---
license: mit
---

# ESM-2 for Post Translational Modification

## Metrics

```python
Train metrics:
{'eval_loss': 0.024510689079761505,
'eval_accuracy': 0.9908227849618837,
'eval_precision': 0.22390420883031378,
'eval_recall': 0.9793229461354229,
'eval_f1': 0.3644773616334614,
'eval_auc': 0.9850883581685357,
'eval_mcc': 0.4660172779827273}

Test metrics:
{'eval_loss': 0.1606895923614502,
'eval_accuracy': 0.9363938912290479,
'eval_precision': 0.04428881619840198,
'eval_recall': 0.7708102070506146,
'eval_f1': 0.08376472210171558,
'eval_auc': 0.8539155251667717,
'eval_mcc': 0.17519724897930178}
```

## Using the Model

To use this model, firts run:

```
!pip install transformers -q
!pip install peft -q
```

Then run the following on your protein sequence to predict post translational modification sites:

```python
from transformers import AutoModelForTokenClassification, AutoTokenizer
from peft import PeftModel
import torch

# Path to the saved LoRA model
model_path = "AmelieSchreiber/esm2_t6_8M_ptm_lora_500K"
# ESM2 base model
base_model_path = "facebook/esm2_t6_8M_UR50D"

# Load the model
base_model = AutoModelForTokenClassification.from_pretrained(base_model_path)
loaded_model = PeftModel.from_pretrained(base_model, model_path)

# Ensure the model is in evaluation mode
loaded_model.eval()

# Load the tokenizer
loaded_tokenizer = AutoTokenizer.from_pretrained(base_model_path)

# Protein sequence for inference
protein_sequence = "MAVPETRPNHTIYINNLNEKIKKDELKKSLHAIFSRFGQILDILVSRSLKMRGQAFVIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAKMKGT"  # Replace with your actual sequence

# Tokenize the sequence
inputs = loaded_tokenizer(protein_sequence, return_tensors="pt", truncation=True, max_length=1024, padding='max_length')

# Run the model
with torch.no_grad():
    logits = loaded_model(**inputs).logits

# Get predictions
tokens = loaded_tokenizer.convert_ids_to_tokens(inputs["input_ids"][0])  # Convert input ids back to tokens
predictions = torch.argmax(logits, dim=2)

# Define labels
id2label = {
    0: "No ptm site",
    1: "ptm site"
}

# Print the predicted labels for each token
for token, prediction in zip(tokens, predictions[0].numpy()):
    if token not in ['<pad>', '<cls>', '<eos>']:
        print((token, id2label[prediction]))
```