Spaces:
Running
Running
import gradio as gr | |
import torch | |
import pandas as pd | |
import matplotlib.pyplot as plt | |
import numpy as np | |
from scipy.stats import norm | |
from .init_model import model, all_index, valid_subsections | |
from .blocks import upload_pdb_button, parse_pdb_file | |
tmp_file_path = "/tmp/results.tsv" | |
tmp_plot_path = "/tmp/histogram.svg" | |
# Samples for input | |
samples = { | |
"sequence": [ | |
["MSATAEQNARNPKGKGGFARTVSQRKRKRLFLIGGALAVLAVAVGLMLTAFNQDIRFFRTPADLTEQDMTSGARFRLGGLVEEGSVSRTGSELRFTVTDTIKTVKVVFEGIPPDLFREGQGVVAEGRFGSDGLFRADNVLAKHDENYVPKDLADSLKKKGVWEGK"], | |
["MITLDWEKANGLITTVVQDATTKQVLMVAYMNQESLAKTMATGETWFWSRSRKTLWHKGATSGNIQTVKTIAVDCDADTLLVTVDPAGPACHTGHISCFYRHYPEGKDLT"], | |
["MDLKQYVSEVQDWPKPGVSFKDITTIMDNGEAYGYATDKIVEYAKDRDVDIVVGPEARGFIIGCPVAYSMGIGFAPVRKEGKLPREVIRYEYDLEYGTNVLTMHKDAIKPGQRVLITDDLLATGGTIEAAIKLVEKLGGIVVGIAFIIELKYLNGIEKIKDYDVMSLISYDE"] | |
], | |
"structure": [ | |
["dddddddddddddddpdpppvcppvnvvvvvvvvvvvvvvvvvvvvvvvvvvqdpqdedeqvrddpcqqpvqhkhkykafwappqwdddpqkiwtwghnppgiaieieghdappqddhrfikifiaghdpvrhtygdhidtdddpddddvvnvvvcvvvvndpdd"], | |
["dddadcpvpvqkakefeaeppprdtadiaiagpvqvvvcvvpqwhwgqdpvvrdidgqcpvpvqiwrwddwdaddnrryiytythtpahsdpvrhvhpppadvvgpddpd"], | |
["dplvvqwdwdaqpphhpdtdthcvscvvppvslvvqlvvvlvvcvvqvaqeeeeepdqrcsnrvsscvvvvhyywykyfpppddaawdwdwdddppgitiiithlpseaaageyeyegaeqalqprvlrvvvrcvvnnyddaeyeyqeyevcrvncvsvvvhhydyvyydpd"] | |
], | |
"text": [ | |
["Proteins with zinc bindings."], | |
["Proteins locating at cell membrane."], | |
["Protein that serves as an enzyme."] | |
], | |
} | |
def clear_results(): | |
return "", gr.update(visible=False), gr.update(visible=False) | |
def plot(scores) -> None: | |
""" | |
Plot the distribution of scores and fit a normal distribution. | |
Args: | |
scores: List of scores | |
""" | |
plt.hist(scores, bins=100, density=True, alpha=0.6) | |
plt.title('Distribution of similarity scores in the database', fontsize=15) | |
plt.xlabel('Similarity score', fontsize=15) | |
plt.ylabel('Density', fontsize=15) | |
y_ed = plt.gca().get_ylim()[-1] | |
plt.ylim(-0.05, y_ed) | |
# Add note | |
x_st = plt.gca().get_xlim()[0] | |
text = ("Note: For the \"UniRef50\" and \"Uncharacterized\" databases, the figure illustrates\n " | |
"only top-ranked clusters (identified using Faiss), whereas for other databases, it\n " | |
"displays the distribution across all samples.") | |
plt.text(x_st, -0.04, text, fontsize=8) | |
mu, std = norm.fit(scores) | |
# Plot the Gaussian | |
xmin, xmax = plt.xlim() | |
_, ymax = plt.ylim() | |
x = np.linspace(xmin, xmax, 100) | |
p = norm.pdf(x, mu, std) | |
plt.plot(x, p) | |
# Plot total number of scores | |
plt.text(xmax, 0.9*ymax, f"Total number: {len(scores)}", ha='right', fontsize=12) | |
# Convert the plot to svg format | |
plt.savefig(tmp_plot_path) | |
plt.cla() | |
# Search from database | |
def search(input: str, nprobe: int, topk: int, input_type: str, query_type: str, subsection_type: str, db: str): | |
print(f"Input type: {input_type}\n Output type: {query_type}\nDatabase: {db}\nSubsection: {subsection_type}") | |
input_modality = input_type.replace("sequence", "protein") | |
with torch.no_grad(): | |
input_embedding = getattr(model, f"get_{input_modality}_repr")([input]).cpu().numpy() | |
if query_type == "text": | |
index = all_index["text"][db][subsection_type]["index"] | |
ids = all_index["text"][db][subsection_type]["ids"] | |
else: | |
index = all_index[query_type][db]["index"] | |
ids = all_index[query_type][db]["ids"] | |
if hasattr(index, "nprobe"): | |
if index.nlist < nprobe: | |
raise gr.Error(f"The number of clusters to search must be less than or equal to the number of clusters in the index ({index.nlist}).") | |
else: | |
index.nprobe = nprobe | |
if topk > index.ntotal: | |
raise gr.Error(f"You cannot retrieve more than the database size ({index.ntotal}).") | |
# Retrieve all scores to plot the distribution | |
scores, ranks = index.search(input_embedding, index.ntotal) | |
scores, ranks = scores[0], ranks[0] | |
# Remove inf values | |
selector = scores > -1 | |
scores = scores[selector] | |
ranks = ranks[selector] | |
scores = scores / model.temperature.item() | |
plot(scores) | |
top_scores = scores[:topk] | |
top_ranks = ranks[:topk] | |
# ranks = [list(range(topk))] | |
# ids = ["P12345"] * topk | |
# scores = torch.randn(topk).tolist() | |
# Write the results to a temporary file for downloading | |
with open(tmp_file_path, "w") as w: | |
w.write("Id\tMatching score\n") | |
for i in range(topk): | |
rank = top_ranks[i] | |
w.write(f"{ids[rank]}\t{top_scores[i]}\n") | |
# Get topk ids | |
topk_ids = [] | |
for rank in top_ranks: | |
now_id = ids[rank] | |
if query_type == "text": | |
topk_ids.append(now_id.replace("|", "\\|")) | |
else: | |
if db != "PDB": | |
# Provide link to uniprot website | |
topk_ids.append(f"[{now_id}](https://www.uniprot.org/uniprotkb/{now_id})") | |
else: | |
# Provide link to pdb website | |
pdb_id = now_id.split("-")[0] | |
topk_ids.append(f"[{now_id}](https://www.rcsb.org/structure/{pdb_id})") | |
limit = 1000 | |
df = pd.DataFrame({"Id": topk_ids[:limit], "Matching score": top_scores[:limit]}) | |
if len(topk_ids) > limit: | |
info_df = pd.DataFrame({"Id": ["Download the file to check all results"], "Matching score": ["..."]}, | |
index=[1000]) | |
df = pd.concat([df, info_df], axis=0) | |
output = df.to_markdown() | |
return (output, | |
gr.DownloadButton(label="Download results", value=tmp_file_path, visible=True, scale=0), | |
gr.update(value=tmp_plot_path, visible=True)) | |
def change_input_type(choice: str): | |
# Change examples if input type is changed | |
global samples | |
# Set visibility of upload button | |
if choice == "text": | |
visible = False | |
else: | |
visible = True | |
return gr.update(samples=samples[choice]), "", gr.update(visible=visible), gr.update(visible=visible) | |
# Load example from dataset | |
def load_example(example_id): | |
return example_id[0] | |
# Change the visibility of subsection type | |
def change_output_type(query_type: str, subsection_type: str): | |
db_type = list(all_index[query_type].keys())[0] | |
nprobe_visible = check_index_ivf(query_type, db_type, subsection_type) | |
subsection_visible = True if query_type == "text" else False | |
return ( | |
gr.update(visible=subsection_visible), | |
gr.update(visible=nprobe_visible), | |
gr.update(choices=list(all_index[query_type].keys()), value=db_type) | |
) | |
def check_index_ivf(index_type: str, db: str, subsection_type: str = None) -> bool: | |
""" | |
Check if the index is of IVF type. | |
Args: | |
index_type: Type of index. | |
subsection_type: If the "index_type" is "text", get the index based on the subsection type. | |
Returns: | |
Whether the index is of IVF type or not. | |
""" | |
if index_type == "sequence": | |
index = all_index["sequence"][db]["index"] | |
elif index_type == "structure": | |
index = all_index["structure"][db]["index"] | |
elif index_type == "text": | |
index = all_index["text"][db][subsection_type]["index"] | |
# nprobe_visible = True if hasattr(index, "nprobe") else False | |
# return nprobe_visible | |
return False | |
def change_db_type(query_type: str, subsection_type: str, db_type: str): | |
""" | |
Change the database to search. | |
Args: | |
query_type: The output type. | |
db_type: The database to search. | |
""" | |
if query_type == "text": | |
subsection_update = gr.update(choices=list(valid_subsections[db_type]), value="Function") | |
else: | |
subsection_update = gr.update(visible=False) | |
nprobe_visible = check_index_ivf(query_type, db_type, subsection_type) | |
return subsection_update, gr.update(visible=nprobe_visible) | |
# Build the searching block | |
def build_search_module(): | |
gr.Markdown(f"# Search from database") | |
with gr.Row(equal_height=True): | |
with gr.Column(): | |
# Set input type | |
input_type = gr.Radio(["sequence", "structure", "text"], label="Input type (e.g. 'text' means searching based on text descriptions)", value="text") | |
with gr.Row(): | |
# Set output type | |
query_type = gr.Radio( | |
["sequence", "structure", "text"], | |
label="Output type (e.g. 'sequence' means returning qualified sequences)", | |
value="sequence", | |
scale=2, | |
) | |
# If the output type is "text", provide an option to choose the subsection of text | |
text_db = list(all_index["text"].keys())[0] | |
sequence_db = list(all_index["sequence"].keys())[0] | |
subsection_type = gr.Dropdown(valid_subsections[text_db], label="Subsection of text", value="Function", | |
interactive=True, visible=False, scale=0) | |
db_type = gr.Dropdown(all_index["sequence"].keys(), label="Database", value=sequence_db, | |
interactive=True, visible=True, scale=0) | |
with gr.Row(): | |
# Input box | |
input = gr.Text(label="Input") | |
# Provide an upload button to upload a pdb file | |
upload_btn, chain_box = upload_pdb_button(visible=False, chain_visible=False) | |
upload_btn.upload(parse_pdb_file, inputs=[input_type, upload_btn, chain_box], outputs=[input]) | |
# If the index is of IVF type, provide an option to choose the number of clusters. | |
nprobe_visible = check_index_ivf(query_type.value, db_type.value) | |
nprobe = gr.Slider(1, 1000000, 1000, step=1, visible=nprobe_visible, | |
label="Number of clusters to search (lower value for faster search and higher value for more accurate search)") | |
# Add event listener to output type | |
query_type.change(fn=change_output_type, inputs=[query_type, subsection_type], | |
outputs=[subsection_type, nprobe, db_type]) | |
# Add event listener to db type | |
db_type.change(fn=change_db_type, inputs=[query_type, subsection_type, db_type], | |
outputs=[subsection_type, nprobe]) | |
# Choose topk results | |
topk = gr.Slider(1, 1000000, 5, step=1, label="Retrieve top k results") | |
# Provide examples | |
examples = gr.Dataset(samples=samples["text"], components=[input], label="Input examples") | |
# Add click event to examples | |
examples.click(fn=load_example, inputs=[examples], outputs=input) | |
# Change examples based on input type | |
input_type.change(fn=change_input_type, inputs=[input_type], outputs=[examples, input, upload_btn, chain_box]) | |
with gr.Row(): | |
search_btn = gr.Button(value="Search") | |
clear_btn = gr.Button(value="Clear") | |
with gr.Row(): | |
with gr.Column(): | |
results = gr.Markdown(label="results", height=450) | |
download_btn = gr.DownloadButton(label="Download results", visible=False) | |
# Plot the distribution of scores | |
histogram = gr.Image(label="Histogram of matching scores", type="filepath", scale=1, visible=False) | |
search_btn.click(fn=search, inputs=[input, nprobe, topk, input_type, query_type, subsection_type, db_type], | |
outputs=[results, download_btn, histogram]) | |
clear_btn.click(fn=clear_results, outputs=[results, download_btn, histogram]) |