title
stringlengths 1
261
| section
stringlengths 0
15.6k
| text
stringlengths 0
145k
|
|---|---|---|
2010 Olympic Village
|
Village overview
|
Village overview
thumb|The Vancouver Olympic Village is located in section 2A of Southeast False CreekThe site, a former industrial area which mostly consisted of parking lots, is located on the shoreline at the southeast corner of False Creek, north of First Avenue between Ontario and Columbia Streets. Just south of Science World, its waterfront is part of the False Creek Seawall promenade and bike route, and is adjacent to the stations of the former Vancouver Downtown Historic Railway, the Spyglass Place pedestrian ferry wharf (served by Aquabus and False Creek Ferries), the Science World pedestrian ferry wharf (normally served by Aquabus and False Creek Ferries but closed temporarily from 25 January 2010 to 24 March 2010),"Olympics to close three waterways to boat traffic" , Vancouver Sun, 30 April 2009 and the Main Street and Olympic Village SkyTrain stations.
Boasting over a thousand units, ranging over a million square feet, the Village was able to accommodate over 2,800 athletes, coaches, and officials for the 2010 Winter Olympics.
Following the Olympics, the accommodations became residential housing. Today, the Village is a mixed-use community, with approximately 1,100 residential units, area parks, and various retail and service outlets.
Southeast False Creek is the designation given to the neighbourhood that the Olympic Village resides in, bordered by Cambie, Main, West 2nd Avenue, and False Creek. In 2012, the site had 252 affordable housing units and another 100 units are for "modest market housing". The City of Vancouver projected that Southeast False Creek would eventually become home to up to 16,000 people by 2020.
As part of the development, Millennium Development Group built the Creekside Community Recreation Centre, a LEED platinum-standard community centre that opened in summer 2010.
|
2010 Olympic Village
|
History
|
History
|
2010 Olympic Village
|
Construction
|
Construction
thumb|The Olympic Village shot from across False Creek, two days before the Opening Ceremonies of the 2010 Olympics.
Preparation and construction of the site began in February 2006. Construction was completed on 1 November 2009 by Millennium Development Group, and turned over to the Vancouver Organizing Committee for the 2010 Olympic and Paralympic Winter Games (VANOC) for use during the Winter Games. On 7 April 2010, it was returned to the City of Vancouver. The village was converted into residential housing, a community centre, daycare, retail, and service spaces.
Residents released video documenting problems with their units, including water pouring out of light fixtures, heat not working, cracks in ceilings, hardwood floors bubbling from moisture and bedrooms too small to fit a bed. More than 60 condo owners at the Village filed a class-action lawsuit against the builder. The lawsuits were subsequently dropped.
Rennie Marketing Systems executive director Bob Rennie mentioned that any construction deficiencies were "minor". “On TV, a toilet leaked,” he said. “That ran for three minutes and everybody thought that the whole village was like that.”
|
2010 Olympic Village
|
Funding crisis
|
Funding crisis
In September 2007, a three-way deal was struck to complete the village with minimal public money: the developer, Millennium Developments, would build the project and sell the units as condominiums, borrowing funds from New York-based investment firm Fortress Investment Group, with the City of Vancouver acting as guarantor, leasing the land to Millennium until the games were complete.
Amid high supply and labour costs, slow condo sales, and the ongoing U.S. subprime mortgage crisis, Fortress halted its funds in September 2008, leaving Millennium in "anticipatory default". Thus, the city in its role as guarantor became responsible for finding funds to complete the project. In October 2008, city council advanced $100 million to Millennium, which was not made public until three weeks after. The city's Chief Financial Officer resigned shortly before the municipal election in November 2008.
The election resulted in the defeat of the NPA: candidate Peter Ladner was defeated, and Vision Vancouver gained control of council and the mayoralty. Ladner's defeat has been directly ascribed to the secret loan, as Vision promised more transparency in the city's finances.
At the beginning of 2009, costs continued to go over budget and the city faced a $458 million shortfall. On 15 January 2009, the deputy city manager overseeing construction of the Olympic Village resigned. Prime minister Stephen Harper ruled out any possibility of a bailout from the federal government.
With time running out, mayor Gregor Robertson made a request to the provincial government to amend the Vancouver Charter to allow the city to borrow extra funds, asserting that losses would be mitigated by rising property values. On 18 January 2009, an emergency meeting of the Legislative Assembly approved Bill 47, the Vancouver Charter Amendment Act, allowing the City of Vancouver to borrow unlimited sums for the Olympic Village--without the ordinary voter referendum required by previous legislation. The city then proceeded to buy out Fortress's share of the project, becoming the sole lender to Millennium.
In November 2010, seven months after the successful completion of the games, the village's holding company and the City of Vancouver agreed to place the property into voluntary receivership.The Economist, "Up False Creek: The cost of a property deal gone sour", 15 January 2011, p. 40.
In 2014, a Vancouver Sun review by Rob MacDonald, a notable Vancouver developer, praised Millennium for their accomplishment in creating the Vancouver Olympic Village under trying circumstances."This development has turned out exactly as we envisioned it. People like living here", Vancouver Sun, 30 April 2014"How city hall messed up Millennium Water" , Vancouver Sun, 16 October 2010 The same year, the city sold off the last shares in the project and cleared its debt from 2009. A later assessment in 2020 regarded the project as a success, creating a thriving neighbourhood.
|
2010 Olympic Village
|
Australia banner controversy
|
Australia banner controversy
A giant banner hung from the Village by members of the Australian team attracted controversy in early February 2010 when a member of the International Olympic Committee toured the site and expressed concern that it might contravene policy, as the banner is not the flag of Australia but rather depicts a kangaroo wearing boxing gloves. The Australian deputy prime minister at the time Julia Gillard called the request for the banner's removal a disgrace. According to a representative of the Australian team, the flag has been at every Olympic Village since the 2000 Games in Sydney. The image had flown from the victorious Australian yacht in the 1983 America's Cup and is now a mascot of Australia's Olympic teams; the Australian Olympic Committee owns the image's trademark. After IOC president Jacques Rogge discussed the issue with John Coates, chief of the AOC, it was confirmed that the flag could remain at the Olympic Village. "While the IOC is of the view that the display of the boxing kangaroo at the Olympic village is a breach of the IOC rules relating to clean venues, the IOC is not going to request us to take down the boxing kangaroo flag on this occasion," Coates said. The AOC was required to register the image with the IOC. The controversy sparked a demand for a version of the boxing-kangaroo flag at a Vancouver flag shop.
|
2010 Olympic Village
|
Post-Olympics
|
Post-Olympics
Following the Olympics, the Village became a mixed-use community with approximately 1,100 residential units, area parks, and various retail and service outlets. In 2012, the site had 252 affordable housing units and another 100 units are for "modest market housing". The City of Vancouver projected that Southeast False Creek would eventually become home to up to 16,000 people by 2020.
On 28 April 2014, the City of Vancouver officially paid down the entire $630 million debt of the Olympic Village development and recovered an additional $70 million.thumb|The Olympic Village plaque unveiling honoring Millennium Development Group. Shahram Malek (left), Amir Malekyazdi (middle), Peter Malek (right).On 12 December 2014, the City unveiled a plaque honouring Millennium Development Group's role in designing, developing and constructing the Olympic Village, named "Millennium Water Olympic Village". The wording on the plaque states:North America's first LEED Platinum community was designed, developed and constructed by Peter and Shahram Malek's Millennium Development Group in time to open as the athletes' village for the successful Vancouver 2010 Olympic and Paralympic Winter Games.
Formerly an industrial site, Millennium Water Olympic Village was the catalyst for the revitalization of the surrounding False Creek neighbourhood and is a testament to the innovation, hard work and community spirit of the Malekyazdi family and hundreds of men and women who helped make this vision a reality.
|
2010 Olympic Village
|
References
|
References
|
2010 Olympic Village
|
External links
|
External links
Vancouver2010.com profile
Government of British Columbia
City of Vancouver
Photograph of the construction of the Olympic Village in False Creek
Vancouver releases secret Olympic Village documents, Bob Mackin, The Tyee, 19 June 2009
The Growing Pains of Vancouver - Internet radio documentary discussing the Olympic Village from 45'21" till 64'24".
Category:2009 establishments in Canada
Olympic Village, 2010
Category:British Columbia political scandals
Category:Buildings and structures in Vancouver
Category:Olympic Villages in Canada
Category:Venues of the 2010 Winter Olympics
|
2010 Olympic Village
|
Table of Content
|
Short description, Whistler Olympic and Paralympic Village, Village overview, History, Construction, Funding crisis, Australia banner controversy, Post-Olympics, References, External links
|
2-pop
|
short description
|
480px|right|Waveform of one frame (1/30th of a second) of 1 kHz sound |thumb
Used in television production and filmmaking post-production, a 2-pop is a 1 kHz tone that is one frame long and placed 2 seconds before the start of a program. It is a simple and effective method of ensuring synchronization between sound and picture in a video or film.
A 2-pop is typically placed at the end of a visual countdown. Only the first frame of the "2" is shown, and the remainder of the 2 seconds prior to the program is black. This provides a unique point of reference where the frame-long image and frame-long sound should align, similar to the way a film clapperboard is used to generate a synchronization point.
For example, in a television or video program the first frame of action (FFOA) starts at one hour (typically timecode of 01:00:00:00 in the US, and 10:00:00:00 in the UK), preceding that, 1 frame (or the 2-pop) of tone would be placed at timecode 00:59:58:00 or exactly 2 seconds before first picture. Alternately, in film post-production the leader starts at 01:00:00:00 (or 0+00 feet if using feet and frames as is common in the United States), the 2-pop starts at 01:00:06:00 (or 9+00), and the first frame of action (FFOA) starts at 01:00:08:00 (or 12+00).
A 2-pop is useful whenever picture and sound are handled separately. For example, projecting work-in-progress in the pre-video days involved a film projector linked to a magnetic dubber, onto which the separate soundtrack reel was loaded. Aligning them by the 2-pop would ensure proper synchronization during playback. A modern scenario would involve sending a soundtrack to a separate facility for a sound mix. The returned product is a computer audio file, which then needs to be synchronized again with the picture.
|
2-pop
|
Sample sound
|
Sample sound
Whereas laying down bars and tone prior to program start establishes video and audio calibration levels on the tape, the 2-pop is primarily used for picture and sound synchronization. Therefore, while the loudness of the 2-pop may be the same as the bars and tone audio level in use, this is not a requirement. The loudness level should be sufficient to be heard clearly.
|
2-pop
|
References
|
References
|
2-pop
|
External links
|
External links
What is 2-Pop & How is it used?, Henri Rapp Recording
Category:Television terminology
Category:Film and video technology
|
2-pop
|
Table of Content
|
short description, Sample sound, References, External links
|
File:Gpcr2.JPG
|
Summary
|
Summary
Sidharth Mohandas, http://bp1.blogger.com/_4iPPaOm9XcA/RdvMO3GRVTI/AAAAAAAAALM/TtUPsXPNm08/s1600-h/gpcr2.JPG,
|
File:Gpcr2.JPG
|
Licensing
|
Licensing
|
File:Gpcr2.JPG
|
Table of Content
|
Summary, Licensing
|
Jāzeps Vītols
|
Short description
|
Jāzeps Vītols (; 26 July 1863 – 24 April 1948) was a Latvian composer, pedagogue and music critic. He is considered one of the fathers of Latvian classical music.
|
Jāzeps Vītols
|
Biography
|
Biography
left|230px|thumb|St. Petersburg Conservatory, 1913
Vītols, born in Valmiera the son of a schoolteacher, began his studies in composition in 1880 at the Saint Petersburg Conservatory with Nikolai Rimsky-Korsakov.Naxos profile. After graduating in 1886, he remained at the Conservatory to teach composition and reached the rank of Professor in 1901. His pupils there included Nikolai Myaskovsky and Sergei Prokofiev. Vītols was a close friend of fellow professors Alexander Glazunov and Anatoly Lyadov; he would regularly participate at Mitrofan Belyayev's "Weekly Fridays"—regular meetings of prominent Russian composers at Belyayev's home. At the time, Belyayev was Vītols' primary publisher. Besides academia, Vītols also spent time as a music critic for the St Petersburger Zeitung from 1897 to 1914.
In 1918, Vītols returned from Russia to his newly independent Latvia to conduct the Latvian National Opera. The following year, he established the first Latvian Conservatory of Music, which was later renamed the Jāzeps Vītols Latvian Academy of Music in his honor, and he ran the composition classes there between 1919 and 1944. His most prominent students during his tenure were Jānis Ivanovs, Ādolfs Skulte and Tālivaldis Ķeniņš. He also helped co-found the Latvian Composers' Society in 1923. In 1944, he moved to Lübeck in Germany and lived there until his death in 1948. His remains were returned to Riga in 1993.
Vītols was active not only as a composer, pedagogue, and conductor, but was also a pianist and prolific music critic. He was a member of Latvian student fraternity Fraternitas Lataviensis.
His choral music, especially Gaismas pils (The Castle of Light) is very popular with Latvian choirs, and is often included in the repertoire of the Latvian Song and Dance Festival. Vītols vocal and choral works are published by Musica Baltica Ltd in Riga. He died in Lübeck.
|
Jāzeps Vītols
|
Style
|
Style
Taking his cue from his Russian colleagues, Vītols became the leading exponent of national romanticism in Latvia. He is considered to be the father of a distinctively Latvian classical music, being the first Latvian composer to achieve international stature. His work reveals the undeniable influence of his teacher Rimsky-Korsakov, not least in the brilliance of its orchestration, an assessment which was shared by Vītols' friend and fellow composer Alexander Glazunov. During his time in Russia, Vītols became deeply interested in Latvian folklore and conducted the Latvian Choir in Saint Petersburg. His melodies clearly draw upon his heritage, and often directly feature Latvian folk tunes. In striving to forge a musical style for Latvia, Vītols emulated the processes of the Russian national school. His large-scale works, which are mostly cast in sonata form, are often characterized by impressive dramatic development. Overall, in comparison with many other 20th-century composers, he tended to be rather conservative but nonetheless possessed a masterly composition technique.
|
Jāzeps Vītols
|
Works
|
Works
{| class="wikitable sortable" style="font-size: 82%; width:100%; text-align: center;"
|-
! Opus
! Orchestral
! Chamber
! Vocal
! Piano
! Year
|-
| 1
| style="background-color:#E5E4E2;" |
| style="background-color:#E5E4E2;" rowspan="2" |
| style="background-color:#E5E4E2;" rowspan="3" |
| Piano Sonata in B-flat minor
| 1886
|-
| 21
| Dramatic Overture
| style="background-color:#E5E4E2;" rowspan="18" |
| 1895
|-
| 27
| style="background-color:#E5E4E2;" rowspan="5" |
| String Quartet in G major
| 1899
|-
| 35
| style="background-color:#E5E4E2;" rowspan="2" |
| The Song (Dziesma)
| 1908
|-
| 45
| Northern Lights (Ziemeļblāzma)
| 1914
|-
| 14
| Récit for Viola or Cello and Piano
| style="background-color:#E5E4E2;" rowspan="7" |
| 1894
|-
| 32
| 8 Latvian Folk Tunes for Piano
|
|-
|
| Symphony in E minor
| style="background-color:#E5E4E2;" rowspan="18" |
| 1886–88
|-
| 37
| Sprīdītis
Amethysts
Emeralds
Pearls
Rubies
Diamonds
| 1907
|-
| 42
| Fantasy on Latvian Folk Tunes
| 1908–10
|-
|
| Autumn Song (Rudens dziesma)
| 1928
|-
| 28
| The Bard of Beverīna (Beverīnas dziedonis)
| 1891
|-
| —
| style="background-color:#E5E4E2;" rowspan="3" |
| Sermon on the Mount (Kalna sprediķi)
| 1943
|-
| 12
| Sketch for Cello and Piano
|
|-
| 8
| Berceuse
| 1892
|-
| 39
| Rhapsody On Lithuanian Folksongs
| style="background-color:#E5E4E2;" |
|
|-
| 29
| rowspan="4" style="background-color:#E5E4E2;" |
| 10 Chants Populaires Lettons
Skaisti dziedi lakstīgala Rīgas torņa galiņā
Apkārt kalnu gāju, kalniņa uzkapu,? Redzēj' savu sirdspuķīti gauži raudādam!
Āvu, āvu baltas kājas, Lecu dārziņā
Aijā, žūžu, lāča bērnis Plakanāmi kājiņāmi
Trīcēt trīcēj' visa Rīga Kas to Rīgu trīcināj'?
Pūt vējiņi, dzen laiviņu, Aizdzen mani Kurzemē
Redz kur jāja div' bajāri, Zīda pušķi zemi slauka
Pati māte savu dēlu Kara vīru audzināja
Kas to līgo ielīgoja? ligo! Mūsu pašu ciema ļaudis, līgo!
Irbit gulēj' ceļmalāi, Baida manu kumeliņ'!
| 1901
|-
| 6
| Variations sur un Theme Lette
| 1892
|-
| 7
| Six Mélodies
Chant du Mendiant: „Faites l’aumône, bonnesgens“.
Berceuse: „O souris grise, apporte le sommeil“.
Chant du Ruisseau: „J’ai quitté les monts“.
„Je ne puis rire“.
Chant de Pêcheurs: „Mère Dvina, mère chère“.
Je t’aime: „Je me rappelle ton premier sourire“.
| 1892
|-
| 3
| rowspan="2" style="background-color:#E5E4E2;" |
| Humoresque
| 1890
|-
| 4
| La fête Lihgo
| rowspan="3" style="background-color:#E5E4E2;" |
| 1889
|-
| 5
| style="background-color:#E5E4E2;" |
| 3 Songs (Dziesmas)
Das Blatt im Buche: "Ich hab’ eine alte Muhme"
Schlimme Ahnung: "Flüchtig ist dein Kuss, Geliebte"
Zu spät: "Sie haben dich fortgetragen"
| 1892
|-
| 2
| Mélodie et Mazurka
| rowspan="2" style="background-color:#E5E4E2;" |
| 1889
|-
| 43
| rowspan="19" style="background-color:#E5E4E2;" |
| 3 Reminiscences
| 1914
|-
| 53
| 3 Songs (Dziesmas)
Die Welle ("Hell strahlt die Sonne")
Nebeltage ("Nun die Welt trübe")
Lächeln ("Lächle einmal noch")
| rowspan="3" style="background-color:#E5E4E2;" |
| 1919
|-
| 55
| Berceuse in A
| style="background-color:#E5E4E2;" |
| 1921
|-
| 11
| rowspan="2" style="background-color:#E5E4E2;" |
| 3 Mélodies for Voice and Piano
Heimkehr: "Es wintert draussen mit aller Macht"
Die Fenster waren gefroren
Du schläfst da so ruhig und süss
|
|-
| 13
| rowspan="2" style="background-color:#E5E4E2;" |
| 3 Preludes
| 1894
|-
| 15
| Romance
| rowspan="2" style="background-color:#E5E4E2;" |
| 1894
|-
| 50
| rowspan="6" style="background-color:#E5E4E2;" |
| 5 chansons d'ete (Vasaras dziesmas)
| 1918
|-
| 16
| rowspan="2" style="background-color:#E5E4E2;" |
| 3 Preludes
| 1895
|-
| 2
| 4 Morceaux
| 1895
|-
| 58
| 12 Chansons Enfantines
| style="background-color:#E5E4E2;" |
| 1921
|-
| 63
| style="background-color:#E5E4E2;" |
| Piano Sonatina in B minor
| 1927
|-
| 52
| 3 Songs (Dziesmas)
Dünastrom, Schwarzauge
Wiegenlied fürs Herz ("Törichtes Herz")
Frühlingstage ("Kein Klagelaut jemals erkling")
| rowspan="2" style="background-color:#E5E4E2;" |
| 1919
|-
| 66
| Dargakeni
Amethysts (Lento)
Emeralds (Allegro rustico)
Pearls (Allegro)
Rubies (Agitato)
Diamonds (Allegro di molto)
| rowspan="2" style="background-color:#E5E4E2;" |
| 1924
|-
| 68
| rowspan="11" style="background-color:#E5E4E2;" |
| 8 miniatures (Astonas miniaturas)
| 1928
|-
| —
| String Quartet No. 1
| rowspan="2" style="background-color:#E5E4E2;" |
| 1885
|-
| —
| Esquisse
| 1894
|-
| 10
| rowspan"2" style="background-color:#E5E4E2;" |
| 3 Preludes
| 1893
|-
| 9
| Mazurka et Valse
| rowspan="5" style="background-color:#E5E4E2;" |
| 1892
|-
| 34
| Songs
|
|-
| 35
| Das Lied
| style="background-color:#E5E4E2;" |
|
|-
| 61
| rowspan="8" style="background-color:#E5E4E2;" |
| 3 Songs (Dziesmas)
| 1925
|-
| 59
| 3 Songs (Dziesmas)
| 1923
|-
| 24
| style="background-color:#E5E4E2;" |
| Valse-Caprice
| 1897
|-
|
| Song of the Sun’s Radiance
| rowspan="2" style="background-color:#E5E4E2;" |
| 1911
|-
|
| There is Still a Silent Night in My Mind
| rowspan="6" style="background-color:#E5E4E2;" |
| 1911
|-
| 23
| rowspan="4" style="background-color:#E5E4E2;" |
| 2 Morceaux
| 1897
|-
| 25
| 3 Morceaux
| 1897
|-
| 33
| Deux miniatures (Divas miniaturas)
| 1905
|-
|
| Rhapsody for Violin and Orchestra
| rowspan="3" style="background-color:#E5E4E2;" |
| 1918
|-
| 57
| rowspan="26" style="background-color:#E5E4E2;" |
| Carmina
| 1927
|-
| 38
| rowspan="43" style="background-color:#E5E4E2;" |
| 3 Silhouettes
| 1909
|-
| 41
| style="background-color:#E5E4E2;" |
| 2 Morceaux
—
Au Clair de la Lune
| 1910
|-
| 44
| 3 songs (Dziesmas)
| rowspan="2" style="background-color:#E5E4E2;" |
| 1910
|-
| 48
| 5 preludes de Naurena Elzas
| 1914
|-
| 54
| rowspan="6" style="background-color:#E5E4E2;" |
| Variations-portraits
| 1920
|-
| 17
| 3 Morceaux
| 1895
|-
| 18
| Berceuse et Étude
| 1895
|-
| 19
| 2 Preludes
| 1895
|-
| 20
| 4 Morceaux
| 1895
|-
| 22
| rowspan="2" style="background-color:#E5E4E2;" |
| style="background-color:#E5E4E2;" |
|-
| 31
| 7 Lieder (Dziesmas)
Mans kaps (Mein Grab)
Mirdzas Lied: "Mondenstrahlen weben"
"Im Sinn liegt mir die stille Nacht"
| 1903-21
|-
| 26
| rowspan="3" style="background-color:#E5E4E2;" |
| 3 Études
| 1898
|-
| 36
| rowspan-"2" style="background-color:#E5E4E2;" |
| rowspan-"2" style="background-color:#E5E4E2;" |
|-
| 30
| 3 Preludes
| 1903
|-
| 40
| 8 Songs (Dziesmas)
| rowspan="25" style="background-color:#E5E4E2;" |
| 1909
|-
| 46
| rowspan-"2" style="background-color:#E5E4E2;" |
| rowspan-"2" style="background-color:#E5E4E2;" |
|-
| 47
| style="background-color:#E5E4E2;" |
| style="background-color:#E5E4E2;" |
|-
| 49
| 5 Latvian Folk Songs
| 1916
|-
| 51
| 3 Songs (Dziesmas)
| 1919
|-
| 56
| 3 Lieder (Trīs dziesmas)
Rozes visskaistākās
Laimītei
Laimas sveiciens
| 1921
|-
| 60
| Le Chagrin du Pueple (Tautas bedas)
—
—
—
| 1923
|-
| 62
| 3 Songs (Dziesmas)
| 1925
|-
| 64
| rowspan="21" style="background-color:#E5E4E2;" |
| rowspan="3" style="background-color:#E5E4E2;" |
|-
| 65
|-
| 67
|-
| —
| Autumn Song (Rudens Dzisma)
|
|-
| —
| Symphony in E minor
| 1886–87
|-
| —
| Symphony No.2
| 1901
|-
| —
| Tom Thumb
| 1908
|-
| —
| Song of a Fisherwoman
| 1911
|-
| —
| Song of the Sun’s Radiance
| 1911
|-
| —
| There is Still a Silent Night in My Mind
| 1911
|-
| —
| Goblet on the Isle of the Dead
| 1911
|-
| —
| Rhapsody for Violin and Orchestra
| 1918
|-
| —
| From the Tree of Acknowledgement
| 1924
|-
| —
| A Song of Autumn
| 1928
|-
| —
| Latvian Country Serenade for orchestra
| 1934
|-
| —
| Sermon on the Mount
| 1943
|-
| —
| Legend for string quartet
| 1942
|-
| —
| rowspan="4" style="background-color:#E5E4E2;" |
| Pastorale (Pastorāle) for Organ
| 1913
|-
| —
| 29 mélodies de chorals d'après le livre de l'église évangélique luthérienne lettonne (29 korāļi meldiju grāmatā latvijas evaņģēliski – luterāņu draudzēm)
| 1924
|-
| —
| Liturgie (Liturģija)
| 1934
|-
| —
| Liturgie de Pâques (Lieldienu liturģija)
| 1935
|}
Musicology works
Anatoly Konstantinovich Lyadov: life, works and the time (one of the essays published with the biography essay by Victor Valter and rememberes by Sergey Gorodetsky) (1916) Вальтер В. Г., Витолс Я., Городецкий С. М. Анатолий Константинович Лядов. — переизд.. — СПб.: Композитор - Санкт-Петербург, 2005. — 184 с. —
Celebration and remembrance
thumb|180px|1 lats coin commemorating Vītols' 150th birthday, 2013.
Jāzeps Vītols music days in Gaujiena started soon after 1922, when he spent summers in Gaujiena "Anniņas" with his wife. Celebrating his birthday, different choirs from all over the country started coming to Gaujiena for July 26 to celebrate Vītols' birthday with music. In 2003, a summer camp for children from music schools was started around this celebration, creating an orchestra and a choir to celebrate music and have fun as well as practice their instruments.
Notes
References
Braun, Joachim and Klotiņš, Arnold. "Vītols, Jāzeps". Grove Music Online '' (subscription required). ed. L. Macy. Retrieved on March 8, 2007.
|
Jāzeps Vītols
|
External links
|
External links
Homepage of the Jāzeps Vītols Latvian Academy of Music
Homepage of Musica Baltica Ltd
Jāzeps Vītols digital collection
Category:1863 births
Category:1948 deaths
Category:People from Valmiera
Category:People from Valmiera county
Category:Latvian composers
Category:Romantic composers
Category:20th-century Latvian classical composers
Category:Latvian conductors (music)
Category:Latvian male conductors (music)
Category:Latvian classical pianists
Category:Latvian music critics
Category:Latvian classical musicians
Category:Saint Petersburg Conservatory alumni
Category:Latvian male classical composers
Category:Latvian World War II refugees
Category:Male classical pianists
Category:20th-century conductors (music)
Category:19th-century male musicians
Category:Academic staff of Jāzeps Vītols Latvian Academy of Music
Category:Composers from the Russian Empire
Category:Latvian emigrants to Germany
Category:Burials at Forest Cemetery, Riga
|
Jāzeps Vītols
|
Table of Content
|
Short description, Biography, Style, Works, External links
|
File:Gpcr+cycle.JPG
|
Summary
|
Summary
Sidharth Mohandas, http://bp0.blogger.com/_4iPPaOm9XcA/RdrW13GRVSI/AAAAAAAAAK8/AhMs7hG76E8/s1600-h/gpcr+cycle.JPG, NMB cycle
|
File:Gpcr+cycle.JPG
|
Licensing
|
Licensing
|
File:Gpcr+cycle.JPG
|
Table of Content
|
Summary, Licensing
|
Marcel Artelesa
|
Short description
|
Marcel Artelesa (2 July 1938 – 23 September 2016) was a French footballer who played as a defender. He played for France at the 1960 Summer Olympics, and in the 1966 FIFA World Cup in England.Former France captain Marcel Artelesa dies
|
Marcel Artelesa
|
Honours
|
Honours
AS Monaco
French championship: 1963
Coupe de France: 1963
|
Marcel Artelesa
|
References
|
References
Profile on French federation official site
Profile
Category:1938 births
Category:2016 deaths
Category:French men's footballers
Category:France men's international footballers
Category:Men's association football defenders
Category:AS Troyes-Savinienne players
Category:AS Monaco FC players
Category:Olympique de Marseille players
Category:OGC Nice players
Category:Ligue 1 players
Category:Ligue 2 players
Category:Olympic footballers for France
Category:Footballers at the 1960 Summer Olympics
Category:1966 FIFA World Cup players
Category:20th-century French sportsmen
|
Marcel Artelesa
|
Table of Content
|
Short description, Honours, References
|
Neuromedin B
|
infobox protein
|
Neuromedin B (NMB) is a bombesin-related peptide in mammals. It was originally purified from pig spinal cord, and later shown to be present in human central nervous system and gastrointestinal tract.
|
Neuromedin B
|
Sequence
|
Sequence
The sequence of the C-terminal decapeptide is highly conserved across mammalian species: GNLWATGHFM-(NH2); this decapeptide is sometimes noted as neuromedin B, but it is more accurately described as neuromedin B 23-32. The sequence of neuromedin B (in rat) is: TPFSWDLPEPRSRASKIRVHPRGNLWATGHFM-(NH2). The (NH2) here indicates a post-translational modification -- alpha amidation of the carboxy terminus.
|
Neuromedin B
|
Function
|
Function
thumb|Figure 1: NMB, 7-TMR receptor and G-protein
thumb|Figure 2 : Signal Cascade after NMB binding
Neuromedin regulates the following functions:
exocrine and endocrine secretions
cell growth
body temperature
blood pressure and glucose level
sneezing
|
Neuromedin B
|
Neuromedin signaling pathway
|
Neuromedin signaling pathway
NMB acts by binding to its high affinity cell surface receptor, neuromedin B receptor (NMBR). This receptor is a G protein-coupled receptor with seven transmembrane spanning regions, hence the receptor is also denoted as a 7-transmembrane receptor (7-TMR). Upon binding several intracellular signaling pathways are triggered (see Figure 2).
When NMB binds to its 7-TMR, the heterotrimeric G protein that is attached to the receptor is activated. The G-protein is called heterotrimeric because it consists of 3 polypeptides: α subunit, β subunit, and γ subunit. In the activated NMBR/G-protein complex, there occurs an exchange of GTP for GDP bound to G-α subunit. The G-α subunit, in turn, dissociated form the G-βγ subunits. The free G-α inactivates adenylate cyclase (AC), which, in turn, catalyzes the conversion of ATP to cAMP, the latter of which functioning as a second messenger. cAMP activates of the enzyme Protein Kinase A (PKA). PKA enters the nucleus and activates the cAMP response element-binding protein. The activated CREB binds along with CREB binding protein, co-activator to the CRE region of the DNA in the nucleus. CREB and CBP are held together by leucine zippers. CRE is the control that activates number of growth factors, and thus cell proliferation and some anti-apoptotic genes. In the brain, CREB plays a role in long-term memory and learning.
|
Neuromedin B
|
References
|
References
|
Neuromedin B
|
External links
|
External links
Category:Neuropeptides
|
Neuromedin B
|
Table of Content
|
infobox protein
, Sequence, Function, Neuromedin signaling pathway, References, External links
|
Forester Brigade
|
Use British English
|
The Forester Brigade (known as the Midland Brigade until 1958) was an administrative formation of the British Army from 1948 to 1964. The Brigade administered the regular infantry regiments of the English Midlands.
After the Second World War the British Army had fourteen infantry depots, each bearing a letter. The depots were territorially organised, and Infantry Depot F at Strensall was the headquarters for the county regiments of Derbyshire, Leicestershire, Lincolnshire, Nottinghamshire and Warwickshire.
In 1948, the depots adopted names and this depot became the Midland Brigade with all regiments being reduced to a single battalion at the same time. The Midland Brigade was formally formed on 14 July 1948, combining the depots of four regiments:Whitaker's Almanack 1956, p. 471
The Royal Warwickshire Regiment
The Royal Lincolnshire Regiment
The Royal Leicestershire Regiment
The Sherwood Foresters (Nottinghamshire and Derbyshire Regiment)
Under the 1957 Defence White Paper changes announced in July 1957, the infantry of the line was reorganised: accordingly, in 1958, the Royal Lincolnshire Regiment was transferred to the East Anglian Brigade and the Midland Brigade was renamed as the Forester Brigade.
From 1958 all regiments in the Brigade adopted a common cap badge: "A Maltese cross voided, the points pommelled, and thereon, on a mount, an antelope statant gorged with a ducal coronet and chained within The Garter, the whole encircled with a chaplet of oak-leaves issuant from a scroll inscribed 'Forester Brigade' and ensigned with, upon a mount, a tiger passant guardant. The badge combined parts of the cap badges of the Royal Warwicks, Royal Leicesters and Sherwood Foresters.A L Kipling and H L King, Head-dress badges of the British Army, Volume 2, London, 1979 From 1960 the Forester Brigade was based at Glen Parva Barracks in Leicestershire.
In 1963, the Royal Warwickshire Regiment was transferred to the Fusilier Brigade, and in the following year the Royal Leicestershire Regiment joined the East Anglian Brigade and the Sherwood Foresters moved to the Mercian Brigade. With this, the Forester Brigade was disbanded.
|
Forester Brigade
|
Units
|
Units
During its existence, the brigade was made up of the following units:
| style="text-align:left; width:50%; vertical-align:top;"|
|
Forester Brigade
|
Regular battalions
|
Regular battalions
1st Battalion, Royal Warwickshire Regiment (1946–1962)
2nd Battalion, Royal Warwickshire Regiment (1946–1948}
1st Battalion, Royal Lincolnshire Regiment (1946–1958)
2nd Battalion, Royal Lincolnshire Regiment (1946–1948)
1st Battalion, Royal Leicestershire Regiment (1946–1963)
2nd Battalion, Royal Leicestershire Regiment (1946–1948)
1st Battalion, Sherwood Foresters (Nottinghamshire and Derbyshire Regiment) (1946–1963)
2nd Battalion, Sherwood Foresters (Nottinghamshire and Derbyshire Regiment) (1946–1948, 1952–1955)
| style="text-align:left; width:50%; vertical-align:top;"|
|
Forester Brigade
|
Territorial battalions
|
Territorial battalions
7th Battalion, Royal Warwickshire Regiment (1947–1962)
2/7th Battalion, Royal Warwickshire Regiment (1947–1950)
4th Battalion, Royal Lincolnshire Regiment (1947–1950)
6th Battalion, Royal Lincolnshire Regiment (1947–1950)
4th/6th Battalion, Royal Lincolnshire Regiment (1950–1958)
5th Battalion, Royal Leicestershire Regiment (1947–1961)
4th/5th Battalion, Royal Leicestershire Regiment (1961–1963)
5th (Derbyshire) Battalion, Sherwood Foresters (Nottinghamshire and Derbyshire Regiment) (1947–1961)
8th (Nottinghamshire) Battalion, Sherwood Foresters (Nottinghamshire and Derbyshire Regiment) (1947–1961)
5th/8th Battalion, Sherwood Foresters (Nottinghamshire and Derbyshire Regiment) (1961–1963)
|
Forester Brigade
|
References
|
References
Category:Infantry
Category:Infantry administrative brigades of the British Army
Category:Military units and formations established in 1948
|
Forester Brigade
|
Table of Content
|
Use British English, Units, Regular battalions, Territorial battalions, References
|
Category:Latvian classical pianists
|
[[Category:Latvian pianists
|
Classical
Latvia
Pianists
|
Category:Latvian classical pianists
|
Table of Content
|
[[Category:Latvian pianists
|
Honoré Joseph Antoine Ganteaume
|
short description
|
Vice-Admiral Honoré Joseph Antoine Ganteaume (13 April 1755 – 28 July 1818) was a French Navy officer. He started his career at sea on East Indiamen, before serving during the American Revolutionary War under Charles Hector, comte d'Estaing and Pierre André de Suffren. During the French Revolutionary Wars, he was promoted to command the 74-gun Trente-et-un Mai, taking part in the Glorious First of June and the Croisière du Grand Hiver.
Ganteaume took part in the French invasion of Egypt and Syria, narrowly escaping death during the Battle of the Nile. There, he formed a personal relationship with Napoleon, who supported his promotion. He was made a Rear-Admiral and given command of a squadron to supply the Army of Egypt, but in Ganteaume's expeditions of 1801, he engaged in months of complicated manoeuvres to elude the Royal Navy and eventually failed his mission.
He supplied the French forces of the Saint-Domingue expedition. During the Trafalgar campaign, Ganteaume was to lead his squadron to the Caribbean to reinforce the ships of Pierre-Charles Villeneuve and Édouard Thomas Burgues de Missiessy, but he was blockaded by the British navy. Ganteaume held various offices during the late First French Empire, and gave his loyalty to Louis XVIII during the Bourbon Restoration in France.
|
Honoré Joseph Antoine Ganteaume
|
Career
|
Career
Ganteaume was born in La Ciotat, into a family of merchant sailors. He started sailing at the age of 14Michaud, p.98 on a merchantman commanded by his father,Levot, p.206 and by the time he reached the age of 22, Ganteaume had accomplished five campaigns in the Middle East and two in the Caribbean. He served on the Mississippi Company Indiaman Fier Rodrigue.
|
Honoré Joseph Antoine Ganteaume
|
Service in the American War of Independence
|
Service in the American War of Independence
In 1778, with the intervention of France in the American Revolutionary War, Ganteaume enlisted in the French Royal Navy as an auxiliary officer, while Fier Rodrigue was purchased into naval service as a 54-gun ship of the line. Fier Rodrigue escorted a convoy to America, and attached to a division under Toussaint-Guillaume Picquet de la MotteGranier, p.437 in the fleet of Admiral Charles Henri Hector, Count of Estaing.
In the fleet of Admiral d'Estaing, Ganteaume took part in the capture of Grenada and siege of Savannah. In 1781, he was promoted to auxiliary frigate lieutenant, and appointed to command the fluyt Marlborough in a convoy bound for the East Indies and escorted by Pierre André de Suffren.
From 1781 to 1785, Ganteaume served on the frigate SurveillanteMichaud (p.98) also mentions the "frigate Apollon", but no ship name Apollon was in service in the French Navy between 1758 and 1788 (furthermore, Apollon is an unlikely name for a frigate and more suitable for a ship of the line). He was promoted to Fireship CaptainCapitaine de brûlot in 1784, and sub-LieutenantSous-lieutenant de vaisseau in 1786.
Upon his return at the peace, Ganteaume was granted permission to return to the service of the Mississippi Company. He successively commanded the Indiamen Maréchal de Ségur, bound for Chian, and Prince de Condé and Constitution, bound for the Indies. In 1793, he was captured on an Indiaman and imprisoned by the British; released, he returned to the Navy, with the rank of Lieutenant. He served on the 74-gun Jupiter for a campaign in the Atlantic Ocean.
|
Honoré Joseph Antoine Ganteaume
|
Service on ''Trente-et-un Mai''
|
Service on Trente-et-un Mai
thumb|The 74-gun Trente-et-un Mai, which Ganteaume commanded between 1794 and 1795
Ganteaume was promoted to Captain in 1794, and was appointed to command the 74-gun Trente-et-un Mai. During the Atlantic campaign of May 1794, he attempted to attach to the French fleet under Villaret-Joyeuse, but only joined late in the Glorious First of June; he took part in the last throes of the battle, where he was thrice wounded.
In the winter, Geanteaume led Trente-et-un Mai in the Croisière du Grand Hiver, and notably rescued the crew of the stricken Scipion.Levot, p.207
In 1795, Trente-et-un Mai sailed to the Mediterranean, and cruised off Catalonia; she sustained a two-hour battle against a Spanish ship of the line. On 18 April 1795,Roche, p.313-314 Trente-et-un Mai was renamed Républicain. She attached to the fleet under Vice-Admiral Martin, and took part in the Battle of Hyères Islands.
In late 1795, Ganteaume was appointed to command a division in an expedition to Smyrna, comprising one ship of the line, four frigates and four corvettes. He sailed to Smyrna, where he lifted the blockade on Villeneuve's squadron, and captured the frigate HMS Nemesis.
In 1796, returned to the Ocean, Ganteaume successful ran the British blockade of Brest and sailed a convoy carrying munitions into the harbour.
|
Honoré Joseph Antoine Ganteaume
|
Service in Egypt
|
Service in Egypt
Appointed Chief of staff to Rear-Admiral and Navy Minister Bruix, Ganteaume took part in the French campaign in Egypt and Syria on the flagship Orient. He took part in the Battle of the Nile, where he was wounded, and narrowly escaped death when he left the burning Orient on a boat. Orient exploded soon after.
Promoted to Rear-Admiral upon request of General Bonaparte, Ganteaume led the flotilla of small ships of the Nile River, taking part in the Siege of Jaffa, the Siege of Acre and the Battle of Abukir.
On 22 August 1799, Ganteaume departed Alexandria with the frigates Muiron and Carrère, the aviso Revanche and a tartane, ferrying General Bonaparte back to France. Bonaparte ordered the ships to sail close to the shore of Africa to elude British squadrons, and landed in Corsica, to finally arrive at Fréjus on 2 October.
After arriving in France, Bonaparte, as First Consul, appointed Ganteaume to the Council of State, in which he presided the section of the Navy.
|
Honoré Joseph Antoine Ganteaume
|
Ganteaume's expeditions of 1801
|
Ganteaume's expeditions of 1801
In 1801, Ganteaume was appointed to command a seven-ship division in Brest, tasked with ferrying supplies and 5000 soldiers to the French Army of Egypt. After successfully crossing British-held Gibraltar, Ganteaume cruised in the Mediterranean for six months to elude the British fleet.
Ganteaume returned to Toulon to resupply and repair his ships. In the following months, he attempted three sorties, once arriving off Alexandria without landing: when he finally arrived near Egypt, actually Derna, Libya, in June 1801, the troops did not land, due to the hostility of the locals and the British naval threat.Mackesy, p.162Strathern, p. 418
Ganteaume eventually renounced and defiantly returned to Toulon, after capturing Elba and four British ships, including the 38-gun frigate HMS Success, and in the action of 24 June 1801, the 74-gun HMS Swiftsure, but failing his mission to supply the French armies in the Middle East.
Ganteaume's tergiversations motivated the satirical poem:
Vaisseaux lestés, tête sans lest,
Ainsi part l'amiral Ganteaume;
Il s'en va de Brest à Bertheaume,
Et revient de Bertheaume à Brest.Loaded ships, head without weight,
Thus departs Admiral Ganteaume;
He sails off from Brest to Bertheaume,
And sails back from Bertheaume to Brest.
|
Honoré Joseph Antoine Ganteaume
|
Service in Saint-Domingue and the Trafalgar Campaign
|
Service in Saint-Domingue and the Trafalgar Campaign
After the Treaty of Lunéville ended the War of the Second Coalition in early 1801, Ganteaume was tasked with supporting the French forces involved in the Saint-Domingue expedition. In 1802, Ganteaume was appointed Maritime Prefect for Toulon.
At the outbreak of the War of the Third Coalition the year after, and with the Coronation of Napoleon I and the advent of the First French Empire on 2 December 1804, Ganteaume was promoted to Vice-Admiral, made a Count of the Empire, and appointed to command the fleet in Brest.
In 1805, after the death of Vice-Admiral Latouche-Tréville and the outbreak of the Trafalgar Campaign, Napoléon briefly considered entrusting Ganteaume with an expedition to land an 18 000-man army in Ireland, in a move similar to what had been attempted in 1796 with the ill-fated Expédition d'Irlande; eventually, Ganteaume was ordered to the Caribbean to land reinforcements there and return to Europe with the fleets under Rear-Admiral Missiessy and Vice-Admiral Villeneuve.
Adverse weather prevented Ganteaume from leaving Brest, and he finally departed one month after Missiessy. In transit, Ganteaume bumped into the British Channel Fleet under Admiral Cornwallis and retreated to Brest, where he ended up hermetically blocked. Informed of the Battle of Cape Finisterre, Ganteaume was ordered to break into the Ocean by force to make his junction with Villeneuve; however, Villeneuve's port call to Cadiz thwarted this plan.Levot, p.208
|
Honoré Joseph Antoine Ganteaume
|
Later career
|
Later career
In 1808, Ganteaume took command of the French squadrons of Toulon and Rochefort, joined together at Toulon, with the aim to
ferry supplies to Corfu, then blockaded by the Royal Navy. He departed Toulon in early February, successfully escorted his convoy into Corfu harbour, and returned to Toulon in April. In February on the following year, he authorised the frigates Pénélope and Pauline to chase HMS Proserpine, yielding the action of 27 February 1809 in which Proserpine was captured and brought to Toulon.
In June 1808, Ganteaume was appointed General Inspector of the Coasts of the Ocean. From 1809 to 1810, Ganteaume was appointed to command the fleet in Toulon, but attacks of gout kept him increasingly away from the sea. In 1810, he joined the Council of the Admiralty. On 1 August 1811, Napoléon appointed Ganteaume to command the battalion of the Marins de la Garde in the Imperial Guard as a colonel.Comte Honoré Joseph Antoine GANTEAUME In 1813, he defended Toulon.
In 1814, at the first Bourbon Restoration, Ganteaume supported the Acte de déchéance de l'Empereur, and in consequence did not return to command during the Hundred Days; immediately after the Battle of Waterloo, he ordered the Royalist white flag hoisted in Toulon; this act got him almost killed.
Restored to power again, Louis XVIII made Ganteaume a Peer of France in recognition for his support. In December 1815, he was promoted to Commander in the Order of Saint Louis, and appointed General Inspector of the Classes. In his capacity of Peer of France, Ganteaume took part in the trial of Marshal Ney, and voted for his execution.
Ganteaume died at his property of Pauline, near Aubagne, on 28 September 1818. The Boulevard Amiral Ganteaume in Aubagne is named after him.
In 1801, the explorer Nicholas Baudin named Gantheaume Point, near Broome in Western Australia, after him.
|
Honoré Joseph Antoine Ganteaume
|
Notes and references
|
Notes and references
|
Honoré Joseph Antoine Ganteaume
|
Notes
|
Notes
|
Honoré Joseph Antoine Ganteaume
|
References
|
References
|
Honoré Joseph Antoine Ganteaume
|
Bibliography
|
Bibliography
|
Honoré Joseph Antoine Ganteaume
|
External links
|
External links
Category:1755 births
Category:1818 deaths
Category:French Navy admirals
Category:French naval commanders of the Napoleonic Wars
Category:Grand Cross of the Legion of Honour
Category:Members of the Chamber of Peers of the Bourbon Restoration
Category:People of the Haitian Revolution
Category:French military personnel of the American Revolutionary War
Category:Names inscribed under the Arc de Triomphe
|
Honoré Joseph Antoine Ganteaume
|
Table of Content
|
short description, Career, Service in the American War of Independence, Service on ''Trente-et-un Mai'', Service in Egypt, Ganteaume's expeditions of 1801, Service in Saint-Domingue and the Trafalgar Campaign, Later career, Notes and references, Notes, References, Bibliography, External links
|
Robertus Anglicus
|
Other uses
|
Robertus Anglicus or Robert the Englishman was an English astronomer of the thirteenth century. He taught at the University of Montpellier, and possibly also at Paris.http://www.textmanuscripts.com/home/archives/archivesdescription.php?m=189 He is known as the author of a 1271 commentary on the De Sphera Mundi of Johannes de Sacrobosco. It includes a significant reference to the state of the art in the technology of clockwork.Timeline - Clocks
He is also the author of the paper "Astrolabii Canones", which provided important principles for measurement on spheres.
|
Robertus Anglicus
|
References
|
References
|
Robertus Anglicus
|
Notes
|
Notes
Category:Medieval English astronomers
Category:13th-century English scientists
Category:13th-century astronomers
|
Robertus Anglicus
|
Table of Content
|
Other uses, References, Notes
|
James Grimston, 2nd Earl of Verulam
|
short description
|
James Walter Grimston, 2nd Earl of Verulam (20 February 1809 – 27 July 1895), known as Viscount Grimston from 1815 to 1845, was a British peer and Conservative politician. He was the eldest son of James Walter Grimston, 1st Earl of Verulam, and Lady Charlotte Jenkinson. He succeeded his father as 2nd Earl of Verulam in November 1845.
In 1860, The Times noted that Grimston was one of only three to hold peerages in all three Kingdoms of England, Scotland and Ireland.The Times, 9 February 1860; Peers of the Three Kingdoms.
|
James Grimston, 2nd Earl of Verulam
|
Family
|
Family
Lord Verulam married Elizabeth Joanna Weyland, daughter of Richard Weyland, in 1844. They had six children:
Lady Harriot Elizabeth Grimston (c.1845 – 15 August 1888), married Maj.-Gen. Francis Harwood Poore on 6 March 1885
Lady Jane Grimston (12 December 1848 – 2 November 1920), married Sir Alfred Jodrell, 4th Baronet on 25 February 1897
James Walter Grimston, 3rd Earl of Verulam (1852–1924)
Cmdr. William Grimston (7 January 1855 – 10 May 1900)
Lady Maud Grimston (c.1857 – 3 September 1929), married Maj. Paulyn Rawdon-Hastings, son of the 1st Baron Donington and the 10th Countess of Loudoun, and had issue
Canon Robert Grimston (18 April 1860 – 8 July 1928), married Gertrude Villiers and had issue, including the Conservative politician Robert Grimston, 1st Baron Grimston of Westbury.
Lord Verulam died in July 1895, aged 86, and was succeeded in his titles by his eldest son James.
|
James Grimston, 2nd Earl of Verulam
|
Politics and business
|
Politics and business
Verulam was elected to the House of Commons for St Albans in 1830, a seat he held until 1831, and then represented Newport, Cornwall from 1831 to 1832 and Hertfordshire from 1832 to 1845. The latter year Verulam succeeded his father in the earldom and entered the House of Lords. He later served in the first two administrations of the Earl of Derby as a Lord-in-waiting (government whip in the House of Lords) in 1852 and from 1858 to 1859. Between 1845 and 1892 he also held the honorary post of Lord Lieutenant of Hertfordshire, in succession to his father.
During a period of unrest in 1830 he raised the Cashio Troop of Hertfordshire Yeomanry Cavalry at the family seat of Gorhambury House and commanded it with the rank of captain. In 1832 it became a troop of the South Hertfordshire Yeomanry Cavalry, of which he became second-in-command with the rank of major. He was promoted to lieutenant-colonel in 1847 when he and the commanding officer, James Gascoyne-Cecil, 2nd Marquess of Salisbury, exchanged positions. He retained the command until 1864Sainsbury, pp. 43–50, 57–61.
|
James Grimston, 2nd Earl of Verulam
|
Cricket and other sport
|
Cricket and other sport
Verulam played first-class cricket as a right-handed batsman. He was mainly associated with Marylebone Cricket Club (MCC), making 21 appearances from 1830 to 1849. In contemporary scorecards to 1845, he was given as Lord Grimston.Arthur Haygarth, Scores & Biographies, Volumes 2–4 (1827–1854), Lillywhite, 1862 He was also a supporter of the boxing arts and in the early 1850s, he and his brother Robert frequented middleweight champion Nat Langham's Rum Pum-Pas club, a dining and boxing establishment in Westminster popular with the aristocracy.List of patrons, location and details of the Rum Pum-pas club in Thormanby, (1900) Boxers and their Battles; Antecdotal Sketches and Personal Recollections, London, R. A. Everett and Co., pg. 267-8.
Several members of his family were first-class cricketers: three of his brothers Edward, Robert and Francis all played, as did his nephews Walter Grimston and Lord Hyde.
|
James Grimston, 2nd Earl of Verulam
|
Folklore Society
|
Folklore Society
Verulam was the first President of the Folklore Society, serving in the role between 1878 and 1879. It has been suggested that Verulam - like the second and third Presidents of the Society, Frederick Lygon, 6th Earl Beauchamp and George Byng, 3rd Earl of Strafford - was not a folklore scholar but lent his patronage to the Society through the efforts of W. J. Thoms, Director of the Society but known to Verulam as deputy librarian of the House of Lords.
|
James Grimston, 2nd Earl of Verulam
|
Notes
|
Notes
|
James Grimston, 2nd Earl of Verulam
|
References
|
References
Kidd, Charles, Williamson, David (editors). Debrett's Peerage and Baronetage (1990 edition). New York: St Martin's Press, 1990,
Charles Mosley (ed.) Burke's Peerage, Baronetage & Knightage, 107th edition, 3 vols. (Wilmington, Delaware, U.S.A.: Burke's Peerage (Genealogical Books) Ltd, 2003), vol. 2, p. 2407.
Lt-Col J.D. Sainsbury, The Hertfordshire Yeomanry: An Illustrated History 1794–1920, Welwyn: Hart Books/Hertfordshire Yeomanry and Artillery Historical Trust, 1994, ISBN 0-948527-03-X.
|
James Grimston, 2nd Earl of Verulam
|
External links
|
External links
Category:1809 births
Category:1895 deaths
Category:English cricketers
Category:English cricketers of 1826 to 1863
Category:19th-century British sportsmen
Category:Marylebone Cricket Club cricketers
Grimston, James Grimston, Viscount
Category:Conservative Party (UK) Baronesses- and Lords-in-Waiting
Category:Lord-lieutenants of Hertfordshire
Grimston, James Grimston, Viscount
Grimston, James Grimston, Viscount
Grimston, James Grimston, Viscount
Grimston, James Grimston, Viscount
Grimston, James Grimston, Viscount
Grimston, James Grimston, Viscount
Category:UK MPs who inherited peerages
Category:Gentlemen cricketers
Category:Married v Single cricketers
Category:Non-international England cricketers
Category:Presidents of the Marylebone Cricket Club
Category:Gentlemen of England cricketers
Category:Hertfordshire Yeomanry officers
2
James
Category:Members of the Parliament of the United Kingdom for Hertfordshire
Category:Presidents of the Folklore Society
Category:A to K v L to Z cricketers
|
James Grimston, 2nd Earl of Verulam
|
Table of Content
|
short description, Family, Politics and business, Cricket and other sport, Folklore Society, Notes, References, External links
|
Philibert de Naillac
|
[[File:Rhodos440 (cropped).JPG
|
thumb|Imaginary portrait of Philibert de Naillac in the Palace of the Grand Master of the Knights of Rhodes
Philibert de Naillac ( – 1421) was grand master of the Knights Hospitaller from 1396 until his death in Rhodes in 1421. Prior to his election he was grand-prior of Aquitaine.
|
Philibert de Naillac
|
Life
|
Life
thumb|Coat of arms of Philibert de Naillac
Philibert de Naillac was born about 1340 of a noble family.Wokjian 1876, p. 833. But little is known of his personal history. He became master of the Order of the Knights of St. John of Jerusalem in 1376, and engaged in the Crusades, and was greatly distinguished by his valour and skill in warfare. He was prominently engaged in the battle of Nicopolis, and served the Christian interests by his treaties with the Saracens. Thus he concluded a treaty with the sultan of Egypt, which gave the Christians permission to enclose the Holy Sepulchre at Jerusalem with a wall; to maintain six knights of the Order of St. John within the city, free from all tribute, who should be permitted to carry on the hospitable duties of their profession in favour of all pilgrims led thither by devotion; that Christian slaves might be redeemed, either by purchase or by exchange with a Saracen; and that convents might be maintained in Jerusalem and in the other principal cities of the Holy Land. In 1415 internal dissension threatened the very existence of the Order of St. John. Naillac's wise counsels prevented all disgraceful proceedings; and when he died, in 1421, "he left the fraternity, at whose head he had been placed for so many years, at union with itself, at peace with its neighbours, and in a most flourishing state of prosperity."
|
Philibert de Naillac
|
See also
|
See also
List of grandmasters of the Knights Hospitaller
|
Philibert de Naillac
|
References
|
References
|
Philibert de Naillac
|
Sources
|
Sources
Attribution:
|
Philibert de Naillac
|
Further reading
|
Further reading
Boissat, Pierre (1629). Hisoire des Chevaliers de l'Ordre de St. Jean de Jerusalem. Paris: Michael Soly, Gervais Alliot.
Le Roulx, Joseph Delaville (1913). Les Hospitaliers à Rhodes jusqu'à la mort de Philibert de Naillac (1310–1421). Paris: Leroux.
Porter, Whitworth (1883). A History of the Knights of Malta. Rev. ed. London: Longmans, Green, & Co. pp. 203–21, 695, 726.
|
Philibert de Naillac
|
External links
|
External links
Category:1421 deaths
Category:Grand masters of the Knights Hospitaller
Category:Christians of the Battle of Nicopolis
Category:15th-century French military personnel
Category:Year of birth uncertain
|
Philibert de Naillac
|
Table of Content
|
[[File:Rhodos440 (cropped).JPG, Life, See also, References, Sources, Further reading, External links
|
Hilary Deacon
|
hatnote
|
Hilary John Deacon (10 January 1936 – 25 May 2010) was a South African archaeologist and academic. He was professor of archaeology at the University of Stellenbosch in Stellenbosch, South Africa. His research focused on the emergence of modern humans and African archaeology.Deacon, H.J., Deacon, J. 1999. Human beginnings in South Africa: uncovering the secrets of the Stone Age. Altamira Press. He was principal researcher at the Klasies River Caves, one of the oldest known sites of anatomically modern humans, who lived there circa 125,000 years ago.
|
Hilary Deacon
|
Early life and education
|
Early life and education
Hilary Deacon was born in Cape Town and did his undergraduate studies in geology and archaeology at the University of Cape Town, graduating in 1955. He then worked as an exploration geologist in Tanzania, Kenya, Ghana and the United Kingdom for six years. He returned to UCT to do an honours degree in archaeology under Ray Inskeep in 1962. Here he met the archaeologist, Janette Buckland, whom he married in 1962.
|
Hilary Deacon
|
Career
|
Career
He was appointed archaeologist and later became deputy director of the Albany Museum in Grahamstown where he worked from 1963 to 1971. He was the recipient of a British Council Scholarship in 1967 that enabled him to attend University College, London, where he was able to gain experience in the preparation of pollen samples, charcoal and other organic material from archaeological sites. He then established the Department of Archaeology at the University of Stellenbosch, until his retirement in 1999. He received his PhD from the University of Cape Town in 1974. He was a visiting professor at University of California, Berkeley (1986), a visiting fellow at Australian National University, Canberra (1984) and a visiting professor at the University of Chicago (1978).
His research centred around the emergence of modern humans and multidisciplinary African archaeology. He was the principal researcher at the well-known sites of Scott's Cave, Amanzi, Howiesons Poort, Wilton, Melkhoutboom, Highlands, Boomplaas and Matjes River, and latterly at Klasies River, one of the oldest known cave sites with well-preserved anatomically modern human remains dating from circa 115,000 years ago. Deacon taught archaeology at the University of Stellenbosch and wrote over a hundred publications in journals, books, monographs and conference proceedings. He served on the council of the university and was past-president of the South African Archaeological Society, the Southern African Association of Archaeologists, the South African Society for Quaternary Research and a member of the Board of Iziko Museums in Cape Town.
|
Hilary Deacon
|
Personal life
|
Personal life
Deacon was married to Janette Deacon, who also taught archaeology at the University of Stellenbosch.
|
Hilary Deacon
|
See also
|
See also
List of fossil sites (with link directory)
List of hominina (hominid) fossils (with images)
Late Stone Age
|
Hilary Deacon
|
References
|
References
|
Hilary Deacon
|
External links
|
External links
Hilary Deacon at PBS Archive
Hilary Deacon at Stellenbosch Writers
Category:1936 births
Category:2010 deaths
Category:Alumni of the University of London
Category:South African archaeologists
Category:People from Cape Town
Category:University of Cape Town alumni
Category:Academic staff of Stellenbosch University
Category:South African prehistorians
Category:Presidents of the South African Archaeological Society
|
Hilary Deacon
|
Table of Content
|
hatnote, Early life and education, Career, Personal life, See also, References, External links
|
File:Vancouver Olympic Village 2010.jpg
|
Summary
|
Summary
|
File:Vancouver Olympic Village 2010.jpg
|
Licensing
|
Licensing
|
File:Vancouver Olympic Village 2010.jpg
|
Table of Content
|
Summary, Licensing
|
Wooden Heart (novel)
|
Short description
|
Wooden Heart is a BBC Books original novel written by Martin Day and based on the long-running science fiction television series Doctor Who. It features the Tenth Doctor and Martha Jones.
|
Wooden Heart (novel)
|
Synopsis
|
Synopsis
Martha and the Doctor discover an apparently deserted starship, and soon, a village appears in the middle of the craft. As they try to work out the mystery of the village, and its connection to the ship, they find out that the village has other problems - fog and monsters surround them at every turn, and their children have been going missing.
|
Wooden Heart (novel)
|
Plot
|
Plot
The Doctor and Martha arrive on the Castor, an abandoned prison ship floating in space. Whilst exploring they find a fully populated village and forest, whose inhabitants appear to be unaware of the spaceship outside, and whose children are mysteriously disappearing. Later, The Doctor and Martha find a creature from another dimension, who, because of its telepathic powers, was used to remove the evil from prisoners in the Castor. To keep itself sane, it expelled the evil, creating a separate being which killed the crew. The telepathic creature then created the forest and village in an attempt to balance itself with goodness, but, due to low power supplies, it is having to remove small parts of the 'program', such as children, to conserve power. The Doctor offers to pilot the ship closer to a sun to give the creature more power to run the program, and a woman from the village absorbs the evil into her body, before exiling herself, so she can learn to control it. The Doctor and Martha then leave the creature to maintain the forest world.
|
Wooden Heart (novel)
|
Production
|
Production
According to an interview in Doctor Who Magazine, the working title was Children of the Fog.
|
Wooden Heart (novel)
|
Audiobook
|
Audiobook
An abridged audiobook was released in July 2007 by BBC Audiobooks and was read by Adjoa Andoh, who plays Francine Jones in the TV series.
|
Wooden Heart (novel)
|
See also
|
See also
Whoniverse
|
Wooden Heart (novel)
|
References
|
References
|
Wooden Heart (novel)
|
External links
|
External links
The Cloister Library - Wooden Heart
Category:2007 British novels
Category:2007 science fiction novels
Category:New Series Adventures
Category:Tenth Doctor novels
Category:Novels by Martin Day
|
Wooden Heart (novel)
|
Table of Content
|
Short description, Synopsis, Plot, Production, Audiobook, See also, References, External links
|
Subsets and Splits
No community queries yet
The top public SQL queries from the community will appear here once available.