2)<=len(S1) and hash_ij1(i,i+len(S2))==hash_ij2(0,len(S2)):
NO[1]=1
if i+len(S2)<=len(S1) and hash_ij1(i,i+len(S3))==hash_ij3(0,len(S3)):
NO[2]=1
for i in range(len(S2)):
if i+len(S1)<=len(S2) and hash_ij2(i,i+len(S1))==hash_ij1(0,len(S1)):
NO[0]=1
if i+len(S3)<=len(S2) and hash_ij2(i,i+len(S3))==hash_ij3(0,len(S3)):
NO[2]=1
for i in range(len(S3)):
if i+len(S1)<=len(S3) and hash_ij3(i,i+len(S1))==hash_ij1(0,len(S1)):
NO[0]=1
if i+len(S2)<=len(S3) and hash_ij3(i,i+len(S2))==hash_ij2(0,len(S2)):
NO[1]=1
for i in range(min(len(S1),len(S2))):
if hash_ij1(0,i)==hash_ij2(len(S2)-i,len(S2)):
ty21=i
if hash_ij2(0,i)==hash_ij1(len(S1)-i,len(S1)):
ty12=i
for i in range(min(len(S2),len(S3))):
if hash_ij2(0,i)==hash_ij3(len(S3)-i,len(S3)):
ty32=i
if hash_ij3(0,i)==hash_ij2(len(S2)-i,len(S2)):
ty23=i
for i in range(min(len(S1),len(S3))):
if hash_ij1(0,i)==hash_ij3(len(S3)-i,len(S3)):
ty31=i
if hash_ij3(0,i)==hash_ij1(len(S1)-i,len(S1)):
ty13=i
if sum(NO)>=2:
print(len(S1),len(S2),len(S3))
elif NO==[0,0,0]:
ANS=1<<63
ANS=min(ANS,len(S1)+len(S2)+len(S3)-ty12-ty23)
ANS=min(ANS,len(S1)+len(S2)+len(S3)-ty13-ty32)
ANS=min(ANS,len(S1)+len(S2)+len(S3)-ty21-ty13)
ANS=min(ANS,len(S1)+len(S2)+len(S3)-ty23-ty31)
ANS=min(ANS,len(S1)+len(S2)+len(S3)-ty31-ty12)
ANS=min(ANS,len(S1)+len(S2)+len(S3)-ty32-ty21)
print(ANS)
else:
ANS=1<<63
if NO[0]==1:
ANS=min(ANS,len(S2)+len(S3)-ty23)
ANS=min(ANS,len(S2)+len(S3)-ty32)
elif NO[1]==1:
ANS=min(ANS,len(S1)+len(S3)-ty13)
ANS=min(ANS,len(S1)+len(S3)-ty31)
else:
ANS=min(ANS,len(S1)+len(S2)-ty12)
ANS=min(ANS,len(S1)+len(S2)-ty21)
print(ANS)
```
| -1 |
139 |
A
|
Petr and Book
|
PROGRAMMING
| 1,000 |
[
"implementation"
] | null | null |
One Sunday Petr went to a bookshop and bought a new book on sports programming. The book had exactly *n* pages.
Petr decided to start reading it starting from the next day, that is, from Monday. Petr's got a very tight schedule and for each day of the week he knows how many pages he will be able to read on that day. Some days are so busy that Petr will have no time to read whatsoever. However, we know that he will be able to read at least one page a week.
Assuming that Petr will not skip days and will read as much as he can every day, determine on which day of the week he will read the last page of the book.
|
The first input line contains the single integer *n* (1<=≤<=*n*<=≤<=1000) — the number of pages in the book.
The second line contains seven non-negative space-separated integers that do not exceed 1000 — those integers represent how many pages Petr can read on Monday, Tuesday, Wednesday, Thursday, Friday, Saturday and Sunday correspondingly. It is guaranteed that at least one of those numbers is larger than zero.
|
Print a single number — the number of the day of the week, when Petr will finish reading the book. The days of the week are numbered starting with one in the natural order: Monday, Tuesday, Wednesday, Thursday, Friday, Saturday, Sunday.
|
[
"100\n15 20 20 15 10 30 45\n",
"2\n1 0 0 0 0 0 0\n"
] |
[
"6\n",
"1\n"
] |
Note to the first sample:
By the end of Monday and therefore, by the beginning of Tuesday Petr has 85 pages left. He has 65 pages left by Wednesday, 45 by Thursday, 30 by Friday, 20 by Saturday and on Saturday Petr finishes reading the book (and he also has time to read 10 pages of something else).
Note to the second sample:
On Monday of the first week Petr will read the first page. On Monday of the second week Petr will read the second page and will finish reading the book.
| 500 |
[
{
"input": "100\n15 20 20 15 10 30 45",
"output": "6"
},
{
"input": "2\n1 0 0 0 0 0 0",
"output": "1"
},
{
"input": "100\n100 200 100 200 300 400 500",
"output": "1"
},
{
"input": "3\n1 1 1 1 1 1 1",
"output": "3"
},
{
"input": "1\n1 1 1 1 1 1 1",
"output": "1"
},
{
"input": "20\n5 3 7 2 1 6 4",
"output": "6"
},
{
"input": "10\n5 1 1 1 1 1 5",
"output": "6"
},
{
"input": "50\n10 1 10 1 10 1 10",
"output": "1"
},
{
"input": "77\n11 11 11 11 11 11 10",
"output": "1"
},
{
"input": "1\n1000 1000 1000 1000 1000 1000 1000",
"output": "1"
},
{
"input": "1000\n100 100 100 100 100 100 100",
"output": "3"
},
{
"input": "999\n10 20 10 20 30 20 10",
"output": "3"
},
{
"input": "433\n109 58 77 10 39 125 15",
"output": "7"
},
{
"input": "1\n0 0 0 0 0 0 1",
"output": "7"
},
{
"input": "5\n1 0 1 0 1 0 1",
"output": "1"
},
{
"input": "997\n1 1 0 0 1 0 1",
"output": "1"
},
{
"input": "1000\n1 1 1 1 1 1 1",
"output": "6"
},
{
"input": "1000\n1000 1000 1000 1000 1000 1000 1000",
"output": "1"
},
{
"input": "1000\n1 0 0 0 0 0 0",
"output": "1"
},
{
"input": "1000\n0 0 0 0 0 0 1",
"output": "7"
},
{
"input": "1000\n1 0 0 1 0 0 1",
"output": "1"
},
{
"input": "509\n105 23 98 0 7 0 155",
"output": "2"
},
{
"input": "7\n1 1 1 1 1 1 1",
"output": "7"
},
{
"input": "2\n1 1 0 0 0 0 0",
"output": "2"
},
{
"input": "1\n0 0 0 0 0 1 0",
"output": "6"
},
{
"input": "10\n0 0 0 0 0 0 1",
"output": "7"
},
{
"input": "5\n0 0 0 0 0 6 0",
"output": "6"
},
{
"input": "3\n0 1 0 0 0 0 0",
"output": "2"
},
{
"input": "10\n0 0 0 0 0 0 10",
"output": "7"
},
{
"input": "28\n1 2 3 4 5 6 7",
"output": "7"
},
{
"input": "100\n5 5 5 5 5 5 5",
"output": "6"
},
{
"input": "4\n1 0 0 0 0 0 1",
"output": "7"
},
{
"input": "2\n0 0 0 0 0 0 1",
"output": "7"
},
{
"input": "7\n0 0 0 0 0 0 7",
"output": "7"
},
{
"input": "7\n2 1 1 1 1 1 0",
"output": "6"
},
{
"input": "2\n0 0 1 1 0 0 0",
"output": "4"
},
{
"input": "6\n1 1 1 1 1 1 0",
"output": "6"
},
{
"input": "5\n1 1 1 0 0 1 1",
"output": "7"
},
{
"input": "100\n10 20 30 10 10 10 10",
"output": "7"
},
{
"input": "1\n0 0 0 1 0 0 0",
"output": "4"
},
{
"input": "70\n10 10 10 10 10 10 10",
"output": "7"
},
{
"input": "22\n1 2 3 4 5 6 10",
"output": "7"
},
{
"input": "5\n0 0 0 1 0 0 0",
"output": "4"
},
{
"input": "2\n0 0 0 1 0 0 0",
"output": "4"
},
{
"input": "6\n1 0 0 0 0 0 2",
"output": "7"
},
{
"input": "10\n1 2 2 1 2 1 1",
"output": "7"
},
{
"input": "5\n0 0 0 0 0 0 10",
"output": "7"
},
{
"input": "4\n0 1 1 0 0 0 0",
"output": "3"
},
{
"input": "100\n0 0 0 0 0 1 0",
"output": "6"
}
] | 1,697,546,696 | 2,147,483,647 |
PyPy 3-64
|
WRONG_ANSWER
|
TESTS
| 7 | 92 | 0 |
#Coder_1_neel
x=int(input())
count=0
a=list(map(int,input().split()))
for num in a:
if num>0:
if x<=0:
break
else:
x=x-num
count+=1
print(count)
|
Title: Petr and Book
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
One Sunday Petr went to a bookshop and bought a new book on sports programming. The book had exactly *n* pages.
Petr decided to start reading it starting from the next day, that is, from Monday. Petr's got a very tight schedule and for each day of the week he knows how many pages he will be able to read on that day. Some days are so busy that Petr will have no time to read whatsoever. However, we know that he will be able to read at least one page a week.
Assuming that Petr will not skip days and will read as much as he can every day, determine on which day of the week he will read the last page of the book.
Input Specification:
The first input line contains the single integer *n* (1<=≤<=*n*<=≤<=1000) — the number of pages in the book.
The second line contains seven non-negative space-separated integers that do not exceed 1000 — those integers represent how many pages Petr can read on Monday, Tuesday, Wednesday, Thursday, Friday, Saturday and Sunday correspondingly. It is guaranteed that at least one of those numbers is larger than zero.
Output Specification:
Print a single number — the number of the day of the week, when Petr will finish reading the book. The days of the week are numbered starting with one in the natural order: Monday, Tuesday, Wednesday, Thursday, Friday, Saturday, Sunday.
Demo Input:
['100\n15 20 20 15 10 30 45\n', '2\n1 0 0 0 0 0 0\n']
Demo Output:
['6\n', '1\n']
Note:
Note to the first sample:
By the end of Monday and therefore, by the beginning of Tuesday Petr has 85 pages left. He has 65 pages left by Wednesday, 45 by Thursday, 30 by Friday, 20 by Saturday and on Saturday Petr finishes reading the book (and he also has time to read 10 pages of something else).
Note to the second sample:
On Monday of the first week Petr will read the first page. On Monday of the second week Petr will read the second page and will finish reading the book.
|
```python
#Coder_1_neel
x=int(input())
count=0
a=list(map(int,input().split()))
for num in a:
if num>0:
if x<=0:
break
else:
x=x-num
count+=1
print(count)
```
| 0 |
|
447 |
B
|
DZY Loves Strings
|
PROGRAMMING
| 1,000 |
[
"greedy",
"implementation"
] | null | null |
DZY loves collecting special strings which only contain lowercase letters. For each lowercase letter *c* DZY knows its value *w**c*. For each special string *s*<==<=*s*1*s*2... *s*|*s*| (|*s*| is the length of the string) he represents its value with a function *f*(*s*), where
Now DZY has a string *s*. He wants to insert *k* lowercase letters into this string in order to get the largest possible value of the resulting string. Can you help him calculate the largest possible value he could get?
|
The first line contains a single string *s* (1<=≤<=|*s*|<=≤<=103).
The second line contains a single integer *k* (0<=≤<=*k*<=≤<=103).
The third line contains twenty-six integers from *w**a* to *w**z*. Each such number is non-negative and doesn't exceed 1000.
|
Print a single integer — the largest possible value of the resulting string DZY could get.
|
[
"abc\n3\n1 2 2 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1\n"
] |
[
"41\n"
] |
In the test sample DZY can obtain "abcbbc", *value* = 1·1 + 2·2 + 3·2 + 4·2 + 5·2 + 6·2 = 41.
| 1,000 |
[
{
"input": "abc\n3\n1 2 2 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "41"
},
{
"input": "mmzhr\n3\n443 497 867 471 195 670 453 413 579 466 553 881 847 642 269 996 666 702 487 209 257 741 974 133 519 453",
"output": "29978"
},
{
"input": "ajeeseerqnpaujubmajpibxrccazaawetywxmifzehojf\n23\n359 813 772 413 733 654 33 87 890 433 395 311 801 852 376 148 914 420 636 695 583 733 664 394 407 314",
"output": "1762894"
},
{
"input": "uahngxejpomhbsebcxvelfsojbaouynnlsogjyvktpwwtcyddkcdqcqs\n34\n530 709 150 660 947 830 487 142 208 276 885 542 138 214 76 184 273 753 30 195 722 236 82 691 572 585",
"output": "2960349"
},
{
"input": "xnzeqmouqyzvblcidmhbkqmtusszuczadpooslqxegldanwopilmdwzbczvrwgnwaireykwpugvpnpafbxlyggkgawghysufuegvmzvpgcqyjkoadcreaguzepbendwnowsuekxxivkziibxvxfoilofxcgnxvfefyezfhevfvtetsuhwtyxdlkccdkvqjl\n282\n170 117 627 886 751 147 414 187 150 960 410 70 576 681 641 729 798 877 611 108 772 643 683 166 305 933",
"output": "99140444"
},
{
"input": "pplkqmluhfympkjfjnfdkwrkpumgdmbkfbbldpepicbbmdgafttpopzdxsevlqbtywzkoxyviglbbxsohycbdqksrhlumsldiwzjmednbkcjishkiekfrchzuztkcxnvuykhuenqojrmzaxlaoxnljnvqgnabtmcftisaazzgbmubmpsorygyusmeonrhrgphnfhlaxrvyhuxsnnezjxmdoklpquzpvjbxgbywppmegzxknhfzyygrmejleesoqfwheulmqhonqaukyuejtwxskjldplripyihbfpookxkuehiwqthbfafyrgmykuxglpplozycgydyecqkgfjljfqvigqhuxssqqtfanwszduwbsoytnrtgc\n464\n838 95 473 955 690 84 436 19 179 437 674 626 377 365 781 4 733 776 462 203 119 256 381 668 855 686",
"output": "301124161"
},
{
"input": "qkautnuilwlhjsldfcuwhiqtgtoihifszlyvfaygrnivzgvwthkrzzdtfjcirrjjlrmjtbjlzmjeqmuffsjorjyggzefwgvmblvotvzffnwjhqxorpowzdcnfksdibezdtfjjxfozaghieksbmowrbeehuxlesmvqjsphlvauxiijm\n98\n121 622 0 691 616 959 838 161 581 862 876 830 267 812 598 106 337 73 588 323 999 17 522 399 657 495",
"output": "30125295"
},
{
"input": "tghyxqfmhz\n8\n191 893 426 203 780 326 148 259 182 140 847 636 778 97 167 773 219 891 758 993 695 603 223 779 368 165",
"output": "136422"
},
{
"input": "nyawbfjxnxjiyhwkydaruozobpphgjqdpfdqzezcsoyvurnapu\n30\n65 682 543 533 990 148 815 821 315 916 632 771 332 513 472 864 12 73 548 687 660 572 507 192 226 348",
"output": "2578628"
},
{
"input": "pylrnkrbcjgoytvdnhmlvnkknijkdgdhworlvtwuonrkhrilkewcnofodaumgvnsisxooswgrgtvdeauyxhkipfoxrrtysuepjcf\n60\n894 206 704 179 272 337 413 828 119 182 330 46 440 102 250 191 242 539 678 783 843 431 612 567 33 338",
"output": "9168707"
},
{
"input": "vhjnkrxbyhjhnjrxvwxmhxwoxttbtqosfxtcuvhfjlkyfspeypthsdkkwnqdpxdlnxsgtzvkrgqosgfjrwetqbxgoarkjhrjbspzgblsapifltkfxbfdbxqwoohlgyzijmiwnpmveybyzvasoctxsmgjehpyysmqblwnmkappbecklqjfmxhlyceordroflnposohfplrvijxbwvqdtvzhobtrumiujnyrfbwthvciinuveoizkccelxtaveiiagryqnyvsgfnipnavrtmdqlcnldepocbpzmqnarkdvykds\n276\n364 244 798 82 582 9 309 950 286 547 892 371 569 159 705 975 740 845 655 179 130 993 255 552 882 657",
"output": "144901921"
},
{
"input": "gsaddmezrnttfalbwlqbnedumvikplfosw\n12\n290 850 872 361 483 895 152 118 974 619 701 154 899 285 328 712 669 984 407 340 851 775 324 892 554 860",
"output": "809931"
},
{
"input": "a\n0\n5 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "5"
},
{
"input": "lol\n3\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "21"
}
] | 1,643,189,116 | 2,147,483,647 |
Python 3
|
OK
|
TESTS
| 24 | 46 | 0 |
s=input()
k=int(input())
nums=[int(nums) for nums in input().split()]
maxvalue=0
for index in range(len(s)):
maxvalue+=(index+1)*(nums[ord(s[index])-97])
n=len(s)
temp=0
for index in range(k):
n+=1
temp+=n
n=max(nums)
maxvalue+=(n*temp)
print(maxvalue)
|
Title: DZY Loves Strings
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
DZY loves collecting special strings which only contain lowercase letters. For each lowercase letter *c* DZY knows its value *w**c*. For each special string *s*<==<=*s*1*s*2... *s*|*s*| (|*s*| is the length of the string) he represents its value with a function *f*(*s*), where
Now DZY has a string *s*. He wants to insert *k* lowercase letters into this string in order to get the largest possible value of the resulting string. Can you help him calculate the largest possible value he could get?
Input Specification:
The first line contains a single string *s* (1<=≤<=|*s*|<=≤<=103).
The second line contains a single integer *k* (0<=≤<=*k*<=≤<=103).
The third line contains twenty-six integers from *w**a* to *w**z*. Each such number is non-negative and doesn't exceed 1000.
Output Specification:
Print a single integer — the largest possible value of the resulting string DZY could get.
Demo Input:
['abc\n3\n1 2 2 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1\n']
Demo Output:
['41\n']
Note:
In the test sample DZY can obtain "abcbbc", *value* = 1·1 + 2·2 + 3·2 + 4·2 + 5·2 + 6·2 = 41.
|
```python
s=input()
k=int(input())
nums=[int(nums) for nums in input().split()]
maxvalue=0
for index in range(len(s)):
maxvalue+=(index+1)*(nums[ord(s[index])-97])
n=len(s)
temp=0
for index in range(k):
n+=1
temp+=n
n=max(nums)
maxvalue+=(n*temp)
print(maxvalue)
```
| 3 |
|
842 |
A
|
Kirill And The Game
|
PROGRAMMING
| 1,200 |
[
"brute force",
"two pointers"
] | null | null |
Kirill plays a new computer game. He came to the potion store where he can buy any potion. Each potion is characterized by two integers — amount of experience and cost. The efficiency of a potion is the ratio of the amount of experience to the cost. Efficiency may be a non-integer number.
For each two integer numbers *a* and *b* such that *l*<=≤<=*a*<=≤<=*r* and *x*<=≤<=*b*<=≤<=*y* there is a potion with experience *a* and cost *b* in the store (that is, there are (*r*<=-<=*l*<=+<=1)·(*y*<=-<=*x*<=+<=1) potions).
Kirill wants to buy a potion which has efficiency *k*. Will he be able to do this?
|
First string contains five integer numbers *l*, *r*, *x*, *y*, *k* (1<=≤<=*l*<=≤<=*r*<=≤<=107, 1<=≤<=*x*<=≤<=*y*<=≤<=107, 1<=≤<=*k*<=≤<=107).
|
Print "YES" without quotes if a potion with efficiency exactly *k* can be bought in the store and "NO" without quotes otherwise.
You can output each of the letters in any register.
|
[
"1 10 1 10 1\n",
"1 5 6 10 1\n"
] |
[
"YES",
"NO"
] |
none
| 500 |
[
{
"input": "1 10 1 10 1",
"output": "YES"
},
{
"input": "1 5 6 10 1",
"output": "NO"
},
{
"input": "1 1 1 1 1",
"output": "YES"
},
{
"input": "1 1 1 1 2",
"output": "NO"
},
{
"input": "1 100000 1 100000 100000",
"output": "YES"
},
{
"input": "1 100000 1 100000 100001",
"output": "NO"
},
{
"input": "25 10000 200 10000 5",
"output": "YES"
},
{
"input": "1 100000 10 100000 50000",
"output": "NO"
},
{
"input": "91939 94921 10197 89487 1",
"output": "NO"
},
{
"input": "30518 58228 74071 77671 1",
"output": "NO"
},
{
"input": "46646 79126 78816 91164 5",
"output": "NO"
},
{
"input": "30070 83417 92074 99337 2",
"output": "NO"
},
{
"input": "13494 17544 96820 99660 6",
"output": "NO"
},
{
"input": "96918 97018 10077 86510 9",
"output": "YES"
},
{
"input": "13046 45594 14823 52475 1",
"output": "YES"
},
{
"input": "29174 40572 95377 97669 4",
"output": "NO"
},
{
"input": "79894 92433 8634 86398 4",
"output": "YES"
},
{
"input": "96022 98362 13380 94100 6",
"output": "YES"
},
{
"input": "79446 95675 93934 96272 3",
"output": "NO"
},
{
"input": "5440 46549 61481 99500 10",
"output": "NO"
},
{
"input": "21569 53580 74739 87749 3",
"output": "NO"
},
{
"input": "72289 78297 79484 98991 7",
"output": "NO"
},
{
"input": "88417 96645 92742 98450 5",
"output": "NO"
},
{
"input": "71841 96625 73295 77648 8",
"output": "NO"
},
{
"input": "87969 99230 78041 94736 4",
"output": "NO"
},
{
"input": "4 4 1 2 3",
"output": "NO"
},
{
"input": "150 150 1 2 100",
"output": "NO"
},
{
"input": "99 100 1 100 50",
"output": "YES"
},
{
"input": "7 7 3 6 2",
"output": "NO"
},
{
"input": "10 10 1 10 1",
"output": "YES"
},
{
"input": "36 36 5 7 6",
"output": "YES"
},
{
"input": "73 96 1 51 51",
"output": "NO"
},
{
"input": "3 3 1 3 2",
"output": "NO"
},
{
"input": "10000000 10000000 1 100000 10000000",
"output": "YES"
},
{
"input": "9222174 9829060 9418763 9955619 9092468",
"output": "NO"
},
{
"input": "70 70 1 2 50",
"output": "NO"
},
{
"input": "100 200 1 20 5",
"output": "YES"
},
{
"input": "1 200000 65536 65536 65537",
"output": "NO"
},
{
"input": "15 15 1 100 1",
"output": "YES"
},
{
"input": "10000000 10000000 1 10000000 100000",
"output": "YES"
},
{
"input": "10 10 2 5 4",
"output": "NO"
},
{
"input": "67 69 7 7 9",
"output": "NO"
},
{
"input": "100000 10000000 1 10000000 100000",
"output": "YES"
},
{
"input": "9 12 1 2 7",
"output": "NO"
},
{
"input": "5426234 6375745 2636512 8492816 4409404",
"output": "NO"
},
{
"input": "6134912 6134912 10000000 10000000 999869",
"output": "NO"
},
{
"input": "3 3 1 100 1",
"output": "YES"
},
{
"input": "10000000 10000000 10 10000000 100000",
"output": "YES"
},
{
"input": "4 4 1 100 2",
"output": "YES"
},
{
"input": "8 13 1 4 7",
"output": "NO"
},
{
"input": "10 10 100000 10000000 10000000",
"output": "NO"
},
{
"input": "5 6 1 4 2",
"output": "YES"
},
{
"input": "1002 1003 1 2 1000",
"output": "NO"
},
{
"input": "4 5 1 2 2",
"output": "YES"
},
{
"input": "5 6 1 5 1",
"output": "YES"
},
{
"input": "15 21 2 4 7",
"output": "YES"
},
{
"input": "4 5 3 7 1",
"output": "YES"
},
{
"input": "15 15 3 4 4",
"output": "NO"
},
{
"input": "3 6 1 2 2",
"output": "YES"
},
{
"input": "2 10 3 6 3",
"output": "YES"
},
{
"input": "1 10000000 1 10000000 100000",
"output": "YES"
},
{
"input": "8 13 1 2 7",
"output": "NO"
},
{
"input": "98112 98112 100000 100000 128850",
"output": "NO"
},
{
"input": "2 2 1 2 1",
"output": "YES"
},
{
"input": "8 8 3 4 2",
"output": "YES"
},
{
"input": "60 60 2 3 25",
"output": "NO"
},
{
"input": "16 17 2 5 5",
"output": "NO"
},
{
"input": "2 4 1 3 1",
"output": "YES"
},
{
"input": "4 5 1 2 3",
"output": "NO"
},
{
"input": "10 10 3 4 3",
"output": "NO"
},
{
"input": "10 10000000 999999 10000000 300",
"output": "NO"
},
{
"input": "100 120 9 11 10",
"output": "YES"
},
{
"input": "8 20 1 3 4",
"output": "YES"
},
{
"input": "10 14 2 3 4",
"output": "YES"
},
{
"input": "2000 2001 1 3 1000",
"output": "YES"
},
{
"input": "12 13 2 3 5",
"output": "NO"
},
{
"input": "7 7 2 3 3",
"output": "NO"
},
{
"input": "5 8 1 10000000 4",
"output": "YES"
},
{
"input": "5 5 1 1 4",
"output": "NO"
},
{
"input": "5 5 1 6 2",
"output": "NO"
},
{
"input": "200 300 4000381 4000382 4000381",
"output": "NO"
},
{
"input": "11 17 2 5 2",
"output": "NO"
},
{
"input": "9999999 10000000 1 10000000 999997",
"output": "NO"
},
{
"input": "7 8 2 3 3",
"output": "NO"
},
{
"input": "7 7 3 3 2",
"output": "NO"
},
{
"input": "15 15 2 3 7",
"output": "NO"
},
{
"input": "65408 65408 859 859 10000000",
"output": "NO"
},
{
"input": "1000000 10000000 1 100000 1",
"output": "NO"
},
{
"input": "6 12 2 3 2",
"output": "YES"
},
{
"input": "7 8 1 3 3",
"output": "NO"
},
{
"input": "4 4 1 2 2",
"output": "YES"
},
{
"input": "2 3 1 2 2",
"output": "YES"
},
{
"input": "11 14 2 3 5",
"output": "NO"
},
{
"input": "7 7 1 10 3",
"output": "NO"
},
{
"input": "49 50 1 2 27",
"output": "NO"
},
{
"input": "1 10000000 1 10000000 123456",
"output": "YES"
},
{
"input": "100000 10000000 100 10000000 100000",
"output": "YES"
},
{
"input": "17 19 2 3 8",
"output": "NO"
},
{
"input": "4 6 3 9 1",
"output": "YES"
},
{
"input": "19 20 6 7 3",
"output": "NO"
},
{
"input": "5000000 10000000 1 4999999 1",
"output": "NO"
}
] | 1,559,705,133 | 2,147,483,647 |
PyPy 3
|
WRONG_ANSWER
|
TESTS
| 0 | 93 | 0 |
l,r,x,y,k=map(int,input().split())
d=0
for n in range(x,y+1):
if l<=n*k<=r and (n*k)==int(n*k):
l=1
print('YES')
break
if d==0:
print('NO')
|
Title: Kirill And The Game
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Kirill plays a new computer game. He came to the potion store where he can buy any potion. Each potion is characterized by two integers — amount of experience and cost. The efficiency of a potion is the ratio of the amount of experience to the cost. Efficiency may be a non-integer number.
For each two integer numbers *a* and *b* such that *l*<=≤<=*a*<=≤<=*r* and *x*<=≤<=*b*<=≤<=*y* there is a potion with experience *a* and cost *b* in the store (that is, there are (*r*<=-<=*l*<=+<=1)·(*y*<=-<=*x*<=+<=1) potions).
Kirill wants to buy a potion which has efficiency *k*. Will he be able to do this?
Input Specification:
First string contains five integer numbers *l*, *r*, *x*, *y*, *k* (1<=≤<=*l*<=≤<=*r*<=≤<=107, 1<=≤<=*x*<=≤<=*y*<=≤<=107, 1<=≤<=*k*<=≤<=107).
Output Specification:
Print "YES" without quotes if a potion with efficiency exactly *k* can be bought in the store and "NO" without quotes otherwise.
You can output each of the letters in any register.
Demo Input:
['1 10 1 10 1\n', '1 5 6 10 1\n']
Demo Output:
['YES', 'NO']
Note:
none
|
```python
l,r,x,y,k=map(int,input().split())
d=0
for n in range(x,y+1):
if l<=n*k<=r and (n*k)==int(n*k):
l=1
print('YES')
break
if d==0:
print('NO')
```
| 0 |
|
702 |
A
|
Maximum Increase
|
PROGRAMMING
| 800 |
[
"dp",
"greedy",
"implementation"
] | null | null |
You are given array consisting of *n* integers. Your task is to find the maximum length of an increasing subarray of the given array.
A subarray is the sequence of consecutive elements of the array. Subarray is called increasing if each element of this subarray strictly greater than previous.
|
The first line contains single positive integer *n* (1<=≤<=*n*<=≤<=105) — the number of integers.
The second line contains *n* positive integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=109).
|
Print the maximum length of an increasing subarray of the given array.
|
[
"5\n1 7 2 11 15\n",
"6\n100 100 100 100 100 100\n",
"3\n1 2 3\n"
] |
[
"3\n",
"1\n",
"3\n"
] |
none
| 0 |
[
{
"input": "5\n1 7 2 11 15",
"output": "3"
},
{
"input": "6\n100 100 100 100 100 100",
"output": "1"
},
{
"input": "3\n1 2 3",
"output": "3"
},
{
"input": "1\n1000000000",
"output": "1"
},
{
"input": "10\n802030518 598196518 640274071 983359971 71550121 96204862 799843967 446173607 796619138 402690754",
"output": "3"
},
{
"input": "2\n2 1",
"output": "1"
},
{
"input": "5\n1 2 3 3 4",
"output": "3"
},
{
"input": "4\n1 2 2 3",
"output": "2"
},
{
"input": "3\n2 1 1",
"output": "1"
},
{
"input": "3\n1 2 1",
"output": "2"
},
{
"input": "1\n1",
"output": "1"
},
{
"input": "2\n1 2",
"output": "2"
},
{
"input": "3\n1 1 2",
"output": "2"
},
{
"input": "11\n1 2 3 1 2 3 2 1 2 3 4",
"output": "4"
},
{
"input": "9\n1 2 3 4 5 6 7 8 9",
"output": "9"
},
{
"input": "9\n1 1 1 1 1 1 1 1 1",
"output": "1"
},
{
"input": "3\n3 2 1",
"output": "1"
},
{
"input": "7\n1 2 3 4 5 6 7",
"output": "7"
},
{
"input": "1\n1234394",
"output": "1"
}
] | 1,692,610,736 | 2,147,483,647 |
PyPy 3
|
RUNTIME_ERROR
|
TESTS
| 0 | 78 | 2,048,000 |
for i in range(int(input())):
s=list(map(int, input().split()))
count=1
prev=0
for j in s:
if j > prev:
count+=1
else:
count=1
prev=j
if count > len(s):
print(len(s))
else:
print(count)
|
Title: Maximum Increase
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You are given array consisting of *n* integers. Your task is to find the maximum length of an increasing subarray of the given array.
A subarray is the sequence of consecutive elements of the array. Subarray is called increasing if each element of this subarray strictly greater than previous.
Input Specification:
The first line contains single positive integer *n* (1<=≤<=*n*<=≤<=105) — the number of integers.
The second line contains *n* positive integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=109).
Output Specification:
Print the maximum length of an increasing subarray of the given array.
Demo Input:
['5\n1 7 2 11 15\n', '6\n100 100 100 100 100 100\n', '3\n1 2 3\n']
Demo Output:
['3\n', '1\n', '3\n']
Note:
none
|
```python
for i in range(int(input())):
s=list(map(int, input().split()))
count=1
prev=0
for j in s:
if j > prev:
count+=1
else:
count=1
prev=j
if count > len(s):
print(len(s))
else:
print(count)
```
| -1 |
|
626 |
B
|
Cards
|
PROGRAMMING
| 1,300 |
[
"constructive algorithms",
"dp",
"math"
] | null | null |
Catherine has a deck of *n* cards, each of which is either red, green, or blue. As long as there are at least two cards left, she can do one of two actions:
- take any two (not necessarily adjacent) cards with different colors and exchange them for a new card of the third color; - take any two (not necessarily adjacent) cards with the same color and exchange them for a new card with that color.
She repeats this process until there is only one card left. What are the possible colors for the final card?
|
The first line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=200) — the total number of cards.
The next line contains a string *s* of length *n* — the colors of the cards. *s* contains only the characters 'B', 'G', and 'R', representing blue, green, and red, respectively.
|
Print a single string of up to three characters — the possible colors of the final card (using the same symbols as the input) in alphabetical order.
|
[
"2\nRB\n",
"3\nGRG\n",
"5\nBBBBB\n"
] |
[
"G\n",
"BR\n",
"B\n"
] |
In the first sample, Catherine has one red card and one blue card, which she must exchange for a green card.
In the second sample, Catherine has two green cards and one red card. She has two options: she can exchange the two green cards for a green card, then exchange the new green card and the red card for a blue card. Alternatively, she can exchange a green and a red card for a blue card, then exchange the blue card and remaining green card for a red card.
In the third sample, Catherine only has blue cards, so she can only exchange them for more blue cards.
| 750 |
[
{
"input": "2\nRB",
"output": "G"
},
{
"input": "3\nGRG",
"output": "BR"
},
{
"input": "5\nBBBBB",
"output": "B"
},
{
"input": "1\nR",
"output": "R"
},
{
"input": "200\nBBRGRRBBRGGGBGBGBGRRGRGRGRBGRGRRBBGRGBGRRGRRRGGBBRGBGBGBRBBBBBBBGGBRGGRRRGGRGBGBGGBRRRRBRRRBRBBGGBGBRGRGBBBBGGBGBBBGBGRRBRRRGBGGBBBRBGRBRRGGGRRGBBBGBGRRRRRRGGRGRGBBBRGGGBGGGBRBBRRGBGRGRBRRRBRBGRGGBRBB",
"output": "BGR"
},
{
"input": "101\nRRRRRRRRRRRRRRRRRRRBRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRR",
"output": "BG"
},
{
"input": "7\nBBBGBRG",
"output": "BGR"
},
{
"input": "5\nGRRGR",
"output": "BGR"
},
{
"input": "3\nGBR",
"output": "BGR"
},
{
"input": "1\nB",
"output": "B"
},
{
"input": "2\nBB",
"output": "B"
},
{
"input": "1\nG",
"output": "G"
},
{
"input": "2\nBG",
"output": "R"
},
{
"input": "3\nBGB",
"output": "GR"
},
{
"input": "2\nGG",
"output": "G"
},
{
"input": "3\nGBG",
"output": "BR"
},
{
"input": "4\nBGBG",
"output": "BGR"
},
{
"input": "1\nR",
"output": "R"
},
{
"input": "2\nBR",
"output": "G"
},
{
"input": "3\nBRB",
"output": "GR"
},
{
"input": "2\nRG",
"output": "B"
},
{
"input": "3\nBGR",
"output": "BGR"
},
{
"input": "4\nRBGB",
"output": "BGR"
},
{
"input": "3\nGGR",
"output": "BR"
},
{
"input": "4\nGGRB",
"output": "BGR"
},
{
"input": "5\nBGBGR",
"output": "BGR"
},
{
"input": "2\nRR",
"output": "R"
},
{
"input": "3\nRBR",
"output": "BG"
},
{
"input": "4\nRRBB",
"output": "BGR"
},
{
"input": "3\nRRG",
"output": "BG"
},
{
"input": "4\nBRRG",
"output": "BGR"
},
{
"input": "5\nRBRBG",
"output": "BGR"
},
{
"input": "4\nRGGR",
"output": "BGR"
},
{
"input": "5\nBRGRG",
"output": "BGR"
},
{
"input": "6\nGRRGBB",
"output": "BGR"
},
{
"input": "150\nGRGBBBBRBGGBGBBGBBBBGRBBRRBBGRRGGGBRBBRGRRRRGBGRRBGBGBGRBBBGBBBGBGBRGBRRRRRGGGRGRBBGBRGGGRBBRGBBGRGGGBBRBRRGRGRRGRRGRRRGBGBRRGGRGGBRBGGGBBBRGRGBRGRRRR",
"output": "BGR"
},
{
"input": "16\nRRGRRRRRRGGRGRRR",
"output": "BGR"
},
{
"input": "190\nBBBBBBBBBBBBBBBBBGBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB",
"output": "GR"
},
{
"input": "200\nRGRGRRRRRGRRGRRRGRGRRRGGRGRRGGGRRGGRRRRRRRRRRRGRRGRRRGRRRGRRRRRRRGRRRRRRRRRRRGGRRGGRRRRGGRRRRRRRRRGGGRGRGRGRRGRGGRGRGRRRGRRRRRRGGRGRRRRGRRGRGGRRRRRRRGRGGRRGRRRRRRRGGRRRRGRRRRRRRGRRRGGRRRRRRGRRGGGRRRGR",
"output": "BGR"
},
{
"input": "200\nGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG",
"output": "G"
},
{
"input": "52\nBBBBBBBBBBBBBBBBBBBBGBGBBBBBBBBBBBBBBBBBBBBBBBBBBBBB",
"output": "BGR"
},
{
"input": "200\nGRGRRGRBRRRGGGRGGRRRRRBBGRRGRBBGRRGBGRRBBRBBRRBBBGRBRGGGGBGGBRRBBRGRBGGRRGGBBRBGGRGBBRRBBRGBRRBGBRBGBBRGGRRRGGGBRGGGGRRRBBRRGRGRBRRGRBBGGRBBRGRGRBGRBBRGGBBBGRGBBGGBGBGBBRRBGRGRGGBRRGRGGGGGBRGGGGBBBBRB",
"output": "BGR"
},
{
"input": "102\nGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGBGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG",
"output": "BGR"
},
{
"input": "193\nRRRGGGRBGGBGGGBGGBBGRBGGRBGGBBRBGGRBBBRBRRGGBBRBRGRRRBGBBRGGRGGGBGGRRGGRGRRBRBRBRRGRGBGBRGBBRGRRRBGRGGBGBRBBBGBRBBGBGBGGGBGGGGBRBBRRBGRGGBBBRBBBBBGRRRGBRGBRRRBBBGBGGGGRGGRRBRBGRRGBGBRBGGGRBRRGG",
"output": "BGR"
},
{
"input": "90\nBGBGGRRBGGRRRRRGGRGBBBBBRRBGBGBGBGGBBGRGGGGRBRBBRRRGBRRGBBGBBGGGRGRGRBGBBBRRGRRBRBRRGGRBRB",
"output": "BGR"
},
{
"input": "3\nGGB",
"output": "BR"
}
] | 1,675,385,247 | 2,147,483,647 |
Python 3
|
WRONG_ANSWER
|
TESTS
| 6 | 46 | 0 |
a = int(input())
list1 = list(input())
r = list1.count('R')
g = list1.count('G')
b = list1.count('B')
if r > 1 and g > 1 and b > 1:
print('BGR')
else:
if r >= 1 and b == 0 and g == 0:
print('R')
else:
if r == 0 and b >= 1 and g == 0:
print('B')
else:
if r == 0 and b == 0 and g >= 1:
print('G')
else:
if r == 1 and g == 1:
print('B')
else:
if r == 1 and b == 1:
print('G')
else:
if g == 1 and b == 1:
print('R')
else:
if r > 1 and g == 1 or r > 1 and b == 1:
print('BG')
else:
if g > 1 and b == 1 or g > 1 and r == 1:
print('BR')
else:
if b > 1 and g == 1 or b > 1 and r == 1:
print('GR')
|
Title: Cards
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Catherine has a deck of *n* cards, each of which is either red, green, or blue. As long as there are at least two cards left, she can do one of two actions:
- take any two (not necessarily adjacent) cards with different colors and exchange them for a new card of the third color; - take any two (not necessarily adjacent) cards with the same color and exchange them for a new card with that color.
She repeats this process until there is only one card left. What are the possible colors for the final card?
Input Specification:
The first line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=200) — the total number of cards.
The next line contains a string *s* of length *n* — the colors of the cards. *s* contains only the characters 'B', 'G', and 'R', representing blue, green, and red, respectively.
Output Specification:
Print a single string of up to three characters — the possible colors of the final card (using the same symbols as the input) in alphabetical order.
Demo Input:
['2\nRB\n', '3\nGRG\n', '5\nBBBBB\n']
Demo Output:
['G\n', 'BR\n', 'B\n']
Note:
In the first sample, Catherine has one red card and one blue card, which she must exchange for a green card.
In the second sample, Catherine has two green cards and one red card. She has two options: she can exchange the two green cards for a green card, then exchange the new green card and the red card for a blue card. Alternatively, she can exchange a green and a red card for a blue card, then exchange the blue card and remaining green card for a red card.
In the third sample, Catherine only has blue cards, so she can only exchange them for more blue cards.
|
```python
a = int(input())
list1 = list(input())
r = list1.count('R')
g = list1.count('G')
b = list1.count('B')
if r > 1 and g > 1 and b > 1:
print('BGR')
else:
if r >= 1 and b == 0 and g == 0:
print('R')
else:
if r == 0 and b >= 1 and g == 0:
print('B')
else:
if r == 0 and b == 0 and g >= 1:
print('G')
else:
if r == 1 and g == 1:
print('B')
else:
if r == 1 and b == 1:
print('G')
else:
if g == 1 and b == 1:
print('R')
else:
if r > 1 and g == 1 or r > 1 and b == 1:
print('BG')
else:
if g > 1 and b == 1 or g > 1 and r == 1:
print('BR')
else:
if b > 1 and g == 1 or b > 1 and r == 1:
print('GR')
```
| 0 |
|
44 |
E
|
Anfisa the Monkey
|
PROGRAMMING
| 1,400 |
[
"dp"
] |
E. Anfisa the Monkey
|
2
|
256
|
Anfisa the monkey learns to type. She is yet unfamiliar with the "space" key and can only type in lower-case Latin letters. Having typed for a fairly long line, Anfisa understood that it would be great to divide what she has written into *k* lines not shorter than *a* and not longer than *b*, for the text to resemble human speech more. Help Anfisa.
|
The first line contains three integers *k*, *a* and *b* (1<=≤<=*k*<=≤<=200, 1<=≤<=*a*<=≤<=*b*<=≤<=200). The second line contains a sequence of lowercase Latin letters — the text typed by Anfisa. It is guaranteed that the given line is not empty and its length does not exceed 200 symbols.
|
Print *k* lines, each of which contains no less than *a* and no more than *b* symbols — Anfisa's text divided into lines. It is not allowed to perform any changes in the text, such as: deleting or adding symbols, changing their order, etc. If the solution is not unique, print any of them. If there is no solution, print "No solution" (without quotes).
|
[
"3 2 5\nabrakadabra\n",
"4 1 2\nabrakadabra\n"
] |
[
"ab\nrakad\nabra\n",
"No solution\n"
] |
none
| 0 |
[
{
"input": "3 2 5\nabrakadabra",
"output": "abra\nkada\nbra"
},
{
"input": "4 1 2\nabrakadabra",
"output": "No solution"
},
{
"input": "3 1 2\nvgnfpo",
"output": "vg\nnf\npo"
},
{
"input": "5 3 4\nvrrdnhazvexzjfv",
"output": "vrr\ndnh\nazv\nexz\njfv"
},
{
"input": "10 12 15\nctxgddcfdtllmpuxsjkubuqpldznulsilueakbwwlzgeyudyrjachmitfdcgyzszoejphrubpxzpdtgexaqpxgnoxwfjoikljudnoucirussumyhetfwgaoxfbugfiyjmp",
"output": "ctxgddcfdtllm\npuxsjkubuqpld\nznulsilueakbw\nwlzgeyudyrjac\nhmitfdcgyzszo\nejphrubpxzpdt\ngexaqpxgnoxwf\njoikljudnouci\nrussumyhetfwg\naoxfbugfiyjmp"
},
{
"input": "10 20 30\nbvdqvlxiyogiyimdlwdyxsummjgqxaxsucfeuegleetybsylpnepkqzbutibtlgqrbjbwqnvkysxftmsjqkczoploxoqfuwyrufzwwsxpcqfuckjainpphpbvvtllgkljnnoibsvwnxvaksxjrffakpoxwkhjjjemqatbfkmmlmjhhroetlqvfaumctbicqkuxaabpsh",
"output": "bvdqvlxiyogiyimdlwdy\nxsummjgqxaxsucfeuegl\neetybsylpnepkqzbutib\ntlgqrbjbwqnvkysxftms\njqkczoploxoqfuwyrufz\nwwsxpcqfuckjainpphpb\nvvtllgkljnnoibsvwnxv\naksxjrffakpoxwkhjjje\nmqatbfkmmlmjhhroetlq\nvfaumctbicqkuxaabpsh"
},
{
"input": "10 1 200\nolahgjusovchbowjxtwzvjakrktyjqcgkqmcxknjchzxcvbnkbakwnxdouebomyhjsrfsicmzsgdweabbuipbzrhuqfpynybaohzquqbbsqpoaskccszzsmnfleevtasmjuwqgcqtvysohvyutqipnvuhjumwwyytkeuebbncxsnpavwdkoxyycqrhcidf",
"output": "olahgjusovchbowjxtw\nzvjakrktyjqcgkqmcxk\nnjchzxcvbnkbakwnxdo\nuebomyhjsrfsicmzsgd\nweabbuipbzrhuqfpyny\nbaohzquqbbsqpoaskcc\nszzsmnfleevtasmjuwq\ngcqtvysohvyutqipnvu\nhjumwwyytkeuebbncxs\nnpavwdkoxyycqrhcidf"
},
{
"input": "30 3 6\nebdgacrmhfldirwrcfadurngearrfyjiqkmfqmgzpnzcpprkjyeuuppzvmibzzwyouhxclcgqtjhjmucypqnhdaqke",
"output": "ebd\ngac\nrmh\nfld\nirw\nrcf\nadu\nrng\near\nrfy\njiq\nkmf\nqmg\nzpn\nzcp\nprk\njye\nuup\npzv\nmib\nzzw\nyou\nhxc\nlcg\nqtj\nhjm\nucy\npqn\nhda\nqke"
},
{
"input": "200 1 200\nlycjpjrpkgxrkfvutlcwglghxadttpihmlpphwfttegfpimjxintjdxgqfhzrmxfcfojnxruhyfynlzgpxjeobjyxarsfxaqeogxfzvdlwsimupkwujudtfenryulzvsiazneyibqtweeuxpzrbumqqswjasliyjnnzfzuvthhzcsgfljikkajqkpjftztrzpjneaxqg",
"output": "l\ny\nc\nj\np\nj\nr\np\nk\ng\nx\nr\nk\nf\nv\nu\nt\nl\nc\nw\ng\nl\ng\nh\nx\na\nd\nt\nt\np\ni\nh\nm\nl\np\np\nh\nw\nf\nt\nt\ne\ng\nf\np\ni\nm\nj\nx\ni\nn\nt\nj\nd\nx\ng\nq\nf\nh\nz\nr\nm\nx\nf\nc\nf\no\nj\nn\nx\nr\nu\nh\ny\nf\ny\nn\nl\nz\ng\np\nx\nj\ne\no\nb\nj\ny\nx\na\nr\ns\nf\nx\na\nq\ne\no\ng\nx\nf\nz\nv\nd\nl\nw\ns\ni\nm\nu\np\nk\nw\nu\nj\nu\nd\nt\nf\ne\nn\nr\ny\nu\nl\nz\nv\ns\ni\na\nz\nn\ne\ny\ni\nb\nq\nt\nw\ne\ne\nu\nx\np\nz\nr\nb\nu\nm\nq\nq\ns\nw\nj\na\ns\nl\ni\ny\nj\nn\nn\nz\nf\nz\nu\nv\nt\nh\nh\nz..."
},
{
"input": "15 3 4\naronayjutjdhjcelgexgalnyiruevjelvcvzaihgbwwrc",
"output": "aro\nnay\njut\njdh\njce\nlge\nxga\nlny\niru\nevj\nelv\ncvz\naih\ngbw\nwrc"
},
{
"input": "7 3 4\nweoghhroclwslkfcsszplh",
"output": "weog\nhhr\nocl\nwsl\nkfc\nssz\nplh"
},
{
"input": "12 2 5\nozgscnrddhejkhllokmafxcuorxryhvqnkikauclhfbddfoxl",
"output": "ozgsc\nnrdd\nhejk\nhllo\nkmaf\nxcuo\nrxry\nhvqn\nkika\nuclh\nfbdd\nfoxl"
},
{
"input": "3 1 2\nfpos",
"output": "fp\no\ns"
},
{
"input": "5 3 4\nvrrdnhazvexzjfvs",
"output": "vrrd\nnha\nzve\nxzj\nfvs"
},
{
"input": "10 12 15\nllmpuxsjkubuqpldznulsilueakbwwlzgeyudyrjachmitfdcgyzszoejphrubpxzpdtgexaqpxgnoxwfjoikljudnoucirussumyhetfwgaoxfbugfiyjmpm",
"output": "llmpuxsjkubuq\npldznulsilue\nakbwwlzgeyud\nyrjachmitfdc\ngyzszoejphru\nbpxzpdtgexaq\npxgnoxwfjoik\nljudnoucirus\nsumyhetfwgao\nxfbugfiyjmpm"
},
{
"input": "10 20 30\nvdqvlxiyogiyimdlwdyxsummjgqxaxsucfeuegleetybsylpnepkqzbutibtlgqrbjbwqnvkysxftmsjqkczoploxoqfuwyrufzwwsxpcqfuckjainpphpbvvtllgkljnnoibsvwnxvaksxjrffakpoxwkhjjjemqatbfkmmlmjhhroetlqvfaumctbicqkuxaabpshu",
"output": "vdqvlxiyogiyimdlwdyx\nsummjgqxaxsucfeuegle\netybsylpnepkqzbutibt\nlgqrbjbwqnvkysxftmsj\nqkczoploxoqfuwyrufzw\nwsxpcqfuckjainpphpbv\nvtllgkljnnoibsvwnxva\nksxjrffakpoxwkhjjjem\nqatbfkmmlmjhhroetlqv\nfaumctbicqkuxaabpshu"
},
{
"input": "10 1 200\nolahgjusovchbowjxtwzvjakrktyjqcgkqmcxknjchzxcvbnkbakwnxdouebomyhjsrfsicmzsgdweabbuipbzrhuqfpynybaohzquqbbsqpoaskccszzsmnfleevtasmjuwqgcqtvysohvyutqipnvuhjumwwyytkeuebbncxsnpavwdkoxyycqrhcidfd",
"output": "olahgjusovchbowjxtwz\nvjakrktyjqcgkqmcxkn\njchzxcvbnkbakwnxdou\nebomyhjsrfsicmzsgdw\neabbuipbzrhuqfpynyb\naohzquqbbsqpoaskccs\nzzsmnfleevtasmjuwqg\ncqtvysohvyutqipnvuh\njumwwyytkeuebbncxsn\npavwdkoxyycqrhcidfd"
},
{
"input": "30 3 6\nhstvoyuksbbsbgatemzmvbhbjdmnzpluefgzlcqgfsmkdydadsonaryzskleebdgacrmhfldirwrcfadurngearrfyjiqkmfqmgzpnzcpprkjyeuuppzvmibzzwyouhxclcgqtjhjmucypqnhdaqkea",
"output": "hstvoy\nuksbb\nsbgat\nemzmv\nbhbjd\nmnzpl\nuefgz\nlcqgf\nsmkdy\ndadso\nnaryz\nsklee\nbdgac\nrmhfl\ndirwr\ncfadu\nrngea\nrrfyj\niqkmf\nqmgzp\nnzcpp\nrkjye\nuuppz\nvmibz\nzwyou\nhxclc\ngqtjh\njmucy\npqnhd\naqkea"
},
{
"input": "200 1 200\nycjpjrpkgxrkfvutlcwglghxadttpihmlpphwfttegfpimjxintjdxgqfhzrmxfcfojnxruhyfynlzgpxjeobjyxarsfxaqeogxfzvdlwsimupkwujudtfenryulzvsiazneyibqtweeuxpzrbumqqswjasliyjnnzfzuvthhzcsgfljikkajqkpjftztrzpjneaxqgn",
"output": "y\nc\nj\np\nj\nr\np\nk\ng\nx\nr\nk\nf\nv\nu\nt\nl\nc\nw\ng\nl\ng\nh\nx\na\nd\nt\nt\np\ni\nh\nm\nl\np\np\nh\nw\nf\nt\nt\ne\ng\nf\np\ni\nm\nj\nx\ni\nn\nt\nj\nd\nx\ng\nq\nf\nh\nz\nr\nm\nx\nf\nc\nf\no\nj\nn\nx\nr\nu\nh\ny\nf\ny\nn\nl\nz\ng\np\nx\nj\ne\no\nb\nj\ny\nx\na\nr\ns\nf\nx\na\nq\ne\no\ng\nx\nf\nz\nv\nd\nl\nw\ns\ni\nm\nu\np\nk\nw\nu\nj\nu\nd\nt\nf\ne\nn\nr\ny\nu\nl\nz\nv\ns\ni\na\nz\nn\ne\ny\ni\nb\nq\nt\nw\ne\ne\nu\nx\np\nz\nr\nb\nu\nm\nq\nq\ns\nw\nj\na\ns\nl\ni\ny\nj\nn\nn\nz\nf\nz\nu\nv\nt\nh\nh\nz\nc..."
},
{
"input": "15 3 4\naronayjutjdhjcelgexgalnyiruevjelvcvzaihgbwwrcq",
"output": "aron\nayj\nutj\ndhj\ncel\ngex\ngal\nnyi\nrue\nvje\nlvc\nvza\nihg\nbww\nrcq"
},
{
"input": "200 1 10\njtlykeyfekfrzbpzrhvrxagzywzlsktyzoriwiyatoetikfnhyhlrhuogyhjrxdmlqvpfsmqiqkivtodligzerymdtnqahuprhbfefbjwuavmpkurtfzmwediq",
"output": "No solution"
},
{
"input": "15 2 3\ndplkzxpsxodehcj",
"output": "No solution"
},
{
"input": "100 100 200\nximcxraplfjygtrpxrgjhqagrojixizlogaqfvwvqjaiqvcimelxtmtcsqluvcrdzhihgmwhywfgxmzmikdqdytfrlpzqmvhaexrtflwacsuxhkuzbukgvbdcmwpcvxwznupsmmryxwexlevjlonpipuxjgagxtcgqjdczrnmktgcaagmiumnbcxuafmysisahaqnngc",
"output": "No solution"
},
{
"input": "7 2 3\nggzkinj",
"output": "No solution"
},
{
"input": "17 2 4\npgyujupquzenuldnt",
"output": "No solution"
},
{
"input": "100 1 1\nratfdjnvjmaqgcttjtenixeocyxrtuwhpmejhpxjcqhzjsujqolgcccmvnpoomkrforsdtvhgrcpakibozhgqotcrctzozhggrufk",
"output": "No solution"
},
{
"input": "50 2 3\nizlszyucwjarrrgxzbfzyoxapozmunxuygfjynslcjnxitimjjklucjowtkccbnfsuwtyroxirhxzosbyhvnrroaxryhcvvcjvwfcpvnpdaqwzaiuzycyrtvkgkjfbdqnzrmritaonptpvncdifushrquywzykybhjdplbmsrgibpknxkxkqqywmkeljpxrrmufpkubv",
"output": "No solution"
},
{
"input": "15 2 5\nkddainaviqrjsesrhhdnbuisennbgcxseeyxqtmautpoobtpfigcpgagcixmyzsntmgzwmiczsfp",
"output": "No solution"
},
{
"input": "3 1 50\nhcdonseimahtfmtejvxebwctfkjsrcqjrunpcofrapijvwmmbbbrohkskjomeknlwkdxscybxkintcaynwyjfaghwcofpsbwruzqqqkhyndbxbdpgqokjqitznnnrfuaciriqmyuvktpdxewkrycjefkmjwglhoggpgvztvqndbhiajryxqlrqdb",
"output": "No solution"
},
{
"input": "5 1 30\nxmuatgstrlkerxzezenrauupxiskpfugncncatcgtffhuwzojuapgrevnwzfkpyzbzljbzwvfoeuqhinyravsfqrjmgidjoszvkkhxrdstmydvbertvzltpipmcuakzqflldztzdjqlicvadgpicqio",
"output": "No solution"
},
{
"input": "5 2 3\nabacababb",
"output": "No solution"
},
{
"input": "5 6 6\nabacabadabacabaabacabadabacab",
"output": "No solution"
}
] | 1,569,875,841 | 2,147,483,647 |
Python 3
|
OK
|
TESTS
| 32 | 218 | 0 |
k,a,b=map(int,input().split())
ss=input()
h=len(ss)
q,r=divmod(h,k)
if q<a or q>b or (q==b and r>0):
print('No solution')
else:
i=0
while r>0:
print(ss[i:i+q+1])
r-=1
i=i+q+1
while i<h:
print(ss[i:i+q])
i=i+q
|
Title: Anfisa the Monkey
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Anfisa the monkey learns to type. She is yet unfamiliar with the "space" key and can only type in lower-case Latin letters. Having typed for a fairly long line, Anfisa understood that it would be great to divide what she has written into *k* lines not shorter than *a* and not longer than *b*, for the text to resemble human speech more. Help Anfisa.
Input Specification:
The first line contains three integers *k*, *a* and *b* (1<=≤<=*k*<=≤<=200, 1<=≤<=*a*<=≤<=*b*<=≤<=200). The second line contains a sequence of lowercase Latin letters — the text typed by Anfisa. It is guaranteed that the given line is not empty and its length does not exceed 200 symbols.
Output Specification:
Print *k* lines, each of which contains no less than *a* and no more than *b* symbols — Anfisa's text divided into lines. It is not allowed to perform any changes in the text, such as: deleting or adding symbols, changing their order, etc. If the solution is not unique, print any of them. If there is no solution, print "No solution" (without quotes).
Demo Input:
['3 2 5\nabrakadabra\n', '4 1 2\nabrakadabra\n']
Demo Output:
['ab\nrakad\nabra\n', 'No solution\n']
Note:
none
|
```python
k,a,b=map(int,input().split())
ss=input()
h=len(ss)
q,r=divmod(h,k)
if q<a or q>b or (q==b and r>0):
print('No solution')
else:
i=0
while r>0:
print(ss[i:i+q+1])
r-=1
i=i+q+1
while i<h:
print(ss[i:i+q])
i=i+q
```
| 3.9455 |
439 |
B
|
Devu, the Dumb Guy
|
PROGRAMMING
| 1,200 |
[
"implementation",
"sortings"
] | null | null |
Devu is a dumb guy, his learning curve is very slow. You are supposed to teach him *n* subjects, the *i**th* subject has *c**i* chapters. When you teach him, you are supposed to teach all the chapters of a subject continuously.
Let us say that his initial per chapter learning power of a subject is *x* hours. In other words he can learn a chapter of a particular subject in *x* hours.
Well Devu is not complete dumb, there is a good thing about him too. If you teach him a subject, then time required to teach any chapter of the next subject will require exactly 1 hour less than previously required (see the examples to understand it more clearly). Note that his per chapter learning power can not be less than 1 hour.
You can teach him the *n* subjects in any possible order. Find out minimum amount of time (in hours) Devu will take to understand all the subjects and you will be free to do some enjoying task rather than teaching a dumb guy.
Please be careful that answer might not fit in 32 bit data type.
|
The first line will contain two space separated integers *n*, *x* (1<=≤<=*n*,<=*x*<=≤<=105). The next line will contain *n* space separated integers: *c*1,<=*c*2,<=...,<=*c**n* (1<=≤<=*c**i*<=≤<=105).
|
Output a single integer representing the answer to the problem.
|
[
"2 3\n4 1\n",
"4 2\n5 1 2 1\n",
"3 3\n1 1 1\n"
] |
[
"11\n",
"10\n",
"6\n"
] |
Look at the first example. Consider the order of subjects: 1, 2. When you teach Devu the first subject, it will take him 3 hours per chapter, so it will take 12 hours to teach first subject. After teaching first subject, his per chapter learning time will be 2 hours. Now teaching him second subject will take 2 × 1 = 2 hours. Hence you will need to spend 12 + 2 = 14 hours.
Consider the order of subjects: 2, 1. When you teach Devu the second subject, then it will take him 3 hours per chapter, so it will take 3 × 1 = 3 hours to teach the second subject. After teaching the second subject, his per chapter learning time will be 2 hours. Now teaching him the first subject will take 2 × 4 = 8 hours. Hence you will need to spend 11 hours.
So overall, minimum of both the cases is 11 hours.
Look at the third example. The order in this example doesn't matter. When you teach Devu the first subject, it will take him 3 hours per chapter. When you teach Devu the second subject, it will take him 2 hours per chapter. When you teach Devu the third subject, it will take him 1 hours per chapter. In total it takes 6 hours.
| 1,000 |
[
{
"input": "2 3\n4 1",
"output": "11"
},
{
"input": "4 2\n5 1 2 1",
"output": "10"
},
{
"input": "3 3\n1 1 1",
"output": "6"
},
{
"input": "20 4\n1 1 3 5 5 1 3 4 2 5 2 4 3 1 3 3 3 3 4 3",
"output": "65"
},
{
"input": "20 10\n6 6 1 2 6 4 5 3 6 5 4 5 6 5 4 6 6 2 3 3",
"output": "196"
},
{
"input": "1 1\n9273",
"output": "9273"
},
{
"input": "1 1\n1",
"output": "1"
},
{
"input": "1 2\n1",
"output": "2"
},
{
"input": "1 2\n2",
"output": "4"
},
{
"input": "2 1\n1 2",
"output": "3"
}
] | 1,555,428,743 | 2,147,483,647 |
Python 3
|
OK
|
TESTS
| 31 | 217 | 7,680,000 |
n,x=map(int,input().split())
listsub=sorted(map(int,input().split()))
ketqua=0
for i in listsub:
ketqua+=i*x
x=max(x-1,1)
print(ketqua)
|
Title: Devu, the Dumb Guy
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Devu is a dumb guy, his learning curve is very slow. You are supposed to teach him *n* subjects, the *i**th* subject has *c**i* chapters. When you teach him, you are supposed to teach all the chapters of a subject continuously.
Let us say that his initial per chapter learning power of a subject is *x* hours. In other words he can learn a chapter of a particular subject in *x* hours.
Well Devu is not complete dumb, there is a good thing about him too. If you teach him a subject, then time required to teach any chapter of the next subject will require exactly 1 hour less than previously required (see the examples to understand it more clearly). Note that his per chapter learning power can not be less than 1 hour.
You can teach him the *n* subjects in any possible order. Find out minimum amount of time (in hours) Devu will take to understand all the subjects and you will be free to do some enjoying task rather than teaching a dumb guy.
Please be careful that answer might not fit in 32 bit data type.
Input Specification:
The first line will contain two space separated integers *n*, *x* (1<=≤<=*n*,<=*x*<=≤<=105). The next line will contain *n* space separated integers: *c*1,<=*c*2,<=...,<=*c**n* (1<=≤<=*c**i*<=≤<=105).
Output Specification:
Output a single integer representing the answer to the problem.
Demo Input:
['2 3\n4 1\n', '4 2\n5 1 2 1\n', '3 3\n1 1 1\n']
Demo Output:
['11\n', '10\n', '6\n']
Note:
Look at the first example. Consider the order of subjects: 1, 2. When you teach Devu the first subject, it will take him 3 hours per chapter, so it will take 12 hours to teach first subject. After teaching first subject, his per chapter learning time will be 2 hours. Now teaching him second subject will take 2 × 1 = 2 hours. Hence you will need to spend 12 + 2 = 14 hours.
Consider the order of subjects: 2, 1. When you teach Devu the second subject, then it will take him 3 hours per chapter, so it will take 3 × 1 = 3 hours to teach the second subject. After teaching the second subject, his per chapter learning time will be 2 hours. Now teaching him the first subject will take 2 × 4 = 8 hours. Hence you will need to spend 11 hours.
So overall, minimum of both the cases is 11 hours.
Look at the third example. The order in this example doesn't matter. When you teach Devu the first subject, it will take him 3 hours per chapter. When you teach Devu the second subject, it will take him 2 hours per chapter. When you teach Devu the third subject, it will take him 1 hours per chapter. In total it takes 6 hours.
|
```python
n,x=map(int,input().split())
listsub=sorted(map(int,input().split()))
ketqua=0
for i in listsub:
ketqua+=i*x
x=max(x-1,1)
print(ketqua)
```
| 3 |
|
381 |
A
|
Sereja and Dima
|
PROGRAMMING
| 800 |
[
"greedy",
"implementation",
"two pointers"
] | null | null |
Sereja and Dima play a game. The rules of the game are very simple. The players have *n* cards in a row. Each card contains a number, all numbers on the cards are distinct. The players take turns, Sereja moves first. During his turn a player can take one card: either the leftmost card in a row, or the rightmost one. The game ends when there is no more cards. The player who has the maximum sum of numbers on his cards by the end of the game, wins.
Sereja and Dima are being greedy. Each of them chooses the card with the larger number during his move.
Inna is a friend of Sereja and Dima. She knows which strategy the guys are using, so she wants to determine the final score, given the initial state of the game. Help her.
|
The first line contains integer *n* (1<=≤<=*n*<=≤<=1000) — the number of cards on the table. The second line contains space-separated numbers on the cards from left to right. The numbers on the cards are distinct integers from 1 to 1000.
|
On a single line, print two integers. The first number is the number of Sereja's points at the end of the game, the second number is the number of Dima's points at the end of the game.
|
[
"4\n4 1 2 10\n",
"7\n1 2 3 4 5 6 7\n"
] |
[
"12 5\n",
"16 12\n"
] |
In the first sample Sereja will take cards with numbers 10 and 2, so Sereja's sum is 12. Dima will take cards with numbers 4 and 1, so Dima's sum is 5.
| 500 |
[
{
"input": "4\n4 1 2 10",
"output": "12 5"
},
{
"input": "7\n1 2 3 4 5 6 7",
"output": "16 12"
},
{
"input": "42\n15 29 37 22 16 5 26 31 6 32 19 3 45 36 33 14 25 20 48 7 42 11 24 28 9 18 8 21 47 17 38 40 44 4 35 1 43 39 41 27 12 13",
"output": "613 418"
},
{
"input": "43\n32 1 15 48 38 26 25 14 20 44 11 30 3 42 49 19 18 46 5 45 10 23 34 9 29 41 2 52 6 17 35 4 50 22 33 51 7 28 47 13 39 37 24",
"output": "644 500"
},
{
"input": "1\n3",
"output": "3 0"
},
{
"input": "45\n553 40 94 225 415 471 126 190 647 394 515 303 189 159 308 6 139 132 326 78 455 75 85 295 135 613 360 614 351 228 578 259 258 591 444 29 33 463 561 174 368 183 140 168 646",
"output": "6848 6568"
},
{
"input": "44\n849 373 112 307 479 608 856 769 526 82 168 143 573 762 115 501 688 36 214 450 396 496 236 309 287 786 397 43 811 141 745 846 350 270 276 677 420 459 403 722 267 54 394 727",
"output": "9562 9561"
},
{
"input": "35\n10 15 18 1 28 16 2 33 6 22 23 4 9 25 35 8 7 26 3 20 30 14 31 19 27 32 11 5 29 24 21 34 13 17 12",
"output": "315 315"
},
{
"input": "17\n580 376 191 496 73 44 520 357 483 149 81 178 514 300 216 598 304",
"output": "3238 2222"
},
{
"input": "30\n334 443 223 424 168 549 189 303 429 559 516 220 459 134 344 346 316 446 209 148 487 526 69 286 102 366 518 280 392 325",
"output": "5246 4864"
},
{
"input": "95\n122 29 188 265 292 287 183 225 222 187 155 256 64 148 173 278 218 136 290 17 31 130 2 87 57 283 255 280 68 166 174 142 102 39 116 206 288 154 26 78 296 172 184 232 77 91 277 8 249 186 94 93 207 251 257 195 101 299 193 124 293 65 58 35 24 302 220 189 252 125 27 284 247 182 141 103 198 97 234 83 281 216 85 180 267 236 109 143 149 239 79 300 191 244 71",
"output": "8147 7807"
},
{
"input": "1\n1",
"output": "1 0"
}
] | 1,691,230,917 | 2,147,483,647 |
Python 3
|
WRONG_ANSWER
|
TESTS
| 0 | 15 | 0 |
n=int(input())
li=list(map(int,input().split()))
c=0
sc=0
dc=0
for i in li:
if li[0]>li[-1]:
k=li.pop(0)
else:
k=li.pop(-1)
if c%2==0:
sc+=k
else:
dc+=k
print(sc,dc)
|
Title: Sereja and Dima
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Sereja and Dima play a game. The rules of the game are very simple. The players have *n* cards in a row. Each card contains a number, all numbers on the cards are distinct. The players take turns, Sereja moves first. During his turn a player can take one card: either the leftmost card in a row, or the rightmost one. The game ends when there is no more cards. The player who has the maximum sum of numbers on his cards by the end of the game, wins.
Sereja and Dima are being greedy. Each of them chooses the card with the larger number during his move.
Inna is a friend of Sereja and Dima. She knows which strategy the guys are using, so she wants to determine the final score, given the initial state of the game. Help her.
Input Specification:
The first line contains integer *n* (1<=≤<=*n*<=≤<=1000) — the number of cards on the table. The second line contains space-separated numbers on the cards from left to right. The numbers on the cards are distinct integers from 1 to 1000.
Output Specification:
On a single line, print two integers. The first number is the number of Sereja's points at the end of the game, the second number is the number of Dima's points at the end of the game.
Demo Input:
['4\n4 1 2 10\n', '7\n1 2 3 4 5 6 7\n']
Demo Output:
['12 5\n', '16 12\n']
Note:
In the first sample Sereja will take cards with numbers 10 and 2, so Sereja's sum is 12. Dima will take cards with numbers 4 and 1, so Dima's sum is 5.
|
```python
n=int(input())
li=list(map(int,input().split()))
c=0
sc=0
dc=0
for i in li:
if li[0]>li[-1]:
k=li.pop(0)
else:
k=li.pop(-1)
if c%2==0:
sc+=k
else:
dc+=k
print(sc,dc)
```
| 0 |
|
485 |
A
|
Factory
|
PROGRAMMING
| 1,400 |
[
"implementation",
"math",
"matrices"
] | null | null |
One industrial factory is reforming working plan. The director suggested to set a mythical detail production norm. If at the beginning of the day there were *x* details in the factory storage, then by the end of the day the factory has to produce (remainder after dividing *x* by *m*) more details. Unfortunately, no customer has ever bought any mythical detail, so all the details produced stay on the factory.
The board of directors are worried that the production by the given plan may eventually stop (that means that there will be а moment when the current number of details on the factory is divisible by *m*).
Given the number of details *a* on the first day and number *m* check if the production stops at some moment.
|
The first line contains two integers *a* and *m* (1<=≤<=*a*,<=*m*<=≤<=105).
|
Print "Yes" (without quotes) if the production will eventually stop, otherwise print "No".
|
[
"1 5\n",
"3 6\n"
] |
[
"No\n",
"Yes\n"
] |
none
| 1,000 |
[
{
"input": "1 5",
"output": "No"
},
{
"input": "3 6",
"output": "Yes"
},
{
"input": "1 8",
"output": "Yes"
},
{
"input": "2 3",
"output": "No"
},
{
"input": "3 24",
"output": "Yes"
},
{
"input": "1 1",
"output": "Yes"
},
{
"input": "100000 100000",
"output": "Yes"
},
{
"input": "1 99989",
"output": "No"
},
{
"input": "512 2",
"output": "Yes"
},
{
"input": "100 24",
"output": "No"
},
{
"input": "1 100000",
"output": "No"
},
{
"input": "100000 1",
"output": "Yes"
},
{
"input": "3 99929",
"output": "No"
},
{
"input": "99961 99971",
"output": "No"
},
{
"input": "1 65536",
"output": "Yes"
},
{
"input": "4 65536",
"output": "Yes"
},
{
"input": "3 65536",
"output": "Yes"
},
{
"input": "32768 65536",
"output": "Yes"
},
{
"input": "65535 65536",
"output": "Yes"
},
{
"input": "1 65535",
"output": "No"
},
{
"input": "98812 100000",
"output": "No"
},
{
"input": "10 5",
"output": "Yes"
},
{
"input": "6 8",
"output": "Yes"
}
] | 1,667,767,866 | 2,147,483,647 |
Python 3
|
OK
|
TESTS
| 23 | 93 | 0 |
# factory
arr = input().split()
a = int(arr[0])
m = int(arr[1])
contador = 0
while True:
resto = a%m
if resto == 0:
print('Yes')
break
elif contador >= (10**5)+1:
print('No')
break
a += resto
contador += 1
|
Title: Factory
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
One industrial factory is reforming working plan. The director suggested to set a mythical detail production norm. If at the beginning of the day there were *x* details in the factory storage, then by the end of the day the factory has to produce (remainder after dividing *x* by *m*) more details. Unfortunately, no customer has ever bought any mythical detail, so all the details produced stay on the factory.
The board of directors are worried that the production by the given plan may eventually stop (that means that there will be а moment when the current number of details on the factory is divisible by *m*).
Given the number of details *a* on the first day and number *m* check if the production stops at some moment.
Input Specification:
The first line contains two integers *a* and *m* (1<=≤<=*a*,<=*m*<=≤<=105).
Output Specification:
Print "Yes" (without quotes) if the production will eventually stop, otherwise print "No".
Demo Input:
['1 5\n', '3 6\n']
Demo Output:
['No\n', 'Yes\n']
Note:
none
|
```python
# factory
arr = input().split()
a = int(arr[0])
m = int(arr[1])
contador = 0
while True:
resto = a%m
if resto == 0:
print('Yes')
break
elif contador >= (10**5)+1:
print('No')
break
a += resto
contador += 1
```
| 3 |
|
616 |
D
|
Longest k-Good Segment
|
PROGRAMMING
| 1,600 |
[
"binary search",
"data structures",
"two pointers"
] | null | null |
The array *a* with *n* integers is given. Let's call the sequence of one or more consecutive elements in *a* segment. Also let's call the segment k-good if it contains no more than *k* different values.
Find any longest k-good segment.
As the input/output can reach huge size it is recommended to use fast input/output methods: for example, prefer to use scanf/printf instead of cin/cout in C++, prefer to use BufferedReader/PrintWriter instead of Scanner/System.out in Java.
|
The first line contains two integers *n*,<=*k* (1<=≤<=*k*<=≤<=*n*<=≤<=5·105) — the number of elements in *a* and the parameter *k*.
The second line contains *n* integers *a**i* (0<=≤<=*a**i*<=≤<=106) — the elements of the array *a*.
|
Print two integers *l*,<=*r* (1<=≤<=*l*<=≤<=*r*<=≤<=*n*) — the index of the left and the index of the right ends of some k-good longest segment. If there are several longest segments you can print any of them. The elements in *a* are numbered from 1 to *n* from left to right.
|
[
"5 5\n1 2 3 4 5\n",
"9 3\n6 5 1 2 3 2 1 4 5\n",
"3 1\n1 2 3\n"
] |
[
"1 5\n",
"3 7\n",
"1 1\n"
] |
none
| 0 |
[
{
"input": "5 5\n1 2 3 4 5",
"output": "1 5"
},
{
"input": "9 3\n6 5 1 2 3 2 1 4 5",
"output": "3 7"
},
{
"input": "3 1\n1 2 3",
"output": "1 1"
},
{
"input": "1 1\n747391",
"output": "1 1"
},
{
"input": "5 2\n171230 171230 171230 171230 171230",
"output": "1 5"
},
{
"input": "10 3\n512008 512008 452221 512008 314256 123232 314256 512008 314256 123232",
"output": "4 10"
},
{
"input": "6 1\n1 1 2 1 1 1",
"output": "4 6"
},
{
"input": "5 4\n1 2 3 4 0",
"output": "1 4"
},
{
"input": "5 4\n2 3 4 5 0",
"output": "1 4"
},
{
"input": "2 2\n0 1",
"output": "1 2"
},
{
"input": "2 2\n0 0",
"output": "1 2"
},
{
"input": "5 4\n1 2 3 45 0",
"output": "1 4"
}
] | 1,683,440,535 | 2,147,483,647 |
Python 3
|
WRONG_ANSWER
|
TESTS
| 1 | 31 | 0 |
n, k = map(int, input().split())
ls = list(map(int, input().split()))
answer = []
for i in range(len(ls) - 1):
for j in range(i + 1, len(ls)):
if ls[j] - ls[i] > k:
answer.append(tuple([i+1, j - 1]))
if len(answer) != 0:
res = max(answer, key=lambda sub: abs(sub[1] - sub[0]))
print(res)
else: print(1, len(ls))
|
Title: Longest k-Good Segment
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
The array *a* with *n* integers is given. Let's call the sequence of one or more consecutive elements in *a* segment. Also let's call the segment k-good if it contains no more than *k* different values.
Find any longest k-good segment.
As the input/output can reach huge size it is recommended to use fast input/output methods: for example, prefer to use scanf/printf instead of cin/cout in C++, prefer to use BufferedReader/PrintWriter instead of Scanner/System.out in Java.
Input Specification:
The first line contains two integers *n*,<=*k* (1<=≤<=*k*<=≤<=*n*<=≤<=5·105) — the number of elements in *a* and the parameter *k*.
The second line contains *n* integers *a**i* (0<=≤<=*a**i*<=≤<=106) — the elements of the array *a*.
Output Specification:
Print two integers *l*,<=*r* (1<=≤<=*l*<=≤<=*r*<=≤<=*n*) — the index of the left and the index of the right ends of some k-good longest segment. If there are several longest segments you can print any of them. The elements in *a* are numbered from 1 to *n* from left to right.
Demo Input:
['5 5\n1 2 3 4 5\n', '9 3\n6 5 1 2 3 2 1 4 5\n', '3 1\n1 2 3\n']
Demo Output:
['1 5\n', '3 7\n', '1 1\n']
Note:
none
|
```python
n, k = map(int, input().split())
ls = list(map(int, input().split()))
answer = []
for i in range(len(ls) - 1):
for j in range(i + 1, len(ls)):
if ls[j] - ls[i] > k:
answer.append(tuple([i+1, j - 1]))
if len(answer) != 0:
res = max(answer, key=lambda sub: abs(sub[1] - sub[0]))
print(res)
else: print(1, len(ls))
```
| 0 |
|
807 |
A
|
Is it rated?
|
PROGRAMMING
| 900 |
[
"implementation",
"sortings"
] | null | null |
Is it rated?
Here it is. The Ultimate Question of Competitive Programming, Codeforces, and Everything. And you are here to answer it.
Another Codeforces round has been conducted. No two participants have the same number of points. For each participant, from the top to the bottom of the standings, their rating before and after the round is known.
It's known that if at least one participant's rating has changed, then the round was rated for sure.
It's also known that if the round was rated and a participant with lower rating took a better place in the standings than a participant with higher rating, then at least one round participant's rating has changed.
In this problem, you should not make any other assumptions about the rating system.
Determine if the current round is rated, unrated, or it's impossible to determine whether it is rated of not.
|
The first line contains a single integer *n* (2<=≤<=*n*<=≤<=1000) — the number of round participants.
Each of the next *n* lines contains two integers *a**i* and *b**i* (1<=≤<=*a**i*,<=*b**i*<=≤<=4126) — the rating of the *i*-th participant before and after the round, respectively. The participants are listed in order from the top to the bottom of the standings.
|
If the round is rated for sure, print "rated". If the round is unrated for sure, print "unrated". If it's impossible to determine whether the round is rated or not, print "maybe".
|
[
"6\n3060 3060\n2194 2194\n2876 2903\n2624 2624\n3007 2991\n2884 2884\n",
"4\n1500 1500\n1300 1300\n1200 1200\n1400 1400\n",
"5\n3123 3123\n2777 2777\n2246 2246\n2246 2246\n1699 1699\n"
] |
[
"rated\n",
"unrated\n",
"maybe\n"
] |
In the first example, the ratings of the participants in the third and fifth places have changed, therefore, the round was rated.
In the second example, no one's rating has changed, but the participant in the second place has lower rating than the participant in the fourth place. Therefore, if the round was rated, someone's rating would've changed for sure.
In the third example, no one's rating has changed, and the participants took places in non-increasing order of their rating. Therefore, it's impossible to determine whether the round is rated or not.
| 500 |
[
{
"input": "6\n3060 3060\n2194 2194\n2876 2903\n2624 2624\n3007 2991\n2884 2884",
"output": "rated"
},
{
"input": "4\n1500 1500\n1300 1300\n1200 1200\n1400 1400",
"output": "unrated"
},
{
"input": "5\n3123 3123\n2777 2777\n2246 2246\n2246 2246\n1699 1699",
"output": "maybe"
},
{
"input": "2\n1 1\n1 1",
"output": "maybe"
},
{
"input": "2\n4126 4126\n4126 4126",
"output": "maybe"
},
{
"input": "10\n446 446\n1331 1331\n3594 3594\n1346 1902\n91 91\n3590 3590\n2437 2437\n4007 3871\n2797 699\n1423 1423",
"output": "rated"
},
{
"input": "10\n4078 4078\n2876 2876\n1061 1061\n3721 3721\n143 143\n2992 2992\n3279 3279\n3389 3389\n1702 1702\n1110 1110",
"output": "unrated"
},
{
"input": "10\n4078 4078\n3721 3721\n3389 3389\n3279 3279\n2992 2992\n2876 2876\n1702 1702\n1110 1110\n1061 1061\n143 143",
"output": "maybe"
},
{
"input": "2\n3936 3936\n2967 2967",
"output": "maybe"
},
{
"input": "2\n1 1\n2 2",
"output": "unrated"
},
{
"input": "2\n2 2\n1 1",
"output": "maybe"
},
{
"input": "2\n2 1\n1 2",
"output": "rated"
},
{
"input": "2\n2967 2967\n3936 3936",
"output": "unrated"
},
{
"input": "3\n1200 1200\n1200 1200\n1300 1300",
"output": "unrated"
},
{
"input": "3\n3 3\n2 2\n1 1",
"output": "maybe"
},
{
"input": "3\n1 1\n1 1\n2 2",
"output": "unrated"
},
{
"input": "2\n3 2\n3 2",
"output": "rated"
},
{
"input": "3\n5 5\n4 4\n3 4",
"output": "rated"
},
{
"input": "3\n200 200\n200 200\n300 300",
"output": "unrated"
},
{
"input": "3\n1 1\n2 2\n3 3",
"output": "unrated"
},
{
"input": "5\n3123 3123\n2777 2777\n2246 2246\n2245 2245\n1699 1699",
"output": "maybe"
},
{
"input": "2\n10 10\n8 8",
"output": "maybe"
},
{
"input": "3\n1500 1500\n1500 1500\n1600 1600",
"output": "unrated"
},
{
"input": "3\n1500 1500\n1500 1500\n1700 1700",
"output": "unrated"
},
{
"input": "4\n100 100\n100 100\n70 70\n80 80",
"output": "unrated"
},
{
"input": "2\n1 2\n2 1",
"output": "rated"
},
{
"input": "3\n5 5\n4 3\n3 3",
"output": "rated"
},
{
"input": "3\n1600 1650\n1500 1550\n1400 1450",
"output": "rated"
},
{
"input": "4\n2000 2000\n1500 1500\n1500 1500\n1700 1700",
"output": "unrated"
},
{
"input": "4\n1500 1500\n1400 1400\n1400 1400\n1700 1700",
"output": "unrated"
},
{
"input": "2\n1600 1600\n1400 1400",
"output": "maybe"
},
{
"input": "2\n3 1\n9 8",
"output": "rated"
},
{
"input": "2\n2 1\n1 1",
"output": "rated"
},
{
"input": "4\n4123 4123\n4123 4123\n2670 2670\n3670 3670",
"output": "unrated"
},
{
"input": "2\n2 2\n3 3",
"output": "unrated"
},
{
"input": "2\n10 11\n5 4",
"output": "rated"
},
{
"input": "2\n15 14\n13 12",
"output": "rated"
},
{
"input": "2\n2 1\n2 2",
"output": "rated"
},
{
"input": "3\n2670 2670\n3670 3670\n4106 4106",
"output": "unrated"
},
{
"input": "3\n4 5\n3 3\n2 2",
"output": "rated"
},
{
"input": "2\n10 9\n10 10",
"output": "rated"
},
{
"input": "3\n1011 1011\n1011 999\n2200 2100",
"output": "rated"
},
{
"input": "2\n3 3\n5 5",
"output": "unrated"
},
{
"input": "2\n1500 1500\n3000 2000",
"output": "rated"
},
{
"input": "2\n5 6\n5 5",
"output": "rated"
},
{
"input": "3\n2000 2000\n1500 1501\n500 500",
"output": "rated"
},
{
"input": "2\n2 3\n2 2",
"output": "rated"
},
{
"input": "2\n3 3\n2 2",
"output": "maybe"
},
{
"input": "2\n1 2\n1 1",
"output": "rated"
},
{
"input": "4\n3123 3123\n2777 2777\n2246 2246\n1699 1699",
"output": "maybe"
},
{
"input": "2\n15 14\n14 13",
"output": "rated"
},
{
"input": "4\n3000 3000\n2900 2900\n3000 3000\n2900 2900",
"output": "unrated"
},
{
"input": "6\n30 3060\n24 2194\n26 2903\n24 2624\n37 2991\n24 2884",
"output": "rated"
},
{
"input": "2\n100 99\n100 100",
"output": "rated"
},
{
"input": "4\n2 2\n1 1\n1 1\n2 2",
"output": "unrated"
},
{
"input": "3\n100 101\n100 100\n100 100",
"output": "rated"
},
{
"input": "4\n1000 1001\n900 900\n950 950\n890 890",
"output": "rated"
},
{
"input": "2\n2 3\n1 1",
"output": "rated"
},
{
"input": "2\n2 2\n1 1",
"output": "maybe"
},
{
"input": "2\n3 2\n2 2",
"output": "rated"
},
{
"input": "2\n3 2\n3 3",
"output": "rated"
},
{
"input": "2\n1 1\n2 2",
"output": "unrated"
},
{
"input": "3\n3 2\n3 3\n3 3",
"output": "rated"
},
{
"input": "4\n1500 1501\n1300 1300\n1200 1200\n1400 1400",
"output": "rated"
},
{
"input": "3\n1000 1000\n500 500\n400 300",
"output": "rated"
},
{
"input": "5\n3123 3123\n2777 2777\n2246 2246\n2246 2246\n3000 3000",
"output": "unrated"
},
{
"input": "2\n1 1\n2 3",
"output": "rated"
},
{
"input": "2\n6 2\n6 2",
"output": "rated"
},
{
"input": "5\n3123 3123\n1699 1699\n2777 2777\n2246 2246\n2246 2246",
"output": "unrated"
},
{
"input": "2\n1500 1500\n1600 1600",
"output": "unrated"
},
{
"input": "5\n3123 3123\n2777 2777\n2246 2246\n2241 2241\n1699 1699",
"output": "maybe"
},
{
"input": "2\n20 30\n10 5",
"output": "rated"
},
{
"input": "3\n1 1\n2 2\n1 1",
"output": "unrated"
},
{
"input": "2\n1 2\n3 3",
"output": "rated"
},
{
"input": "5\n5 5\n4 4\n3 3\n2 2\n1 1",
"output": "maybe"
},
{
"input": "2\n2 2\n2 1",
"output": "rated"
},
{
"input": "2\n100 100\n90 89",
"output": "rated"
},
{
"input": "2\n1000 900\n2000 2000",
"output": "rated"
},
{
"input": "2\n50 10\n10 50",
"output": "rated"
},
{
"input": "2\n200 200\n100 100",
"output": "maybe"
},
{
"input": "3\n2 2\n2 2\n3 3",
"output": "unrated"
},
{
"input": "3\n1000 1000\n300 300\n100 100",
"output": "maybe"
},
{
"input": "4\n2 2\n2 2\n3 3\n4 4",
"output": "unrated"
},
{
"input": "2\n5 3\n6 3",
"output": "rated"
},
{
"input": "2\n1200 1100\n1200 1000",
"output": "rated"
},
{
"input": "2\n5 5\n4 4",
"output": "maybe"
},
{
"input": "2\n5 5\n3 3",
"output": "maybe"
},
{
"input": "5\n1500 1500\n1300 1300\n1200 1200\n1400 1400\n1100 1100",
"output": "unrated"
},
{
"input": "5\n10 10\n9 9\n8 8\n7 7\n6 6",
"output": "maybe"
},
{
"input": "3\n1000 1000\n300 300\n10 10",
"output": "maybe"
},
{
"input": "5\n6 6\n5 5\n4 4\n3 3\n2 2",
"output": "maybe"
},
{
"input": "2\n3 3\n1 1",
"output": "maybe"
},
{
"input": "4\n2 2\n2 2\n2 2\n3 3",
"output": "unrated"
},
{
"input": "2\n1000 1000\n700 700",
"output": "maybe"
},
{
"input": "2\n4 3\n5 3",
"output": "rated"
},
{
"input": "2\n1000 1000\n1100 1100",
"output": "unrated"
},
{
"input": "4\n5 5\n4 4\n3 3\n2 2",
"output": "maybe"
},
{
"input": "3\n1 1\n2 3\n2 2",
"output": "rated"
},
{
"input": "2\n1 2\n1 3",
"output": "rated"
},
{
"input": "2\n3 3\n1 2",
"output": "rated"
},
{
"input": "4\n1501 1500\n1300 1300\n1200 1200\n1400 1400",
"output": "rated"
},
{
"input": "5\n1 1\n2 2\n3 3\n4 4\n5 5",
"output": "unrated"
},
{
"input": "2\n10 10\n1 2",
"output": "rated"
},
{
"input": "6\n3123 3123\n2777 2777\n2246 2246\n2246 2246\n1699 1699\n1900 1900",
"output": "unrated"
},
{
"input": "6\n3123 3123\n2777 2777\n3000 3000\n2246 2246\n2246 2246\n1699 1699",
"output": "unrated"
},
{
"input": "2\n100 100\n110 110",
"output": "unrated"
},
{
"input": "3\n3 3\n3 3\n4 4",
"output": "unrated"
},
{
"input": "3\n3 3\n3 2\n4 4",
"output": "rated"
},
{
"input": "3\n5 2\n4 4\n3 3",
"output": "rated"
},
{
"input": "4\n4 4\n3 3\n2 2\n1 1",
"output": "maybe"
},
{
"input": "2\n1 1\n3 2",
"output": "rated"
},
{
"input": "5\n3123 3123\n2777 2777\n2246 2246\n2246 2246\n2699 2699",
"output": "unrated"
},
{
"input": "3\n3 3\n3 3\n3 4",
"output": "rated"
},
{
"input": "3\n1 2\n2 2\n3 3",
"output": "rated"
},
{
"input": "3\n1 2\n1 2\n1 2",
"output": "rated"
},
{
"input": "2\n2 1\n2 1",
"output": "rated"
},
{
"input": "2\n1 2\n3 4",
"output": "rated"
},
{
"input": "2\n3 2\n2 3",
"output": "rated"
},
{
"input": "3\n1500 1500\n1600 1600\n1600 1600",
"output": "unrated"
},
{
"input": "3\n1 1\n3 3\n4 4",
"output": "unrated"
},
{
"input": "3\n1 1\n2 2\n2 2",
"output": "unrated"
},
{
"input": "2\n10 12\n8 8",
"output": "rated"
},
{
"input": "5\n1200 1200\n1500 1500\n1500 1500\n1500 1500\n1500 1500",
"output": "unrated"
},
{
"input": "2\n1 2\n2 2",
"output": "rated"
},
{
"input": "3\n1500 1400\n1200 1200\n1100 1100",
"output": "rated"
},
{
"input": "2\n10 12\n10 10",
"output": "rated"
},
{
"input": "3\n1500 1500\n1400 1400\n1300 1300",
"output": "maybe"
},
{
"input": "3\n3 3\n4 4\n5 5",
"output": "unrated"
},
{
"input": "3\n2 6\n3 5\n4 4",
"output": "rated"
},
{
"input": "2\n5 6\n4 6",
"output": "rated"
},
{
"input": "4\n10 10\n10 10\n7 7\n8 8",
"output": "unrated"
},
{
"input": "2\n4 4\n3 3",
"output": "maybe"
}
] | 1,688,335,489 | 2,147,483,647 |
PyPy 3-64
|
WRONG_ANSWER
|
TESTS
| 7 | 77 | 3,891,200 |
n = int(input())
ls, unrated = [], False
for i in range(n):
x, y = input().split()
if x != y:
print("rated")
exit()
ls.append(x)
for j in ls:
if i > 0 and x > j : unrated = True
print("unrated" if unrated else "maybe")
|
Title: Is it rated?
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Is it rated?
Here it is. The Ultimate Question of Competitive Programming, Codeforces, and Everything. And you are here to answer it.
Another Codeforces round has been conducted. No two participants have the same number of points. For each participant, from the top to the bottom of the standings, their rating before and after the round is known.
It's known that if at least one participant's rating has changed, then the round was rated for sure.
It's also known that if the round was rated and a participant with lower rating took a better place in the standings than a participant with higher rating, then at least one round participant's rating has changed.
In this problem, you should not make any other assumptions about the rating system.
Determine if the current round is rated, unrated, or it's impossible to determine whether it is rated of not.
Input Specification:
The first line contains a single integer *n* (2<=≤<=*n*<=≤<=1000) — the number of round participants.
Each of the next *n* lines contains two integers *a**i* and *b**i* (1<=≤<=*a**i*,<=*b**i*<=≤<=4126) — the rating of the *i*-th participant before and after the round, respectively. The participants are listed in order from the top to the bottom of the standings.
Output Specification:
If the round is rated for sure, print "rated". If the round is unrated for sure, print "unrated". If it's impossible to determine whether the round is rated or not, print "maybe".
Demo Input:
['6\n3060 3060\n2194 2194\n2876 2903\n2624 2624\n3007 2991\n2884 2884\n', '4\n1500 1500\n1300 1300\n1200 1200\n1400 1400\n', '5\n3123 3123\n2777 2777\n2246 2246\n2246 2246\n1699 1699\n']
Demo Output:
['rated\n', 'unrated\n', 'maybe\n']
Note:
In the first example, the ratings of the participants in the third and fifth places have changed, therefore, the round was rated.
In the second example, no one's rating has changed, but the participant in the second place has lower rating than the participant in the fourth place. Therefore, if the round was rated, someone's rating would've changed for sure.
In the third example, no one's rating has changed, and the participants took places in non-increasing order of their rating. Therefore, it's impossible to determine whether the round is rated or not.
|
```python
n = int(input())
ls, unrated = [], False
for i in range(n):
x, y = input().split()
if x != y:
print("rated")
exit()
ls.append(x)
for j in ls:
if i > 0 and x > j : unrated = True
print("unrated" if unrated else "maybe")
```
| 0 |
|
785 |
A
|
Anton and Polyhedrons
|
PROGRAMMING
| 800 |
[
"implementation",
"strings"
] | null | null |
Anton's favourite geometric figures are regular polyhedrons. Note that there are five kinds of regular polyhedrons:
- Tetrahedron. Tetrahedron has 4 triangular faces. - Cube. Cube has 6 square faces. - Octahedron. Octahedron has 8 triangular faces. - Dodecahedron. Dodecahedron has 12 pentagonal faces. - Icosahedron. Icosahedron has 20 triangular faces.
All five kinds of polyhedrons are shown on the picture below:
Anton has a collection of *n* polyhedrons. One day he decided to know, how many faces his polyhedrons have in total. Help Anton and find this number!
|
The first line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=200<=000) — the number of polyhedrons in Anton's collection.
Each of the following *n* lines of the input contains a string *s**i* — the name of the *i*-th polyhedron in Anton's collection. The string can look like this:
- "Tetrahedron" (without quotes), if the *i*-th polyhedron in Anton's collection is a tetrahedron. - "Cube" (without quotes), if the *i*-th polyhedron in Anton's collection is a cube. - "Octahedron" (without quotes), if the *i*-th polyhedron in Anton's collection is an octahedron. - "Dodecahedron" (without quotes), if the *i*-th polyhedron in Anton's collection is a dodecahedron. - "Icosahedron" (without quotes), if the *i*-th polyhedron in Anton's collection is an icosahedron.
|
Output one number — the total number of faces in all the polyhedrons in Anton's collection.
|
[
"4\nIcosahedron\nCube\nTetrahedron\nDodecahedron\n",
"3\nDodecahedron\nOctahedron\nOctahedron\n"
] |
[
"42\n",
"28\n"
] |
In the first sample Anton has one icosahedron, one cube, one tetrahedron and one dodecahedron. Icosahedron has 20 faces, cube has 6 faces, tetrahedron has 4 faces and dodecahedron has 12 faces. In total, they have 20 + 6 + 4 + 12 = 42 faces.
| 500 |
[
{
"input": "4\nIcosahedron\nCube\nTetrahedron\nDodecahedron",
"output": "42"
},
{
"input": "3\nDodecahedron\nOctahedron\nOctahedron",
"output": "28"
},
{
"input": "25\nIcosahedron\nOctahedron\nTetrahedron\nDodecahedron\nCube\nIcosahedron\nOctahedron\nCube\nTetrahedron\nIcosahedron\nIcosahedron\nTetrahedron\nOctahedron\nDodecahedron\nIcosahedron\nOctahedron\nIcosahedron\nTetrahedron\nDodecahedron\nTetrahedron\nOctahedron\nCube\nCube\nDodecahedron\nTetrahedron",
"output": "256"
},
{
"input": "1\nTetrahedron",
"output": "4"
},
{
"input": "1\nCube",
"output": "6"
},
{
"input": "1\nOctahedron",
"output": "8"
},
{
"input": "1\nDodecahedron",
"output": "12"
},
{
"input": "1\nIcosahedron",
"output": "20"
},
{
"input": "28\nOctahedron\nDodecahedron\nOctahedron\nOctahedron\nDodecahedron\nIcosahedron\nIcosahedron\nDodecahedron\nDodecahedron\nDodecahedron\nCube\nDodecahedron\nCube\nTetrahedron\nCube\nCube\nTetrahedron\nDodecahedron\nDodecahedron\nDodecahedron\nIcosahedron\nIcosahedron\nDodecahedron\nIcosahedron\nDodecahedron\nDodecahedron\nIcosahedron\nIcosahedron",
"output": "340"
}
] | 1,690,913,438 | 2,147,483,647 |
PyPy 3-64
|
OK
|
TESTS
| 30 | 1,091 | 9,216,000 |
n = int(input())
faces = {"Tetrahedron": 4, "Cube": 6, "Octahedron": 8, "Dodecahedron": 12, "Icosahedron": 20}
total = 0
for i in range(n):
name = input()
total += faces[name]
print(total)
|
Title: Anton and Polyhedrons
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Anton's favourite geometric figures are regular polyhedrons. Note that there are five kinds of regular polyhedrons:
- Tetrahedron. Tetrahedron has 4 triangular faces. - Cube. Cube has 6 square faces. - Octahedron. Octahedron has 8 triangular faces. - Dodecahedron. Dodecahedron has 12 pentagonal faces. - Icosahedron. Icosahedron has 20 triangular faces.
All five kinds of polyhedrons are shown on the picture below:
Anton has a collection of *n* polyhedrons. One day he decided to know, how many faces his polyhedrons have in total. Help Anton and find this number!
Input Specification:
The first line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=200<=000) — the number of polyhedrons in Anton's collection.
Each of the following *n* lines of the input contains a string *s**i* — the name of the *i*-th polyhedron in Anton's collection. The string can look like this:
- "Tetrahedron" (without quotes), if the *i*-th polyhedron in Anton's collection is a tetrahedron. - "Cube" (without quotes), if the *i*-th polyhedron in Anton's collection is a cube. - "Octahedron" (without quotes), if the *i*-th polyhedron in Anton's collection is an octahedron. - "Dodecahedron" (without quotes), if the *i*-th polyhedron in Anton's collection is a dodecahedron. - "Icosahedron" (without quotes), if the *i*-th polyhedron in Anton's collection is an icosahedron.
Output Specification:
Output one number — the total number of faces in all the polyhedrons in Anton's collection.
Demo Input:
['4\nIcosahedron\nCube\nTetrahedron\nDodecahedron\n', '3\nDodecahedron\nOctahedron\nOctahedron\n']
Demo Output:
['42\n', '28\n']
Note:
In the first sample Anton has one icosahedron, one cube, one tetrahedron and one dodecahedron. Icosahedron has 20 faces, cube has 6 faces, tetrahedron has 4 faces and dodecahedron has 12 faces. In total, they have 20 + 6 + 4 + 12 = 42 faces.
|
```python
n = int(input())
faces = {"Tetrahedron": 4, "Cube": 6, "Octahedron": 8, "Dodecahedron": 12, "Icosahedron": 20}
total = 0
for i in range(n):
name = input()
total += faces[name]
print(total)
```
| 3 |
|
59 |
A
|
Word
|
PROGRAMMING
| 800 |
[
"implementation",
"strings"
] |
A. Word
|
2
|
256
|
Vasya is very upset that many people on the Net mix uppercase and lowercase letters in one word. That's why he decided to invent an extension for his favorite browser that would change the letters' register in every word so that it either only consisted of lowercase letters or, vice versa, only of uppercase ones. At that as little as possible letters should be changed in the word. For example, the word HoUse must be replaced with house, and the word ViP — with VIP. If a word contains an equal number of uppercase and lowercase letters, you should replace all the letters with lowercase ones. For example, maTRIx should be replaced by matrix. Your task is to use the given method on one given word.
|
The first line contains a word *s* — it consists of uppercase and lowercase Latin letters and possesses the length from 1 to 100.
|
Print the corrected word *s*. If the given word *s* has strictly more uppercase letters, make the word written in the uppercase register, otherwise - in the lowercase one.
|
[
"HoUse\n",
"ViP\n",
"maTRIx\n"
] |
[
"house\n",
"VIP\n",
"matrix\n"
] |
none
| 500 |
[
{
"input": "HoUse",
"output": "house"
},
{
"input": "ViP",
"output": "VIP"
},
{
"input": "maTRIx",
"output": "matrix"
},
{
"input": "BNHWpnpawg",
"output": "bnhwpnpawg"
},
{
"input": "VTYGP",
"output": "VTYGP"
},
{
"input": "CHNenu",
"output": "chnenu"
},
{
"input": "ERPZGrodyu",
"output": "erpzgrodyu"
},
{
"input": "KSXBXWpebh",
"output": "KSXBXWPEBH"
},
{
"input": "qvxpqullmcbegsdskddortcvxyqlbvxmmkhevovnezubvpvnrcajpxraeaxizgaowtfkzywvhnbgzsxbhkaipcmoumtikkiyyaiv",
"output": "qvxpqullmcbegsdskddortcvxyqlbvxmmkhevovnezubvpvnrcajpxraeaxizgaowtfkzywvhnbgzsxbhkaipcmoumtikkiyyaiv"
},
{
"input": "Amnhaxtaopjzrkqlbroiyipitndczpunwygstmzevgyjdzyanxkdqnvgkikfabwouwkkbzuiuvgvxgpizsvqsbwepktpdrgdkmfd",
"output": "amnhaxtaopjzrkqlbroiyipitndczpunwygstmzevgyjdzyanxkdqnvgkikfabwouwkkbzuiuvgvxgpizsvqsbwepktpdrgdkmfd"
},
{
"input": "ISAGFJFARYFBLOPQDSHWGMCNKMFTLVFUGNJEWGWNBLXUIATXEkqiettmmjgydwcpafqrppdsrrrtguinqbgmzzfqwonkpgpcwenv",
"output": "isagfjfaryfblopqdshwgmcnkmftlvfugnjewgwnblxuiatxekqiettmmjgydwcpafqrppdsrrrtguinqbgmzzfqwonkpgpcwenv"
},
{
"input": "XHRPXZEGHSOCJPICUIXSKFUZUPYTSGJSDIYBCMNMNBPNDBXLXBzhbfnqvwcffvrdhtickyqhupmcehlsyvncqmfhautvxudqdhgg",
"output": "xhrpxzeghsocjpicuixskfuzupytsgjsdiybcmnmnbpndbxlxbzhbfnqvwcffvrdhtickyqhupmcehlsyvncqmfhautvxudqdhgg"
},
{
"input": "RJIQZMJCIMSNDBOHBRAWIENODSALETAKGKPYUFGVEFGCBRENZGAdkcetqjljtmttlonpekcovdzebzdkzggwfsxhapmjkdbuceak",
"output": "RJIQZMJCIMSNDBOHBRAWIENODSALETAKGKPYUFGVEFGCBRENZGADKCETQJLJTMTTLONPEKCOVDZEBZDKZGGWFSXHAPMJKDBUCEAK"
},
{
"input": "DWLWOBHNMMGTFOLFAECKBRNNGLYLYDXTGTVRLMEESZOIUATZZZXUFUZDLSJXMEVRTESSFBWLNZZCLCQWEVNNUCXYVHNGNXHCBDFw",
"output": "DWLWOBHNMMGTFOLFAECKBRNNGLYLYDXTGTVRLMEESZOIUATZZZXUFUZDLSJXMEVRTESSFBWLNZZCLCQWEVNNUCXYVHNGNXHCBDFW"
},
{
"input": "NYCNHJWGBOCOTSPETKKHVWFGAQYNHOVJWJHCIEFOUQZXOYUIEQDZALFKTEHTVDBVJMEUBJUBCMNVPWGDPNCHQHZJRCHYRFPVIGUB",
"output": "NYCNHJWGBOCOTSPETKKHVWFGAQYNHOVJWJHCIEFOUQZXOYUIEQDZALFKTEHTVDBVJMEUBJUBCMNVPWGDPNCHQHZJRCHYRFPVIGUB"
},
{
"input": "igxoixiecetohtgjgbqzvlaobkhstejxdklghowtvwunnnvauriohuspsdmpzckprwajyxldoyckgjivjpmbfqtszmtocovxwge",
"output": "igxoixiecetohtgjgbqzvlaobkhstejxdklghowtvwunnnvauriohuspsdmpzckprwajyxldoyckgjivjpmbfqtszmtocovxwge"
},
{
"input": "Ykkekrsqolzryiwsmdlnbmfautxxxauoojrddvwklgnlyrfcvhorrzbmtcrvpaypqhcffdqhwziipyyskcmztjprjqvmzzqhqnw",
"output": "ykkekrsqolzryiwsmdlnbmfautxxxauoojrddvwklgnlyrfcvhorrzbmtcrvpaypqhcffdqhwziipyyskcmztjprjqvmzzqhqnw"
},
{
"input": "YQOMLKYAORUQQUCQZCDYMIVDHGWZFFRMUVTAWCHERFPMNRYRIkgqrciokgajamehmcxgerpudvsqyonjonsxgbnefftzmygncks",
"output": "yqomlkyaoruqqucqzcdymivdhgwzffrmuvtawcherfpmnryrikgqrciokgajamehmcxgerpudvsqyonjonsxgbnefftzmygncks"
},
{
"input": "CDOZDPBVVVHNBJVBYHEOXWFLJKRWJCAJMIFCOZWWYFKVWOGTVJcuusigdqfkumewjtdyitveeiaybwrhomrwmpdipjwiuxfnwuz",
"output": "CDOZDPBVVVHNBJVBYHEOXWFLJKRWJCAJMIFCOZWWYFKVWOGTVJCUUSIGDQFKUMEWJTDYITVEEIAYBWRHOMRWMPDIPJWIUXFNWUZ"
},
{
"input": "WHIUVEXHVOOIJIDVJVPQUBJMEVPMPDKQWJKFBZSGSKUXMIPPMJWuckzcpxosodcjaaakvlxpbiigsiauviilylnnqlyucziihqg",
"output": "WHIUVEXHVOOIJIDVJVPQUBJMEVPMPDKQWJKFBZSGSKUXMIPPMJWUCKZCPXOSODCJAAAKVLXPBIIGSIAUVIILYLNNQLYUCZIIHQG"
},
{
"input": "VGHUNFOXKETUYMZDJNGTAOIOANYXSGYNFOGOFFLDAWEUKYFOZXCJTCAFXZYLQZERYZLRSQXYQGAPCSUDPMEYTNCTTTMFAGVDWBO",
"output": "VGHUNFOXKETUYMZDJNGTAOIOANYXSGYNFOGOFFLDAWEUKYFOZXCJTCAFXZYLQZERYZLRSQXYQGAPCSUDPMEYTNCTTTMFAGVDWBO"
},
{
"input": "EDUANHCQDOCJHFONTTSWBUJSTTIXBIXMAIUFSGFLXWAYIURTVAVZPYQDLAWIGCLMPHXCEFCJPFAAHXVNGQUFNHADAIUAZIDMHDd",
"output": "EDUANHCQDOCJHFONTTSWBUJSTTIXBIXMAIUFSGFLXWAYIURTVAVZPYQDLAWIGCLMPHXCEFCJPFAAHXVNGQUFNHADAIUAZIDMHDD"
},
{
"input": "EBWOVSNLYTWWXrnovgugogtjahnmatomubebyxakas",
"output": "ebwovsnlytwwxrnovgugogtjahnmatomubebyxakas"
},
{
"input": "AORNNDKTRLRVGDPXJKXFTPFpopuzrlqumrxssskvbm",
"output": "AORNNDKTRLRVGDPXJKXFTPFPOPUZRLQUMRXSSSKVBM"
},
{
"input": "DBBZJCWQEVGYHEEUHJAWRHBDPsnplijbwtdibqrrheebfxqcvn",
"output": "dbbzjcwqevgyheeuhjawrhbdpsnplijbwtdibqrrheebfxqcvn"
},
{
"input": "t",
"output": "t"
},
{
"input": "N",
"output": "N"
},
{
"input": "kv",
"output": "kv"
},
{
"input": "Ur",
"output": "ur"
},
{
"input": "CN",
"output": "CN"
}
] | 1,686,154,601 | 2,147,483,647 |
Python 3
|
RUNTIME_ERROR
|
TESTS
| 0 | 30 | 0 |
s=input()
l=0
u=0
for i in s:
if i.isUpper():
u+=1
else:
l+=1
t=""
if u<=l:
for i in s:
if i.isUpper():
t+=i.lower()
else:
t+=i
else:
for i in s:
if i.isLower():
t+=i.upper()
else:
t+=i
print(t)
|
Title: Word
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Vasya is very upset that many people on the Net mix uppercase and lowercase letters in one word. That's why he decided to invent an extension for his favorite browser that would change the letters' register in every word so that it either only consisted of lowercase letters or, vice versa, only of uppercase ones. At that as little as possible letters should be changed in the word. For example, the word HoUse must be replaced with house, and the word ViP — with VIP. If a word contains an equal number of uppercase and lowercase letters, you should replace all the letters with lowercase ones. For example, maTRIx should be replaced by matrix. Your task is to use the given method on one given word.
Input Specification:
The first line contains a word *s* — it consists of uppercase and lowercase Latin letters and possesses the length from 1 to 100.
Output Specification:
Print the corrected word *s*. If the given word *s* has strictly more uppercase letters, make the word written in the uppercase register, otherwise - in the lowercase one.
Demo Input:
['HoUse\n', 'ViP\n', 'maTRIx\n']
Demo Output:
['house\n', 'VIP\n', 'matrix\n']
Note:
none
|
```python
s=input()
l=0
u=0
for i in s:
if i.isUpper():
u+=1
else:
l+=1
t=""
if u<=l:
for i in s:
if i.isUpper():
t+=i.lower()
else:
t+=i
else:
for i in s:
if i.isLower():
t+=i.upper()
else:
t+=i
print(t)
```
| -1 |
445 |
A
|
DZY Loves Chessboard
|
PROGRAMMING
| 1,200 |
[
"dfs and similar",
"implementation"
] | null | null |
DZY loves chessboard, and he enjoys playing with it.
He has a chessboard of *n* rows and *m* columns. Some cells of the chessboard are bad, others are good. For every good cell, DZY wants to put a chessman on it. Each chessman is either white or black. After putting all chessmen, DZY wants that no two chessmen with the same color are on two adjacent cells. Two cells are adjacent if and only if they share a common edge.
You task is to find any suitable placement of chessmen on the given chessboard.
|
The first line contains two space-separated integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=100).
Each of the next *n* lines contains a string of *m* characters: the *j*-th character of the *i*-th string is either "." or "-". A "." means that the corresponding cell (in the *i*-th row and the *j*-th column) is good, while a "-" means it is bad.
|
Output must contain *n* lines, each line must contain a string of *m* characters. The *j*-th character of the *i*-th string should be either "W", "B" or "-". Character "W" means the chessman on the cell is white, "B" means it is black, "-" means the cell is a bad cell.
If multiple answers exist, print any of them. It is guaranteed that at least one answer exists.
|
[
"1 1\n.\n",
"2 2\n..\n..\n",
"3 3\n.-.\n---\n--."
] |
[
"B\n",
"BW\nWB\n",
"B-B\n---\n--B"
] |
In the first sample, DZY puts a single black chessman. Of course putting a white one is also OK.
In the second sample, all 4 cells are good. No two same chessmen share an edge in the sample output.
In the third sample, no good cells are adjacent. So you can just put 3 chessmen, no matter what their colors are.
| 500 |
[
{
"input": "1 1\n.",
"output": "B"
},
{
"input": "2 2\n..\n..",
"output": "BW\nWB"
},
{
"input": "3 3\n.-.\n---\n--.",
"output": "B-B\n---\n--B"
},
{
"input": "3 1\n-\n.\n.",
"output": "-\nW\nB"
},
{
"input": "11 11\n-----------\n-----------\n-----------\n-----------\n-----------\n-----------\n-----------\n-----------\n-----------\n-----------\n-----------",
"output": "-----------\n-----------\n-----------\n-----------\n-----------\n-----------\n-----------\n-----------\n-----------\n-----------\n-----------"
},
{
"input": "1 1\n-",
"output": "-"
},
{
"input": "4 2\n..\n..\n..\n..",
"output": "BW\nWB\nBW\nWB"
},
{
"input": "5 1\n.\n.\n.\n.\n.",
"output": "B\nW\nB\nW\nB"
}
] | 1,650,692,784 | 2,147,483,647 |
Python 3
|
OK
|
TESTS
| 37 | 46 | 0 |
n, m = map(int, input().split())
matrix = []
row = ""
for i in range(n):
matrix.append(input())
for j in range(m):
if matrix[i][j] == '.':
if (i+j) & 1 == 1:
row += 'W'
else:
row += 'B'
else:
row += '-'
row += '\n'
print(row)
|
Title: DZY Loves Chessboard
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
DZY loves chessboard, and he enjoys playing with it.
He has a chessboard of *n* rows and *m* columns. Some cells of the chessboard are bad, others are good. For every good cell, DZY wants to put a chessman on it. Each chessman is either white or black. After putting all chessmen, DZY wants that no two chessmen with the same color are on two adjacent cells. Two cells are adjacent if and only if they share a common edge.
You task is to find any suitable placement of chessmen on the given chessboard.
Input Specification:
The first line contains two space-separated integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=100).
Each of the next *n* lines contains a string of *m* characters: the *j*-th character of the *i*-th string is either "." or "-". A "." means that the corresponding cell (in the *i*-th row and the *j*-th column) is good, while a "-" means it is bad.
Output Specification:
Output must contain *n* lines, each line must contain a string of *m* characters. The *j*-th character of the *i*-th string should be either "W", "B" or "-". Character "W" means the chessman on the cell is white, "B" means it is black, "-" means the cell is a bad cell.
If multiple answers exist, print any of them. It is guaranteed that at least one answer exists.
Demo Input:
['1 1\n.\n', '2 2\n..\n..\n', '3 3\n.-.\n---\n--.']
Demo Output:
['B\n', 'BW\nWB\n', 'B-B\n---\n--B']
Note:
In the first sample, DZY puts a single black chessman. Of course putting a white one is also OK.
In the second sample, all 4 cells are good. No two same chessmen share an edge in the sample output.
In the third sample, no good cells are adjacent. So you can just put 3 chessmen, no matter what their colors are.
|
```python
n, m = map(int, input().split())
matrix = []
row = ""
for i in range(n):
matrix.append(input())
for j in range(m):
if matrix[i][j] == '.':
if (i+j) & 1 == 1:
row += 'W'
else:
row += 'B'
else:
row += '-'
row += '\n'
print(row)
```
| 3 |
|
441 |
A
|
Valera and Antique Items
|
PROGRAMMING
| 1,000 |
[
"implementation"
] | null | null |
Valera is a collector. Once he wanted to expand his collection with exactly one antique item.
Valera knows *n* sellers of antiques, the *i*-th of them auctioned *k**i* items. Currently the auction price of the *j*-th object of the *i*-th seller is *s**ij*. Valera gets on well with each of the *n* sellers. He is perfectly sure that if he outbids the current price of one of the items in the auction (in other words, offers the seller the money that is strictly greater than the current price of the item at the auction), the seller of the object will immediately sign a contract with him.
Unfortunately, Valera has only *v* units of money. Help him to determine which of the *n* sellers he can make a deal with.
|
The first line contains two space-separated integers *n*,<=*v* (1<=≤<=*n*<=≤<=50; 104<=≤<=*v*<=≤<=106) — the number of sellers and the units of money the Valera has.
Then *n* lines follow. The *i*-th line first contains integer *k**i* (1<=≤<=*k**i*<=≤<=50) the number of items of the *i*-th seller. Then go *k**i* space-separated integers *s**i*1,<=*s**i*2,<=...,<=*s**ik**i* (104<=≤<=*s**ij*<=≤<=106) — the current prices of the items of the *i*-th seller.
|
In the first line, print integer *p* — the number of sellers with who Valera can make a deal.
In the second line print *p* space-separated integers *q*1,<=*q*2,<=...,<=*q**p* (1<=≤<=*q**i*<=≤<=*n*) — the numbers of the sellers with who Valera can make a deal. Print the numbers of the sellers in the increasing order.
|
[
"3 50000\n1 40000\n2 20000 60000\n3 10000 70000 190000\n",
"3 50000\n1 50000\n3 100000 120000 110000\n3 120000 110000 120000\n"
] |
[
"3\n1 2 3\n",
"0\n\n"
] |
In the first sample Valera can bargain with each of the sellers. He can outbid the following items: a 40000 item from the first seller, a 20000 item from the second seller, and a 10000 item from the third seller.
In the second sample Valera can not make a deal with any of the sellers, as the prices of all items in the auction too big for him.
| 500 |
[
{
"input": "3 50000\n1 40000\n2 20000 60000\n3 10000 70000 190000",
"output": "3\n1 2 3"
},
{
"input": "3 50000\n1 50000\n3 100000 120000 110000\n3 120000 110000 120000",
"output": "0"
},
{
"input": "2 100001\n1 895737\n1 541571",
"output": "0"
},
{
"input": "1 1000000\n1 1000000",
"output": "0"
},
{
"input": "1 1000000\n1 561774",
"output": "1\n1"
},
{
"input": "3 1000000\n5 1000000 568832 1000000 1000000 1000000\n13 1000000 1000000 1000000 596527 1000000 1000000 1000000 1000000 1000000 1000000 1000000 1000000 1000000\n20 1000000 1000000 1000000 1000000 1000000 1000000 1000000 1000000 1000000 1000000 1000000 1000000 1000000 1000000 1000000 1000000 1000000 1000000 1000000 1000000",
"output": "2\n1 2"
},
{
"input": "3 999999\n7 1000000 1000000 1000000 999999 1000000 999999 1000000\n6 999999 1000000 999999 1000000 999999 999999\n7 999999 1000000 1000000 999999 1000000 1000000 1000000",
"output": "0"
},
{
"input": "3 999999\n22 1000000 1000000 999999 999999 1000000 1000000 1000000 1000000 1000000 1000000 1000000 1000000 999999 1000000 1000000 999999 1000000 1000000 1000000 352800 999999 1000000\n14 999999 999999 999999 999999 999999 1000000 999999 999999 999999 999999 702638 999999 1000000 999999\n5 999999 1000000 1000000 999999 363236",
"output": "3\n1 2 3"
},
{
"input": "1 50001\n1 50000",
"output": "1\n1"
}
] | 1,477,896,446 | 2,147,483,647 |
Python 3
|
OK
|
TESTS
| 26 | 62 | 0 |
n,v = list(map(int, input().split()))
ans=[]
for i in range(n):
arr = list(map(int, input().split()))
arr.sort()
if v>arr[1]:
ans.append(i+1)
print(len(ans))
for i in ans:
print(i, end=' ')
|
Title: Valera and Antique Items
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Valera is a collector. Once he wanted to expand his collection with exactly one antique item.
Valera knows *n* sellers of antiques, the *i*-th of them auctioned *k**i* items. Currently the auction price of the *j*-th object of the *i*-th seller is *s**ij*. Valera gets on well with each of the *n* sellers. He is perfectly sure that if he outbids the current price of one of the items in the auction (in other words, offers the seller the money that is strictly greater than the current price of the item at the auction), the seller of the object will immediately sign a contract with him.
Unfortunately, Valera has only *v* units of money. Help him to determine which of the *n* sellers he can make a deal with.
Input Specification:
The first line contains two space-separated integers *n*,<=*v* (1<=≤<=*n*<=≤<=50; 104<=≤<=*v*<=≤<=106) — the number of sellers and the units of money the Valera has.
Then *n* lines follow. The *i*-th line first contains integer *k**i* (1<=≤<=*k**i*<=≤<=50) the number of items of the *i*-th seller. Then go *k**i* space-separated integers *s**i*1,<=*s**i*2,<=...,<=*s**ik**i* (104<=≤<=*s**ij*<=≤<=106) — the current prices of the items of the *i*-th seller.
Output Specification:
In the first line, print integer *p* — the number of sellers with who Valera can make a deal.
In the second line print *p* space-separated integers *q*1,<=*q*2,<=...,<=*q**p* (1<=≤<=*q**i*<=≤<=*n*) — the numbers of the sellers with who Valera can make a deal. Print the numbers of the sellers in the increasing order.
Demo Input:
['3 50000\n1 40000\n2 20000 60000\n3 10000 70000 190000\n', '3 50000\n1 50000\n3 100000 120000 110000\n3 120000 110000 120000\n']
Demo Output:
['3\n1 2 3\n', '0\n\n']
Note:
In the first sample Valera can bargain with each of the sellers. He can outbid the following items: a 40000 item from the first seller, a 20000 item from the second seller, and a 10000 item from the third seller.
In the second sample Valera can not make a deal with any of the sellers, as the prices of all items in the auction too big for him.
|
```python
n,v = list(map(int, input().split()))
ans=[]
for i in range(n):
arr = list(map(int, input().split()))
arr.sort()
if v>arr[1]:
ans.append(i+1)
print(len(ans))
for i in ans:
print(i, end=' ')
```
| 3 |
|
761 |
A
|
Dasha and Stairs
|
PROGRAMMING
| 1,000 |
[
"brute force",
"constructive algorithms",
"implementation",
"math"
] | null | null |
On her way to programming school tiger Dasha faced her first test — a huge staircase!
The steps were numbered from one to infinity. As we know, tigers are very fond of all striped things, it is possible that it has something to do with their color. So on some interval of her way she calculated two values — the number of steps with even and odd numbers.
You need to check whether there is an interval of steps from the *l*-th to the *r*-th (1<=≤<=*l*<=≤<=*r*), for which values that Dasha has found are correct.
|
In the only line you are given two integers *a*, *b* (0<=≤<=*a*,<=*b*<=≤<=100) — the number of even and odd steps, accordingly.
|
In the only line print "YES", if the interval of steps described above exists, and "NO" otherwise.
|
[
"2 3\n",
"3 1\n"
] |
[
"YES\n",
"NO\n"
] |
In the first example one of suitable intervals is from 1 to 5. The interval contains two even steps — 2 and 4, and three odd: 1, 3 and 5.
| 500 |
[
{
"input": "2 3",
"output": "YES"
},
{
"input": "3 1",
"output": "NO"
},
{
"input": "5 4",
"output": "YES"
},
{
"input": "9 9",
"output": "YES"
},
{
"input": "85 95",
"output": "NO"
},
{
"input": "0 1",
"output": "YES"
},
{
"input": "89 25",
"output": "NO"
},
{
"input": "74 73",
"output": "YES"
},
{
"input": "62 39",
"output": "NO"
},
{
"input": "57 57",
"output": "YES"
},
{
"input": "100 99",
"output": "YES"
},
{
"input": "0 0",
"output": "NO"
},
{
"input": "98 100",
"output": "NO"
},
{
"input": "99 100",
"output": "YES"
},
{
"input": "1 0",
"output": "YES"
},
{
"input": "100 0",
"output": "NO"
},
{
"input": "0 100",
"output": "NO"
},
{
"input": "100 98",
"output": "NO"
},
{
"input": "100 100",
"output": "YES"
},
{
"input": "0 5",
"output": "NO"
},
{
"input": "2 2",
"output": "YES"
}
] | 1,593,955,745 | 2,147,483,647 |
Python 3
|
OK
|
TESTS
| 21 | 109 | 6,758,400 |
a=input()
a=a.split()
n=int(a[0])
m=int(a[1])
if(n==0 and m==0):
print('NO')
else:
if(abs(n-m)<2):
print('YES')
else:
print("NO")
|
Title: Dasha and Stairs
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
On her way to programming school tiger Dasha faced her first test — a huge staircase!
The steps were numbered from one to infinity. As we know, tigers are very fond of all striped things, it is possible that it has something to do with their color. So on some interval of her way she calculated two values — the number of steps with even and odd numbers.
You need to check whether there is an interval of steps from the *l*-th to the *r*-th (1<=≤<=*l*<=≤<=*r*), for which values that Dasha has found are correct.
Input Specification:
In the only line you are given two integers *a*, *b* (0<=≤<=*a*,<=*b*<=≤<=100) — the number of even and odd steps, accordingly.
Output Specification:
In the only line print "YES", if the interval of steps described above exists, and "NO" otherwise.
Demo Input:
['2 3\n', '3 1\n']
Demo Output:
['YES\n', 'NO\n']
Note:
In the first example one of suitable intervals is from 1 to 5. The interval contains two even steps — 2 and 4, and three odd: 1, 3 and 5.
|
```python
a=input()
a=a.split()
n=int(a[0])
m=int(a[1])
if(n==0 and m==0):
print('NO')
else:
if(abs(n-m)<2):
print('YES')
else:
print("NO")
```
| 3 |
|
1 |
A
|
Theatre Square
|
PROGRAMMING
| 1,000 |
[
"math"
] |
A. Theatre Square
|
1
|
256
|
Theatre Square in the capital city of Berland has a rectangular shape with the size *n*<=×<=*m* meters. On the occasion of the city's anniversary, a decision was taken to pave the Square with square granite flagstones. Each flagstone is of the size *a*<=×<=*a*.
What is the least number of flagstones needed to pave the Square? It's allowed to cover the surface larger than the Theatre Square, but the Square has to be covered. It's not allowed to break the flagstones. The sides of flagstones should be parallel to the sides of the Square.
|
The input contains three positive integer numbers in the first line: *n*,<=<=*m* and *a* (1<=≤<=<=*n*,<=*m*,<=*a*<=≤<=109).
|
Write the needed number of flagstones.
|
[
"6 6 4\n"
] |
[
"4\n"
] |
none
| 0 |
[
{
"input": "6 6 4",
"output": "4"
},
{
"input": "1 1 1",
"output": "1"
},
{
"input": "2 1 1",
"output": "2"
},
{
"input": "1 2 1",
"output": "2"
},
{
"input": "2 2 1",
"output": "4"
},
{
"input": "2 1 2",
"output": "1"
},
{
"input": "1 1 3",
"output": "1"
},
{
"input": "2 3 4",
"output": "1"
},
{
"input": "1000000000 1000000000 1",
"output": "1000000000000000000"
},
{
"input": "12 13 4",
"output": "12"
},
{
"input": "222 332 5",
"output": "3015"
},
{
"input": "1000 1000 10",
"output": "10000"
},
{
"input": "1001 1000 10",
"output": "10100"
},
{
"input": "100 10001 1000000000",
"output": "1"
},
{
"input": "1000000000 1000000000 1000000000",
"output": "1"
},
{
"input": "1000000000 1000000000 999999999",
"output": "4"
},
{
"input": "1000000000 1000000000 192",
"output": "27126743055556"
},
{
"input": "1000000000 987654321 1",
"output": "987654321000000000"
},
{
"input": "456784567 1000000000 51",
"output": "175618850864484"
},
{
"input": "39916800 134217728 40320",
"output": "3295710"
}
] | 1,665,492,857 | 2,147,483,647 |
Python 3
|
OK
|
TESTS
| 20 | 46 | 0 |
n,m,a=[int(i) for i in input().split()]
res=((n+a-1)//a)*((m+a-1)//a)
print(res)
|
Title: Theatre Square
Time Limit: 1 seconds
Memory Limit: 256 megabytes
Problem Description:
Theatre Square in the capital city of Berland has a rectangular shape with the size *n*<=×<=*m* meters. On the occasion of the city's anniversary, a decision was taken to pave the Square with square granite flagstones. Each flagstone is of the size *a*<=×<=*a*.
What is the least number of flagstones needed to pave the Square? It's allowed to cover the surface larger than the Theatre Square, but the Square has to be covered. It's not allowed to break the flagstones. The sides of flagstones should be parallel to the sides of the Square.
Input Specification:
The input contains three positive integer numbers in the first line: *n*,<=<=*m* and *a* (1<=≤<=<=*n*,<=*m*,<=*a*<=≤<=109).
Output Specification:
Write the needed number of flagstones.
Demo Input:
['6 6 4\n']
Demo Output:
['4\n']
Note:
none
|
```python
n,m,a=[int(i) for i in input().split()]
res=((n+a-1)//a)*((m+a-1)//a)
print(res)
```
| 3.977 |
Subsets and Splits
SQL Console for MatrixStudio/Codeforces-Python-Submissions
Counts the number of entries with a 'OK' verdict, providing a basic overview of a specific category within the dataset.