Spaces:
Runtime error
Runtime error
File size: 3,345 Bytes
f3ea76e e9fd832 f3ea76e |
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 |
import gradio as gr
from transformers import AutoTokenizer, EsmForMaskedLM
import torch
import matplotlib.pyplot as plt
import numpy as np
import os
def generate_heatmap(protein_sequence, start_pos=1, end_pos=None):
# Load the model and tokenizer
model_name = "facebook/esm2_t6_8M_UR50D"
tokenizer = AutoTokenizer.from_pretrained(model_name)
model = EsmForMaskedLM.from_pretrained(model_name)
# Tokenize the input sequence
input_ids = tokenizer.encode(protein_sequence, return_tensors="pt")
sequence_length = input_ids.shape[1] - 2 # Excluding the special tokens
# Adjust end position if not specified
if end_pos is None:
end_pos = sequence_length
# List of amino acids
amino_acids = list("ACDEFGHIKLMNPQRSTVWY")
# Initialize heatmap
heatmap = np.zeros((20, end_pos - start_pos + 1))
# Calculate LLRs for each position and amino acid
for position in range(start_pos, end_pos + 1):
# Mask the target position
masked_input_ids = input_ids.clone()
masked_input_ids[0, position] = tokenizer.mask_token_id
# Get logits for the masked token
with torch.no_grad():
logits = model(masked_input_ids).logits
# Calculate log probabilities
probabilities = torch.nn.functional.softmax(logits[0, position], dim=0)
log_probabilities = torch.log(probabilities)
# Get the log probability of the wild-type residue
wt_residue = input_ids[0, position].item()
log_prob_wt = log_probabilities[wt_residue].item()
# Calculate LLR for each variant
for i, amino_acid in enumerate(amino_acids):
log_prob_mt = log_probabilities[tokenizer.convert_tokens_to_ids(amino_acid)].item()
heatmap[i, position - start_pos] = log_prob_mt - log_prob_wt
# Visualize the heatmap
plt.figure(figsize=(15, 5))
plt.imshow(heatmap, cmap="viridis_r", aspect="auto")
plt.xticks(range(end_pos - start_pos + 1), list(protein_sequence[start_pos-1:end_pos]))
plt.yticks(range(20), amino_acids)
plt.xlabel("Position in Protein Sequence")
plt.ylabel("Amino Acid Mutations")
plt.title("Predicted Effects of Mutations on Protein Sequence (LLR)")
plt.colorbar(label="Log Likelihood Ratio (LLR)")
plt.show()
# Save the plot to a temporary file and return the file path
temp_file = "temp_heatmap.png"
plt.savefig(temp_file)
plt.close()
return temp_file
def heatmap_interface(sequence, start, end):
# Ensure start and end positions are within bounds
if start < 1 or end > len(sequence):
return "Start or end position is out of bounds."
# Generate heatmap
heatmap_path = generate_heatmap(sequence, start, end)
return heatmap_path
# Define the Gradio interface
iface = gr.Interface(
fn=heatmap_interface,
inputs=[
gr.Textbox(lines=2, placeholder="Enter Protein Sequence Here..."),
gr.Number(label="Start Position", value=1), # Use 'value' instead of 'default'
gr.Number(label="End Position", value=len("MAPLRKTYVLKLYVAGNTPNSVRALKTLNNILEKEFKGVYALKVIDVLKNPQLAEEDKILATPTLAKVLPPPVRRIIGDLSNREKVLIGLDLLYEEIGDQAEDDLGLE")) # Example default end position
],
outputs="image",
live=True
)
# Run the Gradio app
iface.launch()
|