Upload 5 files
Browse files- .gitattributes +1 -0
- Streamlit/Untitled.ipynb +293 -0
- Streamlit/header.png +0 -0
- Streamlit/main.py +205 -0
- Streamlit/streamlit-main-2022-10-10-17-10-73.webm +3 -0
- Streamlit/test_run_file.py +176 -0
.gitattributes
CHANGED
@@ -32,3 +32,4 @@ saved_model/**/* filter=lfs diff=lfs merge=lfs -text
|
|
32 |
*.zip filter=lfs diff=lfs merge=lfs -text
|
33 |
*.zst filter=lfs diff=lfs merge=lfs -text
|
34 |
*tfevents* filter=lfs diff=lfs merge=lfs -text
|
|
|
|
32 |
*.zip filter=lfs diff=lfs merge=lfs -text
|
33 |
*.zst filter=lfs diff=lfs merge=lfs -text
|
34 |
*tfevents* filter=lfs diff=lfs merge=lfs -text
|
35 |
+
Streamlit/streamlit-main-2022-10-10-17-10-73.webm filter=lfs diff=lfs merge=lfs -text
|
Streamlit/Untitled.ipynb
ADDED
@@ -0,0 +1,293 @@
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
1 |
+
{
|
2 |
+
"cells": [
|
3 |
+
{
|
4 |
+
"cell_type": "code",
|
5 |
+
"execution_count": 1,
|
6 |
+
"metadata": {},
|
7 |
+
"outputs": [
|
8 |
+
{
|
9 |
+
"ename": "ModuleNotFoundError",
|
10 |
+
"evalue": "No module named 'rdkit'",
|
11 |
+
"output_type": "error",
|
12 |
+
"traceback": [
|
13 |
+
"\u001b[0;31m---------------------------------------------------------------------------\u001b[0m",
|
14 |
+
"\u001b[0;31mModuleNotFoundError\u001b[0m Traceback (most recent call last)",
|
15 |
+
"Cell \u001b[0;32mIn [1], line 4\u001b[0m\n\u001b[1;32m 1\u001b[0m \u001b[38;5;28;01mimport\u001b[39;00m \u001b[38;5;21;01mpandas\u001b[39;00m \u001b[38;5;28;01mas\u001b[39;00m \u001b[38;5;21;01mpd\u001b[39;00m\n\u001b[1;32m 2\u001b[0m \u001b[38;5;28;01mimport\u001b[39;00m \u001b[38;5;21;01mnumpy\u001b[39;00m \u001b[38;5;28;01mas\u001b[39;00m \u001b[38;5;21;01mnp\u001b[39;00m\n\u001b[0;32m----> 4\u001b[0m \u001b[38;5;28;01mfrom\u001b[39;00m \u001b[38;5;21;01mrdkit\u001b[39;00m \u001b[38;5;28;01mimport\u001b[39;00m Chem\n\u001b[1;32m 5\u001b[0m \u001b[38;5;28;01mfrom\u001b[39;00m \u001b[38;5;21;01mrdkit\u001b[39;00m\u001b[38;5;21;01m.\u001b[39;00m\u001b[38;5;21;01mChem\u001b[39;00m \u001b[38;5;28;01mimport\u001b[39;00m AllChem\n\u001b[1;32m 6\u001b[0m \u001b[38;5;66;03m# from rdkit.Chem import Draw\u001b[39;00m\n",
|
16 |
+
"\u001b[0;31mModuleNotFoundError\u001b[0m: No module named 'rdkit'"
|
17 |
+
]
|
18 |
+
}
|
19 |
+
],
|
20 |
+
"source": [
|
21 |
+
"import pandas as pd\n",
|
22 |
+
"import numpy as np\n",
|
23 |
+
"\n",
|
24 |
+
"from rdkit import Chem\n",
|
25 |
+
"from rdkit.Chem import AllChem\n",
|
26 |
+
"# from rdkit.Chem import Draw\n",
|
27 |
+
"from rdkit.Chem import rdChemReactions as Reactions\n",
|
28 |
+
"\n",
|
29 |
+
"import tensorflow as tf\n",
|
30 |
+
"from tensorflow import keras\n",
|
31 |
+
"from keras.preprocessing import sequence\n",
|
32 |
+
"from keras.utils import pad_sequences\n",
|
33 |
+
"import keras\n",
|
34 |
+
"from keras import backend as K\n",
|
35 |
+
"from keras.models import load_model\n",
|
36 |
+
"import argparse\n",
|
37 |
+
"import h5py\n",
|
38 |
+
"import pdb\n"
|
39 |
+
]
|
40 |
+
},
|
41 |
+
{
|
42 |
+
"cell_type": "code",
|
43 |
+
"execution_count": null,
|
44 |
+
"metadata": {},
|
45 |
+
"outputs": [],
|
46 |
+
"source": [
|
47 |
+
"\n",
|
48 |
+
"seq_rdic = ['A', 'I', 'L', 'V', 'F', 'W', 'Y', 'N', 'C', 'Q', 'M','S', 'T', 'D', 'E', 'R', 'H', 'K', 'G', 'P', 'O', 'U', 'X', 'B', 'Z']\n",
|
49 |
+
"seq_dic = {w: i+1 for i, w in enumerate(seq_rdic)}\n",
|
50 |
+
"\n",
|
51 |
+
"\n",
|
52 |
+
"def encodeSeq(seq, seq_dic):\n",
|
53 |
+
" if pd.isnull(seq):\n",
|
54 |
+
" return [0]\n",
|
55 |
+
" else:\n",
|
56 |
+
" return [seq_dic[aa] for aa in seq]\n",
|
57 |
+
"\n",
|
58 |
+
"\n",
|
59 |
+
"def load_modelfile(model_string):\n",
|
60 |
+
"\tloaded_model = tf.keras.models.load_model(model_string)\n",
|
61 |
+
"\treturn loaded_model\n"
|
62 |
+
]
|
63 |
+
},
|
64 |
+
{
|
65 |
+
"cell_type": "code",
|
66 |
+
"execution_count": 4,
|
67 |
+
"metadata": {},
|
68 |
+
"outputs": [
|
69 |
+
{
|
70 |
+
"ename": "NameError",
|
71 |
+
"evalue": "name 'load_modelfile' is not defined",
|
72 |
+
"output_type": "error",
|
73 |
+
"traceback": [
|
74 |
+
"\u001b[0;31m---------------------------------------------------------------------------\u001b[0m",
|
75 |
+
"\u001b[0;31mNameError\u001b[0m Traceback (most recent call last)",
|
76 |
+
"Cell \u001b[0;32mIn [4], line 80\u001b[0m\n\u001b[1;32m 72\u001b[0m \u001b[38;5;28;01mreturn\u001b[39;00m prediction_vals[\u001b[38;5;241m0\u001b[39m][\u001b[38;5;241m0\u001b[39m]\n\u001b[1;32m 75\u001b[0m \u001b[38;5;66;03m# loaded_model = load_modelfile('./../CNN_results/model_final.model')\u001b[39;00m\n\u001b[1;32m 76\u001b[0m \n\u001b[1;32m 77\u001b[0m \u001b[38;5;66;03m# KEGG_compound_read = pd.read_csv('./../CNN_data/Final_test/kegg_compound.csv', index_col = 'Compound_ID')\u001b[39;00m\n\u001b[1;32m 78\u001b[0m \u001b[38;5;66;03m# kegg_df = KEGG_compound_read.reset_index()\u001b[39;00m\n\u001b[0;32m---> 80\u001b[0m loaded_model \u001b[38;5;241m=\u001b[39m load_modelfile(\u001b[38;5;124m'\u001b[39m\u001b[38;5;124m./../CNN_results_split_final/Final_model.model\u001b[39m\u001b[38;5;124m'\u001b[39m)\n\u001b[1;32m 81\u001b[0m KEGG_compound_read \u001b[38;5;241m=\u001b[39m pd\u001b[38;5;241m.\u001b[39mread_csv(\u001b[38;5;124m'\u001b[39m\u001b[38;5;124m./../CNN_data/Final_test/kegg_compound.csv\u001b[39m\u001b[38;5;124m'\u001b[39m, index_col \u001b[38;5;241m=\u001b[39m \u001b[38;5;124m'\u001b[39m\u001b[38;5;124mCompound_ID\u001b[39m\u001b[38;5;124m'\u001b[39m)\n\u001b[1;32m 82\u001b[0m kegg_df \u001b[38;5;241m=\u001b[39m KEGG_compound_read\u001b[38;5;241m.\u001b[39mreset_index()\n",
|
77 |
+
"\u001b[0;31mNameError\u001b[0m: name 'load_modelfile' is not defined"
|
78 |
+
]
|
79 |
+
}
|
80 |
+
],
|
81 |
+
"source": [
|
82 |
+
"\n",
|
83 |
+
"def prot_feature_gen_from_str_input(prot_input_str, prot_len=2500):\n",
|
84 |
+
" Prot_ID = prot_input_str.split(':')[0]\n",
|
85 |
+
" Prot_seq = prot_input_str.split(':')[1]\n",
|
86 |
+
" prot_dataframe = pd.DataFrame(\n",
|
87 |
+
" {'Protein_ID': Prot_ID, 'Sequence': Prot_seq}, index=[0])\n",
|
88 |
+
" prot_dataframe.set_index('Protein_ID')\n",
|
89 |
+
"\n",
|
90 |
+
" prot_dataframe[\"encoded_sequence\"] = prot_dataframe.Sequence.map(\n",
|
91 |
+
" lambda a: encodeSeq(a, seq_dic))\n",
|
92 |
+
" prot_feature = pad_sequences(\n",
|
93 |
+
" prot_dataframe[\"encoded_sequence\"].values, prot_len)\n",
|
94 |
+
"\n",
|
95 |
+
" return prot_feature, Prot_ID\n",
|
96 |
+
"\n",
|
97 |
+
"\n",
|
98 |
+
"def mol_feature_gen_from_str_input(mol_str, kegg_id_flag, kegg_df):\n",
|
99 |
+
"\n",
|
100 |
+
"\tif kegg_id_flag == 1:\n",
|
101 |
+
"\t\tKEGG_ID = mol_str\n",
|
102 |
+
"\t\tkegg_id_loc = kegg_df.index[kegg_df.Compound_ID == KEGG_ID][0]\n",
|
103 |
+
"\t\tKEGG_ID_info = kegg_df.loc[kegg_id_loc]\n",
|
104 |
+
"\t\tKEGG_ID_info_df = KEGG_ID_info.to_frame().T.set_index('Compound_ID')\n",
|
105 |
+
"\n",
|
106 |
+
"\t\tfinal_return = KEGG_ID_info_df\n",
|
107 |
+
"\t\tfinal_id = KEGG_ID\n",
|
108 |
+
"\n",
|
109 |
+
"\telse:\n",
|
110 |
+
"\t\ttry:\n",
|
111 |
+
"\t\t\tmol_ID = mol_str.split(':')[0]\n",
|
112 |
+
"\t\t\tmol_smiles = mol_str.split(':')[1]\n",
|
113 |
+
"\t\t\tmol = Chem.MolFromSmiles(mol_smiles)\n",
|
114 |
+
"\t\t\tfp1 = AllChem.GetMorganFingerprintAsBitVect(\n",
|
115 |
+
"\t\t\t mol, useChirality=True, radius=2, nBits=2048)\n",
|
116 |
+
"\t\t\tfp_list = list(np.array(fp1).astype(float))\n",
|
117 |
+
"\t\t\tfp_str = list(map(str, fp_list))\n",
|
118 |
+
"\t\t\tmol_fp = '\\t'.join(fp_str)\n",
|
119 |
+
"\n",
|
120 |
+
"\t\t\tmol_dict = {}\n",
|
121 |
+
"\t\t\tmol_dict['Compound_ID'] = mol_ID\n",
|
122 |
+
"\t\t\tmol_dict['Smiles'] = mol_smiles\n",
|
123 |
+
"\t\t\tmol_dict['morgan_fp_r2'] = mol_fp\n",
|
124 |
+
"\n",
|
125 |
+
"\t\t\tmol_info_df = pd.DataFrame(mol_dict, index=[0])\n",
|
126 |
+
"\t\t\tmol_info_df.set_index('Compound_ID')\n",
|
127 |
+
"\n",
|
128 |
+
"\t\t\tfinal_return = mol_info_df\n",
|
129 |
+
"\t\t\tfinal_id = mol_ID\n",
|
130 |
+
"\n",
|
131 |
+
"\t\texcept Exception as error:\n",
|
132 |
+
"\t\t\tprint('Something wrong with molecule input string...' + repr(error))\n",
|
133 |
+
"\n",
|
134 |
+
"\treturn final_return, final_id\n",
|
135 |
+
"\n",
|
136 |
+
"\n",
|
137 |
+
"def act_df_gen_mol_feature(mol_id, prot_id):\n",
|
138 |
+
"\tact_df = pd.DataFrame(\n",
|
139 |
+
"\t {'Protein_ID': prot_id, 'Compound_ID': mol_id}, index=[0])\n",
|
140 |
+
"\n",
|
141 |
+
"\treturn act_df\n",
|
142 |
+
"\n",
|
143 |
+
"\n",
|
144 |
+
"def compound_feature_gen_df_input(act_df, comp_df, comp_len=2048, comp_vec='morgan_fp_r2'):\n",
|
145 |
+
"\tact_df = pd.merge(act_df, comp_df, left_on='Compound_ID', right_index=True)\n",
|
146 |
+
"\tcomp_feature = np.stack(act_df[comp_vec].map(lambda fp: fp.split(\"\\t\")))\n",
|
147 |
+
"\tcomp_feature = comp_feature.astype('float')\n",
|
148 |
+
"\treturn comp_feature\n",
|
149 |
+
"\n",
|
150 |
+
"\n",
|
151 |
+
"def model_prediction(compound_feature, enz_feature, model):\n",
|
152 |
+
" prediction_vals = model.predict([compound_feature, enz_feature])\n",
|
153 |
+
"\n",
|
154 |
+
" return prediction_vals[0][0]\n",
|
155 |
+
"\n",
|
156 |
+
"\n",
|
157 |
+
"# loaded_model = load_modelfile('./../CNN_results/model_final.model')\n",
|
158 |
+
"\n",
|
159 |
+
"# KEGG_compound_read = pd.read_csv('./../CNN_data/Final_test/kegg_compound.csv', index_col = 'Compound_ID')\n",
|
160 |
+
"# kegg_df = KEGG_compound_read.reset_index()\n",
|
161 |
+
"\n",
|
162 |
+
"loaded_model = load_modelfile('./../CNN_results_split_final/Final_model.model')\n",
|
163 |
+
"KEGG_compound_read = pd.read_csv('./../CNN_data/Final_test/kegg_compound.csv', index_col = 'Compound_ID')\n",
|
164 |
+
"kegg_df = KEGG_compound_read.reset_index()\n",
|
165 |
+
"\n",
|
166 |
+
"\n",
|
167 |
+
"# def img_to_bytes(img_path):\n",
|
168 |
+
"# img_bytes = Path(img_path).read_bytes()\n",
|
169 |
+
"# encoded = base64.b64encode(img_bytes).decode()\n",
|
170 |
+
"# return encoded\n",
|
171 |
+
"# # st.title('dGPredictor')\n",
|
172 |
+
"\n",
|
173 |
+
"# header_html = \"<img src='../figures/header.png'>\"\n",
|
174 |
+
"\n",
|
175 |
+
"# st.markdown(\n",
|
176 |
+
"# header_html, unsafe_allow_html=True,\n",
|
177 |
+
"# )\n",
|
178 |
+
"\n"
|
179 |
+
]
|
180 |
+
},
|
181 |
+
{
|
182 |
+
"cell_type": "code",
|
183 |
+
"execution_count": 3,
|
184 |
+
"metadata": {},
|
185 |
+
"outputs": [
|
186 |
+
{
|
187 |
+
"name": "stdout",
|
188 |
+
"output_type": "stream",
|
189 |
+
"text": [
|
190 |
+
"Error somewhere...NameError(\"name 'prot_feature_gen_from_str_input' is not defined\")\n"
|
191 |
+
]
|
192 |
+
},
|
193 |
+
{
|
194 |
+
"ename": "NameError",
|
195 |
+
"evalue": "name 'compound_feature1' is not defined",
|
196 |
+
"output_type": "error",
|
197 |
+
"traceback": [
|
198 |
+
"\u001b[0;31m---------------------------------------------------------------------------\u001b[0m",
|
199 |
+
"\u001b[0;31mNameError\u001b[0m Traceback (most recent call last)",
|
200 |
+
"Cell \u001b[0;32mIn [3], line 16\u001b[0m\n\u001b[1;32m 13\u001b[0m \u001b[38;5;28;01mexcept\u001b[39;00m \u001b[38;5;167;01mException\u001b[39;00m \u001b[38;5;28;01mas\u001b[39;00m e:\n\u001b[1;32m 14\u001b[0m \u001b[38;5;28mprint\u001b[39m(\u001b[38;5;124m'\u001b[39m\u001b[38;5;124mError somewhere...\u001b[39m\u001b[38;5;124m'\u001b[39m \u001b[38;5;241m+\u001b[39m \u001b[38;5;28mrepr\u001b[39m(e))\n\u001b[0;32m---> 16\u001b[0m \u001b[38;5;28mprint\u001b[39m(\u001b[38;5;28mtype\u001b[39m(compound_feature1))\n",
|
201 |
+
"\u001b[0;31mNameError\u001b[0m: name 'compound_feature1' is not defined"
|
202 |
+
]
|
203 |
+
}
|
204 |
+
],
|
205 |
+
"source": [
|
206 |
+
"\n",
|
207 |
+
"enz_str =\"A0A4P8WFA8:MTKRVLVTGGAGFLGSHLCERLLSEGHEVICLDNFGSGRRKNIKEFEDHPSFKVNDRDVRISESLPSVDRIYHLASRASPADFTQFPVNIALANTQGTRRLLDQARACDARMVFASTSEVYGDPKVHPQPETYTGNVNIRGARGCYDESKRFGETLTVAYQRKYDVDARTVRIFNTYGPRMRPDDGRVVPTFVTQALRGDDLTIYGDGEQTRSFCYVDDLIEGLISLMRVDNPEHNVYNIGKENERTIKELAYEVLGLTDTESDIVYEPLPEDDPGQRRPDITRAKTELDWEPKISLREGLEDTITYFDN\"\n",
|
208 |
+
"\n",
|
209 |
+
"comp_str = 'C00149:O[C@@H](CC([O-])=O)C([O-])=O'\n",
|
210 |
+
"try:\n",
|
211 |
+
" prot_feature, prot_id = prot_feature_gen_from_str_input(enz_str)\n",
|
212 |
+
" kegg_id_flag = 0\n",
|
213 |
+
" comp_feature, comp_id = mol_feature_gen_from_str_input(comp_str, kegg_id_flag, kegg_df)\n",
|
214 |
+
"\n",
|
215 |
+
" act_dataframe = act_df_gen_mol_feature(comp_id, prot_id)\n",
|
216 |
+
" # pdb.set_trace()\n",
|
217 |
+
" compound_feature1 = compound_feature_gen_df_input(act_dataframe, comp_feature)\n",
|
218 |
+
"\n",
|
219 |
+
"except Exception as e:\n",
|
220 |
+
" print('Error somewhere...' + repr(e))\n",
|
221 |
+
"\n",
|
222 |
+
"print(type(compound_feature1))\n"
|
223 |
+
]
|
224 |
+
},
|
225 |
+
{
|
226 |
+
"cell_type": "code",
|
227 |
+
"execution_count": 11,
|
228 |
+
"metadata": {},
|
229 |
+
"outputs": [
|
230 |
+
{
|
231 |
+
"name": "stdout",
|
232 |
+
"output_type": "stream",
|
233 |
+
"text": [
|
234 |
+
"1/1 [==============================] - 0s 223ms/step\n"
|
235 |
+
]
|
236 |
+
}
|
237 |
+
],
|
238 |
+
"source": [
|
239 |
+
"\n",
|
240 |
+
"EnzRankScore = model_prediction(compound_feature1, prot_feature, loaded_model)\n",
|
241 |
+
"es = EnzRankScore"
|
242 |
+
]
|
243 |
+
},
|
244 |
+
{
|
245 |
+
"cell_type": "code",
|
246 |
+
"execution_count": 12,
|
247 |
+
"metadata": {},
|
248 |
+
"outputs": [
|
249 |
+
{
|
250 |
+
"data": {
|
251 |
+
"text/plain": [
|
252 |
+
"0.9315796"
|
253 |
+
]
|
254 |
+
},
|
255 |
+
"execution_count": 12,
|
256 |
+
"metadata": {},
|
257 |
+
"output_type": "execute_result"
|
258 |
+
}
|
259 |
+
],
|
260 |
+
"source": [
|
261 |
+
"es"
|
262 |
+
]
|
263 |
+
},
|
264 |
+
{
|
265 |
+
"cell_type": "code",
|
266 |
+
"execution_count": null,
|
267 |
+
"metadata": {},
|
268 |
+
"outputs": [],
|
269 |
+
"source": []
|
270 |
+
}
|
271 |
+
],
|
272 |
+
"metadata": {
|
273 |
+
"kernelspec": {
|
274 |
+
"display_name": "Python 3 (ipykernel)",
|
275 |
+
"language": "python",
|
276 |
+
"name": "python3"
|
277 |
+
},
|
278 |
+
"language_info": {
|
279 |
+
"codemirror_mode": {
|
280 |
+
"name": "ipython",
|
281 |
+
"version": 3
|
282 |
+
},
|
283 |
+
"file_extension": ".py",
|
284 |
+
"mimetype": "text/x-python",
|
285 |
+
"name": "python",
|
286 |
+
"nbconvert_exporter": "python",
|
287 |
+
"pygments_lexer": "ipython3",
|
288 |
+
"version": "3.8.8"
|
289 |
+
}
|
290 |
+
},
|
291 |
+
"nbformat": 4,
|
292 |
+
"nbformat_minor": 4
|
293 |
+
}
|
Streamlit/header.png
ADDED
![]() |
Streamlit/main.py
ADDED
@@ -0,0 +1,205 @@
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
1 |
+
import streamlit as st
|
2 |
+
import pandas as pd
|
3 |
+
import numpy as np
|
4 |
+
import re
|
5 |
+
from PIL import Image
|
6 |
+
import webbrowser
|
7 |
+
|
8 |
+
from rdkit import Chem
|
9 |
+
from rdkit.Chem import AllChem
|
10 |
+
from rdkit.Chem import Draw
|
11 |
+
from rdkit.Chem import rdChemReactions as Reactions
|
12 |
+
|
13 |
+
import tensorflow as tf
|
14 |
+
from tensorflow import keras
|
15 |
+
from keras.preprocessing import sequence
|
16 |
+
from keras.utils import pad_sequences
|
17 |
+
import keras
|
18 |
+
from keras import backend as K
|
19 |
+
from keras.models import load_model
|
20 |
+
import argparse
|
21 |
+
import h5py
|
22 |
+
import pdb
|
23 |
+
|
24 |
+
|
25 |
+
seq_rdic = ['A', 'I', 'L', 'V', 'F', 'W', 'Y', 'N', 'C', 'Q', 'M',
|
26 |
+
'S', 'T', 'D', 'E', 'R', 'H', 'K', 'G', 'P', 'O', 'U', 'X', 'B', 'Z']
|
27 |
+
seq_dic = {w: i+1 for i, w in enumerate(seq_rdic)}
|
28 |
+
|
29 |
+
|
30 |
+
@st.cache(allow_output_mutation=True)
|
31 |
+
def encodeSeq(seq, seq_dic):
|
32 |
+
if pd.isnull(seq):
|
33 |
+
return [0]
|
34 |
+
else:
|
35 |
+
return [seq_dic[aa] for aa in seq]
|
36 |
+
|
37 |
+
|
38 |
+
@st.cache(allow_output_mutation=True)
|
39 |
+
def load_modelfile(model_string):
|
40 |
+
loaded_model = tf.keras.models.load_model(model_string)
|
41 |
+
return loaded_model
|
42 |
+
|
43 |
+
|
44 |
+
@st.cache(allow_output_mutation=True)
|
45 |
+
def prot_feature_gen_from_str_input(prot_input_str, prot_len=2500):
|
46 |
+
Prot_ID = prot_input_str.split(':')[0]
|
47 |
+
Prot_seq = prot_input_str.split(':')[1]
|
48 |
+
prot_dataframe = pd.DataFrame(
|
49 |
+
{'Protein_ID': Prot_ID, 'Sequence': Prot_seq}, index=[0])
|
50 |
+
prot_dataframe.set_index('Protein_ID')
|
51 |
+
|
52 |
+
prot_dataframe["encoded_sequence"] = prot_dataframe.Sequence.map(
|
53 |
+
lambda a: encodeSeq(a, seq_dic))
|
54 |
+
prot_feature = pad_sequences(
|
55 |
+
prot_dataframe["encoded_sequence"].values, prot_len)
|
56 |
+
|
57 |
+
return prot_feature, Prot_ID
|
58 |
+
|
59 |
+
|
60 |
+
@st.cache(allow_output_mutation=True)
|
61 |
+
def mol_feature_gen_from_str_input(mol_str, kegg_id_flag, kegg_df):
|
62 |
+
|
63 |
+
if kegg_id_flag == 1:
|
64 |
+
KEGG_ID = mol_str
|
65 |
+
kegg_id_loc = kegg_df.index[kegg_df.Compound_ID == KEGG_ID][0]
|
66 |
+
KEGG_ID_info = kegg_df.loc[kegg_id_loc]
|
67 |
+
KEGG_ID_info_df = KEGG_ID_info.to_frame().T.set_index('Compound_ID')
|
68 |
+
|
69 |
+
final_return = KEGG_ID_info_df
|
70 |
+
final_id = KEGG_ID
|
71 |
+
|
72 |
+
else:
|
73 |
+
try:
|
74 |
+
mol_ID = mol_str.split(':')[0]
|
75 |
+
mol_smiles = mol_str.split(':')[1]
|
76 |
+
mol = Chem.MolFromSmiles(mol_smiles)
|
77 |
+
fp1 = AllChem.GetMorganFingerprintAsBitVect(
|
78 |
+
mol, useChirality=True, radius=2, nBits=2048)
|
79 |
+
fp_list = list(np.array(fp1).astype(float))
|
80 |
+
fp_str = list(map(str, fp_list))
|
81 |
+
mol_fp = '\t'.join(fp_str)
|
82 |
+
|
83 |
+
mol_dict = {}
|
84 |
+
mol_dict['Compound_ID'] = mol_ID
|
85 |
+
mol_dict['Smiles'] = mol_smiles
|
86 |
+
mol_dict['morgan_fp_r2'] = mol_fp
|
87 |
+
|
88 |
+
mol_info_df = pd.DataFrame(mol_dict, index=[0])
|
89 |
+
mol_info_df = mol_info_df.set_index('Compound_ID')
|
90 |
+
|
91 |
+
final_return = mol_info_df
|
92 |
+
final_id = mol_ID
|
93 |
+
|
94 |
+
except Exception as error:
|
95 |
+
print('Something wrong with molecule input string...' + repr(error))
|
96 |
+
|
97 |
+
return final_return, final_id
|
98 |
+
|
99 |
+
|
100 |
+
@st.cache(allow_output_mutation=True)
|
101 |
+
def act_df_gen_mol_feature(mol_id, prot_id):
|
102 |
+
act_df = pd.DataFrame(
|
103 |
+
{'Protein_ID': prot_id, 'Compound_ID': mol_id}, index=[0])
|
104 |
+
|
105 |
+
return act_df
|
106 |
+
|
107 |
+
|
108 |
+
@st.cache(allow_output_mutation=True)
|
109 |
+
def compound_feature_gen_df_input(act_df, comp_df, comp_len=2048, comp_vec='morgan_fp_r2'):
|
110 |
+
act_df = pd.merge(act_df, comp_df, left_on='Compound_ID', right_index=True)
|
111 |
+
comp_feature = np.stack(act_df[comp_vec].map(lambda fp: fp.split("\t")))
|
112 |
+
comp_feature = comp_feature.astype('float')
|
113 |
+
return comp_feature
|
114 |
+
|
115 |
+
|
116 |
+
@st.cache(allow_output_mutation=True)
|
117 |
+
def model_prediction(compound_feature, enz_feature, model):
|
118 |
+
prediction_vals = model.predict([compound_feature, enz_feature])
|
119 |
+
|
120 |
+
return prediction_vals[0][0]
|
121 |
+
|
122 |
+
|
123 |
+
# loaded_model = load_modelfile('./../CNN_results/model_final.model')
|
124 |
+
|
125 |
+
# KEGG_compound_read = pd.read_csv('./../CNN_data/Final_test/kegg_compound.csv', index_col = 'Compound_ID')
|
126 |
+
# kegg_df = KEGG_compound_read.reset_index()
|
127 |
+
|
128 |
+
|
129 |
+
def main():
|
130 |
+
graph = tf.compat.v1.get_default_graph()
|
131 |
+
ld_model = tf.keras.models.load_model('./../CNN_results_split_final/Final_model.model')
|
132 |
+
|
133 |
+
KEGG_compound_read = pd.read_csv('./../CNN_data/Final_test/kegg_compound.csv', index_col = 'Compound_ID')
|
134 |
+
kegg_df = KEGG_compound_read.reset_index()
|
135 |
+
|
136 |
+
|
137 |
+
# def img_to_bytes(img_path):
|
138 |
+
# img_bytes = Path(img_path).read_bytes()
|
139 |
+
# encoded = base64.b64encode(img_bytes).decode()
|
140 |
+
# return encoded
|
141 |
+
# # st.title('dGPredictor')
|
142 |
+
|
143 |
+
# header_html = "<img src='../figures/header.png'>"
|
144 |
+
|
145 |
+
# st.markdown(
|
146 |
+
# header_html, unsafe_allow_html=True,
|
147 |
+
# )
|
148 |
+
|
149 |
+
|
150 |
+
st.image('./header.png', use_column_width=True)
|
151 |
+
|
152 |
+
st.subheader('Enzyme-Substrate Activity Predictor ')
|
153 |
+
|
154 |
+
st.subheader('Enzyme sequence')
|
155 |
+
st.caption('Please follow the input format show in the text box--> id:Sequence')
|
156 |
+
|
157 |
+
enz_str = st.text_input('', value="A0A4P8WFA8:MTKRVLVTGGAGFLGSHLCERLLSEGHEVICLDNFGSGRRKNIKEFEDHPSFKVNDRDVRISESLPSVDRIYHLASRASPADFTQFPVNIALANTQGTRRLLDQARACDARMVFASTSEVYGDPKVHPQPETYTGNVNIRGARGCYDESKRFGETLTVAYQRKYDVDARTVRIFNTYGPRMRPDDGRVVPTFVTQALRGDDLTIYGDGEQTRSFCYVDDLIEGLISLMRVDNPEHNVYNIGKENERTIKELAYEVLGLTDTESDIVYEPLPEDDPGQRRPDITRAKTELDWEPKISLREGLEDTITYFDN")
|
158 |
+
|
159 |
+
# url = 'https://www.genome.jp/dbget-bin/www_bget?rn:R00801'
|
160 |
+
# if st.button('KEformat example'):
|
161 |
+
# webbrowser.open_new_tab(url)
|
162 |
+
|
163 |
+
st.subheader('Substrate ')
|
164 |
+
st.caption('Please follow the input format show in the text box--> KEGG id or click the checkbox')
|
165 |
+
|
166 |
+
comp_str = st.text_input('', value="C00149")
|
167 |
+
if st.checkbox('If you are entering smiles string along with KEGG ID'):
|
168 |
+
add_info = st.text_area('Additional information (id: Smiles):', "C00149:O[C@@H](CC([O-])=O)C([O-])=O")
|
169 |
+
else:
|
170 |
+
add_info = ''
|
171 |
+
|
172 |
+
if st.button("Predict"):
|
173 |
+
# if session_state.button_search:
|
174 |
+
# st.subheader('Enzyme-Substrate activity score')
|
175 |
+
with st.spinner('Calculating...'):
|
176 |
+
try:
|
177 |
+
# st.write('I am inside')
|
178 |
+
prot_feature, prot_id = prot_feature_gen_from_str_input(enz_str)
|
179 |
+
if len(add_info) == 0:
|
180 |
+
kegg_id_flag = 1
|
181 |
+
comp_feature, comp_id = mol_feature_gen_from_str_input(comp_str, kegg_id_flag, kegg_df)
|
182 |
+
else:
|
183 |
+
kegg_id_flag = 0
|
184 |
+
comp_feature, comp_id = mol_feature_gen_from_str_input(add_info, kegg_id_flag, kegg_df)
|
185 |
+
|
186 |
+
act_dataframe = act_df_gen_mol_feature(comp_id, prot_id)
|
187 |
+
# st.write(act_dataframe)
|
188 |
+
compound_feature = compound_feature_gen_df_input(act_dataframe, comp_feature)
|
189 |
+
# st.write(compound_feature)
|
190 |
+
|
191 |
+
except Exception as e:
|
192 |
+
st.write('Error somewhere...' + repr(e))
|
193 |
+
|
194 |
+
# st.write(compound_feature)
|
195 |
+
# st.write(prot_feature)
|
196 |
+
# keras.backend.clear_session()
|
197 |
+
|
198 |
+
y = ld_model.predict([compound_feature, prot_feature])
|
199 |
+
|
200 |
+
subheaderstring = 'EnzRank Score for '+ prot_id + '-' + comp_id + ' pair:'
|
201 |
+
st.subheader(subheaderstring)
|
202 |
+
st.write(str(y[0][0]))
|
203 |
+
|
204 |
+
if __name__ == '__main__':
|
205 |
+
main()
|
Streamlit/streamlit-main-2022-10-10-17-10-73.webm
ADDED
@@ -0,0 +1,3 @@
|
|
|
|
|
|
|
|
|
1 |
+
version https://git-lfs.github.com/spec/v1
|
2 |
+
oid sha256:491b9f0b51969d6171fc1daccf7de1f97a8a8b616a2d2c13afaf252bf23c753c
|
3 |
+
size 7700063
|
Streamlit/test_run_file.py
ADDED
@@ -0,0 +1,176 @@
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
|
1 |
+
|
2 |
+
import pandas as pd
|
3 |
+
import numpy as np
|
4 |
+
|
5 |
+
from rdkit import Chem
|
6 |
+
from rdkit.Chem import AllChem
|
7 |
+
# from rdkit.Chem import Draw
|
8 |
+
from rdkit.Chem import rdChemReactions as Reactions
|
9 |
+
|
10 |
+
import tensorflow as tf
|
11 |
+
from tensorflow import keras
|
12 |
+
from keras.preprocessing import sequence
|
13 |
+
from keras.utils import pad_sequences
|
14 |
+
import keras
|
15 |
+
from keras import backend as K
|
16 |
+
from keras.models import load_model
|
17 |
+
import argparse
|
18 |
+
import h5py
|
19 |
+
import pdb
|
20 |
+
|
21 |
+
|
22 |
+
seq_rdic = ['A', 'I', 'L', 'V', 'F', 'W', 'Y', 'N', 'C', 'Q', 'M','S', 'T', 'D', 'E', 'R', 'H', 'K', 'G', 'P', 'O', 'U', 'X', 'B', 'Z']
|
23 |
+
seq_dic = {w: i+1 for i, w in enumerate(seq_rdic)}
|
24 |
+
|
25 |
+
|
26 |
+
def encodeSeq(seq, seq_dic):
|
27 |
+
if pd.isnull(seq):
|
28 |
+
return [0]
|
29 |
+
else:
|
30 |
+
return [seq_dic[aa] for aa in seq]
|
31 |
+
|
32 |
+
|
33 |
+
def load_modelfile(model_string):
|
34 |
+
loaded_model = tf.keras.models.load_model(model_string)
|
35 |
+
return loaded_model
|
36 |
+
|
37 |
+
|
38 |
+
def prot_feature_gen_from_str_input(prot_input_str, prot_len=2500):
|
39 |
+
Prot_ID = prot_input_str.split(':')[0]
|
40 |
+
Prot_seq = prot_input_str.split(':')[1]
|
41 |
+
prot_dataframe = pd.DataFrame(
|
42 |
+
{'Protein_ID': Prot_ID, 'Sequence': Prot_seq}, index=[0])
|
43 |
+
prot_dataframe.set_index('Protein_ID')
|
44 |
+
|
45 |
+
prot_dataframe["encoded_sequence"] = prot_dataframe.Sequence.map(
|
46 |
+
lambda a: encodeSeq(a, seq_dic))
|
47 |
+
prot_feature = pad_sequences(
|
48 |
+
prot_dataframe["encoded_sequence"].values, prot_len)
|
49 |
+
|
50 |
+
return prot_feature, Prot_ID
|
51 |
+
|
52 |
+
|
53 |
+
def mol_feature_gen_from_str_input(mol_str, kegg_id_flag, kegg_df):
|
54 |
+
|
55 |
+
if kegg_id_flag == 1:
|
56 |
+
KEGG_ID = mol_str
|
57 |
+
kegg_id_loc = kegg_df.index[kegg_df.Compound_ID == KEGG_ID][0]
|
58 |
+
KEGG_ID_info = kegg_df.loc[kegg_id_loc]
|
59 |
+
KEGG_ID_info_df = KEGG_ID_info.to_frame().T.set_index('Compound_ID')
|
60 |
+
|
61 |
+
final_return = KEGG_ID_info_df
|
62 |
+
final_id = KEGG_ID
|
63 |
+
|
64 |
+
else:
|
65 |
+
try:
|
66 |
+
mol_ID = mol_str.split(':')[0]
|
67 |
+
mol_smiles = mol_str.split(':')[1]
|
68 |
+
mol = Chem.MolFromSmiles(mol_smiles)
|
69 |
+
fp1 = AllChem.GetMorganFingerprintAsBitVect(
|
70 |
+
mol, useChirality=True, radius=2, nBits=2048)
|
71 |
+
fp_list = list(np.array(fp1).astype(float))
|
72 |
+
fp_str = list(map(str, fp_list))
|
73 |
+
mol_fp = '\t'.join(fp_str)
|
74 |
+
|
75 |
+
mol_dict = {}
|
76 |
+
mol_dict['Compound_ID'] = mol_ID
|
77 |
+
mol_dict['Smiles'] = mol_smiles
|
78 |
+
mol_dict['morgan_fp_r2'] = mol_fp
|
79 |
+
|
80 |
+
mol_info_df = pd.DataFrame(mol_dict, index=[0])
|
81 |
+
mol_info_df.set_index('Compound_ID')
|
82 |
+
|
83 |
+
final_return = mol_info_df
|
84 |
+
final_id = mol_ID
|
85 |
+
|
86 |
+
except Exception as error:
|
87 |
+
print('Something wrong with molecule input string...' + repr(error))
|
88 |
+
|
89 |
+
return final_return, final_id
|
90 |
+
|
91 |
+
|
92 |
+
def act_df_gen_mol_feature(mol_id, prot_id):
|
93 |
+
act_df = pd.DataFrame(
|
94 |
+
{'Protein_ID': prot_id, 'Compound_ID': mol_id}, index=[0])
|
95 |
+
|
96 |
+
return act_df
|
97 |
+
|
98 |
+
|
99 |
+
def compound_feature_gen_df_input(act_df, comp_df, comp_len=2048, comp_vec='morgan_fp_r2'):
|
100 |
+
act_df = pd.merge(act_df, comp_df, left_on='Compound_ID', right_index=True)
|
101 |
+
comp_feature = np.stack(act_df[comp_vec].map(lambda fp: fp.split("\t")))
|
102 |
+
comp_feature = comp_feature.astype('float')
|
103 |
+
return comp_feature
|
104 |
+
|
105 |
+
|
106 |
+
def model_prediction(compound_feature, enz_feature, model):
|
107 |
+
prediction_vals = model.predict([compound_feature, enz_feature])
|
108 |
+
|
109 |
+
return prediction_vals[0][0]
|
110 |
+
|
111 |
+
|
112 |
+
# loaded_model = load_modelfile('./../CNN_results/model_final.model')
|
113 |
+
|
114 |
+
# KEGG_compound_read = pd.read_csv('./../CNN_data/Final_test/kegg_compound.csv', index_col = 'Compound_ID')
|
115 |
+
# kegg_df = KEGG_compound_read.reset_index()
|
116 |
+
|
117 |
+
|
118 |
+
def main():
|
119 |
+
loaded_model = load_modelfile('./../CNN_results_split_final/Final_model.model')
|
120 |
+
KEGG_compound_read = pd.read_csv('./../CNN_data/Final_test/kegg_compound.csv', index_col = 'Compound_ID')
|
121 |
+
kegg_df = KEGG_compound_read.reset_index()
|
122 |
+
# print(loaded_model.summary())
|
123 |
+
|
124 |
+
|
125 |
+
# def img_to_bytes(img_path):
|
126 |
+
# img_bytes = Path(img_path).read_bytes()
|
127 |
+
# encoded = base64.b64encode(img_bytes).decode()
|
128 |
+
# return encoded
|
129 |
+
# # st.title('dGPredictor')
|
130 |
+
|
131 |
+
# header_html = "<img src='../figures/header.png'>"
|
132 |
+
|
133 |
+
# st.markdown(
|
134 |
+
# header_html, unsafe_allow_html=True,
|
135 |
+
# )
|
136 |
+
|
137 |
+
|
138 |
+
enz_str ="A0A4P8WFA8:MTKRVLVTGGAGFLGSHLCERLLSEGHEVICLDNFGSGRRKNIKEFEDHPSFKVNDRDVRISESLPSVDRIYHLASRASPADFTQFPVNIALANTQGTRRLLDQARACDARMVFASTSEVYGDPKVHPQPETYTGNVNIRGARGCYDESKRFGETLTVAYQRKYDVDARTVRIFNTYGPRMRPDDGRVVPTFVTQALRGDDLTIYGDGEQTRSFCYVDDLIEGLISLMRVDNPEHNVYNIGKENERTIKELAYEVLGLTDTESDIVYEPLPEDDPGQRRPDITRAKTELDWEPKISLREGLEDTITYFDN"
|
139 |
+
|
140 |
+
comp_str = "C00149"
|
141 |
+
try:
|
142 |
+
prot_feature, prot_id = prot_feature_gen_from_str_input(enz_str)
|
143 |
+
kegg_id_flag = 1
|
144 |
+
comp_feature, comp_id = mol_feature_gen_from_str_input(comp_str, kegg_id_flag, kegg_df)
|
145 |
+
|
146 |
+
act_dataframe = act_df_gen_mol_feature(comp_id, prot_id)
|
147 |
+
# pdb.set_trace()
|
148 |
+
compound_feature = compound_feature_gen_df_input(act_dataframe, comp_feature)
|
149 |
+
|
150 |
+
except Exception as e:
|
151 |
+
print('Error somewhere...' + repr(e))
|
152 |
+
|
153 |
+
# print(type(compound_feature1))
|
154 |
+
# print(loaded_model.predict([compound_feature1, prot_feature]))
|
155 |
+
|
156 |
+
EnzRankScore = model_prediction(compound_feature, prot_feature, loaded_model)
|
157 |
+
es = EnzRankScore
|
158 |
+
|
159 |
+
print('something has happened')
|
160 |
+
print('EnzRank score')
|
161 |
+
print(es)
|
162 |
+
# print(type(es))
|
163 |
+
# print(type(EnzRankScore))
|
164 |
+
|
165 |
+
|
166 |
+
# graph = tf.compat.v1.get_default_graph()
|
167 |
+
# with graph.as_default():
|
168 |
+
# y = loaded_model.predict([compound_feature, prot_feature])
|
169 |
+
|
170 |
+
# print('-----------')
|
171 |
+
# print(y)
|
172 |
+
# print(type(y[0][0]))
|
173 |
+
# print(y[0][0])
|
174 |
+
|
175 |
+
if __name__ == '__main__':
|
176 |
+
main()
|