predict protein sequence using esm from bio-embeddings

app.py

@@ -1,8 +1,10 @@
 import os
 import sys
+import torch
 import numpy as np 
 import pandas as pd
 import streamlit as st
+import bio_embeddings.embed
 
 from rdkit import Chem
 from rdkit.Chem import Draw
@@ -183,6 +185,16 @@ def retrieval():
         
 
 def display_protein():
+    st.markdown('##')
+
+    st.markdown('### Target')
+    sequence = st.text_input('Enter the amino-acid sequence of the query protein target', value='HXHVWPVQDAKARFSEFLDACITEGPQIVSRRGAEEAVLVPIGEWRRLQAAA', placeholder='HXHVWPVQDAKARFSEFLDACITEGPQIVSRRGAEEAVLVPIGEWRRLQAAA')
+    
+    if sequence:
+        embeddings = bio_embeddings.embed(sequence, "esm")
+        coordinates = embeddings["esm"].detach().numpy()
+        st.write(coordinates)
+    
     """
     sequence = st.text_input("Enter the amino-acid sequence of the query protein target", value="HXHVWPVQDAKARFSEFLDACITEGPQIVSRRGAEEAVLVPIGEWRRLQAAA", placeholder="HXHVWPVQDAKARFSEFLDACITEGPQIVSRRGAEEAVLVPIGEWRRLQAAA")
     
@@ -248,8 +260,9 @@ def display_protein():
 
 page_names_to_func = {
     'About': about_page,
-    #'Display DTI': display_dti,
-    #'Retrieve Top-k': retrieval
+    'Display DTI': display_dti,
+    'Retrieve Top-k': retrieval,
+    'Diplay Protein': display_dti
 }
 
 selected_page = st.sidebar.selectbox('Choose function', page_names_to_func.keys())